


| Basic Information | |
|---|---|
| Family ID | F105325 |
| Family Type | Metagenome |
| Number of Sequences | 100 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MPTYLRRFYIQKASKFYEEEKKQYDKASKKKSGISRPGIPRG |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 60.00 % |
| % of genes near scaffold ends (potentially truncated) | 39.00 % |
| % of genes from short scaffolds (< 2000 bps) | 80.00 % |
| Associated GOLD sequencing projects | 82 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (76.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (48.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (89.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (90.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.00% β-sheet: 0.00% Coil/Unstructured: 60.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF04984 | Phage_sheath_1 | 4.00 |
| PF06841 | Phage_T4_gp19 | 3.00 |
| PF01434 | Peptidase_M41 | 1.00 |
| PF01583 | APS_kinase | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG3497 | Phage tail sheath protein FI | Mobilome: prophages, transposons [X] | 4.00 |
| COG0465 | ATP-dependent Zn proteases | Posttranslational modification, protein turnover, chaperones [O] | 1.00 |
| COG0529 | Adenylylsulfate kinase or related kinase | Inorganic ion transport and metabolism [P] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 76.00 % |
| All Organisms | root | All Organisms | 24.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000142|LPaug09P16500mDRAFT_c1044698 | Not Available | 649 | Open in IMG/M |
| 3300000172|SI34jun09_200mDRAFT_c1038930 | Not Available | 901 | Open in IMG/M |
| 3300000949|BBAY94_10056519 | Not Available | 1089 | Open in IMG/M |
| 3300001740|JGI24656J20076_1032449 | Not Available | 561 | Open in IMG/M |
| 3300002482|JGI25127J35165_1053251 | Not Available | 872 | Open in IMG/M |
| 3300002483|JGI25132J35274_1001230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 6774 | Open in IMG/M |
| 3300002488|JGI25128J35275_1004543 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 3847 | Open in IMG/M |
| 3300002518|JGI25134J35505_10014955 | Not Available | 2476 | Open in IMG/M |
| 3300004109|Ga0008650_1017076 | Not Available | 2113 | Open in IMG/M |
| 3300004111|Ga0008651_10049888 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1482 | Open in IMG/M |
| 3300005400|Ga0066867_10196683 | Not Available | 739 | Open in IMG/M |
| 3300005404|Ga0066856_10455497 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 546 | Open in IMG/M |
| 3300005424|Ga0066826_10011048 | Not Available | 4003 | Open in IMG/M |
| 3300005424|Ga0066826_10061899 | Not Available | 1410 | Open in IMG/M |
| 3300005425|Ga0066859_10022910 | Not Available | 1915 | Open in IMG/M |
| 3300005428|Ga0066863_10340438 | Not Available | 517 | Open in IMG/M |
| 3300005430|Ga0066849_10300785 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 613 | Open in IMG/M |
| 3300005594|Ga0066839_10285111 | Not Available | 571 | Open in IMG/M |
| 3300005608|Ga0066840_10103197 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 594 | Open in IMG/M |
| 3300005948|Ga0066380_10248401 | Not Available | 543 | Open in IMG/M |
| 3300005969|Ga0066369_10056606 | Not Available | 1383 | Open in IMG/M |
| 3300005971|Ga0066370_10235492 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 646 | Open in IMG/M |
| 3300006002|Ga0066368_10187295 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 706 | Open in IMG/M |
| 3300006002|Ga0066368_10236871 | Not Available | 620 | Open in IMG/M |
| 3300006019|Ga0066375_10243509 | Not Available | 556 | Open in IMG/M |
| 3300006076|Ga0081592_1172076 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 739 | Open in IMG/M |
| 3300006091|Ga0082018_1105056 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 502 | Open in IMG/M |
| 3300006339|Ga0068481_1038675 | Not Available | 755 | Open in IMG/M |
| 3300006735|Ga0098038_1052167 | Not Available | 1475 | Open in IMG/M |
| 3300006738|Ga0098035_1161140 | Not Available | 759 | Open in IMG/M |
| 3300006754|Ga0098044_1179522 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium SCGC AAA027-F04 | 839 | Open in IMG/M |
| 3300006754|Ga0098044_1300423 | Not Available | 614 | Open in IMG/M |
| 3300006902|Ga0066372_10564220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium SCGC AAA027-F04 | 675 | Open in IMG/M |
| 3300006921|Ga0098060_1060054 | Not Available | 1111 | Open in IMG/M |
| 3300006927|Ga0098034_1032274 | Not Available | 1577 | Open in IMG/M |
| 3300006927|Ga0098034_1238569 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 503 | Open in IMG/M |
| 3300006929|Ga0098036_1166356 | Not Available | 672 | Open in IMG/M |
| 3300009706|Ga0115002_10439179 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 959 | Open in IMG/M |
| 3300009790|Ga0115012_10562213 | Not Available | 899 | Open in IMG/M |
| 3300010155|Ga0098047_10161577 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 865 | Open in IMG/M |
| 3300010883|Ga0133547_10684466 | Not Available | 2034 | Open in IMG/M |
| 3300012920|Ga0160423_10226447 | Not Available | 1298 | Open in IMG/M |
| 3300012928|Ga0163110_10017109 | Not Available | 4194 | Open in IMG/M |
| 3300012928|Ga0163110_10529807 | Not Available | 902 | Open in IMG/M |
| 3300012928|Ga0163110_11020641 | Not Available | 659 | Open in IMG/M |
| 3300012936|Ga0163109_10231065 | Not Available | 1356 | Open in IMG/M |
| 3300012952|Ga0163180_10116096 | Not Available | 1731 | Open in IMG/M |
| 3300012952|Ga0163180_10181903 | Not Available | 1422 | Open in IMG/M |
| 3300017703|Ga0181367_1009456 | Not Available | 1794 | Open in IMG/M |
| 3300017714|Ga0181412_1085644 | Not Available | 753 | Open in IMG/M |
| 3300017738|Ga0181428_1081196 | Not Available | 756 | Open in IMG/M |
| 3300017775|Ga0181432_1303046 | Not Available | 507 | Open in IMG/M |
| 3300017951|Ga0181577_10349805 | Not Available | 950 | Open in IMG/M |
| 3300018420|Ga0181563_10734882 | Not Available | 543 | Open in IMG/M |
| 3300020297|Ga0211490_1074881 | Not Available | 569 | Open in IMG/M |
| 3300020353|Ga0211613_1081979 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 757 | Open in IMG/M |
| 3300020364|Ga0211538_1021171 | Not Available | 2215 | Open in IMG/M |
| 3300020409|Ga0211472_10125876 | Not Available | 1018 | Open in IMG/M |
| 3300020410|Ga0211699_10018293 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 2743 | Open in IMG/M |
| 3300020411|Ga0211587_10110579 | Not Available | 1186 | Open in IMG/M |
| 3300020417|Ga0211528_10331197 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 567 | Open in IMG/M |
| 3300020436|Ga0211708_10005005 | Not Available | 4946 | Open in IMG/M |
| 3300020436|Ga0211708_10025031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED64 | 2267 | Open in IMG/M |
| 3300020438|Ga0211576_10000536 | Not Available | 31402 | Open in IMG/M |
| 3300020439|Ga0211558_10325071 | Not Available | 718 | Open in IMG/M |
| 3300020441|Ga0211695_10178683 | Not Available | 742 | Open in IMG/M |
| 3300020448|Ga0211638_10327750 | Not Available | 713 | Open in IMG/M |
| 3300020450|Ga0211641_10523162 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 564 | Open in IMG/M |
| 3300020457|Ga0211643_10045635 | Not Available | 2194 | Open in IMG/M |
| 3300020468|Ga0211475_10229934 | Not Available | 924 | Open in IMG/M |
| 3300020470|Ga0211543_10142178 | Not Available | 1207 | Open in IMG/M |
| 3300021980|Ga0232637_10349024 | Not Available | 714 | Open in IMG/M |
| (restricted) 3300022902|Ga0233429_1052433 | Not Available | 1885 | Open in IMG/M |
| (restricted) 3300022931|Ga0233433_10118326 | Not Available | 1264 | Open in IMG/M |
| (restricted) 3300024256|Ga0233446_1021082 | Not Available | 2589 | Open in IMG/M |
| (restricted) 3300024260|Ga0233441_1035109 | Not Available | 2082 | Open in IMG/M |
| 3300025084|Ga0208298_1000548 | Not Available | 15571 | Open in IMG/M |
| 3300025099|Ga0208669_1041037 | Not Available | 1088 | Open in IMG/M |
| 3300025114|Ga0208433_1036259 | Not Available | 1351 | Open in IMG/M |
| 3300025114|Ga0208433_1115338 | Not Available | 656 | Open in IMG/M |
| 3300025118|Ga0208790_1149868 | Not Available | 646 | Open in IMG/M |
| 3300025128|Ga0208919_1076059 | Not Available | 1107 | Open in IMG/M |
| 3300025132|Ga0209232_1104130 | Not Available | 954 | Open in IMG/M |
| 3300025141|Ga0209756_1031537 | Not Available | 2838 | Open in IMG/M |
| 3300025151|Ga0209645_1003933 | Not Available | 6699 | Open in IMG/M |
| 3300025547|Ga0209556_1066610 | Not Available | 846 | Open in IMG/M |
| 3300025873|Ga0209757_10046486 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1269 | Open in IMG/M |
| 3300026079|Ga0208748_1092983 | Not Available | 762 | Open in IMG/M |
| 3300026204|Ga0208521_1140689 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 618 | Open in IMG/M |
| 3300026261|Ga0208524_1040936 | Not Available | 1377 | Open in IMG/M |
| 3300027844|Ga0209501_10332237 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 922 | Open in IMG/M |
| 3300028173|Ga0257118_1026787 | Not Available | 1633 | Open in IMG/M |
| 3300028192|Ga0257107_1044891 | Not Available | 1373 | Open in IMG/M |
| 3300028277|Ga0257116_1046672 | Not Available | 1305 | Open in IMG/M |
| 3300028488|Ga0257113_1236039 | Not Available | 523 | Open in IMG/M |
| 3300029448|Ga0183755_1001640 | All Organisms → cellular organisms → Archaea | 12505 | Open in IMG/M |
| 3300031774|Ga0315331_10362552 | Not Available | 1063 | Open in IMG/M |
| 3300032820|Ga0310342_100038419 | Not Available | 3929 | Open in IMG/M |
| 3300032820|Ga0310342_102956420 | Not Available | 566 | Open in IMG/M |
| 3300034695|Ga0372840_090364 | Not Available | 911 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 48.00% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 18.00% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 5.00% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 4.00% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 4.00% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 3.00% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 3.00% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 2.00% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 2.00% |
| Marine | Environmental → Aquatic → Marine → Inlet → Unclassified → Marine | 2.00% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 2.00% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 1.00% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 1.00% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 1.00% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 1.00% |
| Hydrothermal Vent Fluids | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Hydrothermal Vent Fluids | 1.00% |
| Diffuse Hydrothermal Fluids | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Fluids | 1.00% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000142 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2009 P16 500m | Environmental | Open in IMG/M |
| 3300000172 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 34 06/16/09 200m | Environmental | Open in IMG/M |
| 3300000949 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94 | Host-Associated | Open in IMG/M |
| 3300001740 | Marine viral communities from the Deep Pacific Ocean - MSP-114 | Environmental | Open in IMG/M |
| 3300002482 | Marine viral communities from the Pacific Ocean - ETNP_2_30 | Environmental | Open in IMG/M |
| 3300002483 | Marine viral communities from the Pacific Ocean - ETNP_6_30 | Environmental | Open in IMG/M |
| 3300002488 | Marine viral communities from the Pacific Ocean - ETNP_2_60 | Environmental | Open in IMG/M |
| 3300002518 | Marine viral communities from the Pacific Ocean - ETNP_6_100 | Environmental | Open in IMG/M |
| 3300004109 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S2LV_150m_DNA | Environmental | Open in IMG/M |
| 3300004111 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S2LV_200m_DNA | Environmental | Open in IMG/M |
| 3300005400 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV261 | Environmental | Open in IMG/M |
| 3300005404 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV205 | Environmental | Open in IMG/M |
| 3300005424 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306SV49 | Environmental | Open in IMG/M |
| 3300005425 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV199 | Environmental | Open in IMG/M |
| 3300005428 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV253 | Environmental | Open in IMG/M |
| 3300005430 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV69 | Environmental | Open in IMG/M |
| 3300005594 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV82 | Environmental | Open in IMG/M |
| 3300005608 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302PF84A | Environmental | Open in IMG/M |
| 3300005948 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_O2min_ad_571m_LV | Environmental | Open in IMG/M |
| 3300005969 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_Bottom_ad_4513_LV_A | Environmental | Open in IMG/M |
| 3300005971 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_SurfaceA_ad_5m_LV_A | Environmental | Open in IMG/M |
| 3300006002 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_NADW_ad_2505m_LV_A | Environmental | Open in IMG/M |
| 3300006019 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_NADW_ad_2500m_LV_A | Environmental | Open in IMG/M |
| 3300006076 | Microbial communities in diffuse hydrothermal fluids of Manus Basin, Bismarck Sea ? fluid A | Environmental | Open in IMG/M |
| 3300006091 | Marine microbial communities from the Eastern Tropical South Pacific Oxygen Minumum Zone, cruise NBP1315, 2013 - sample NBP125 | Environmental | Open in IMG/M |
| 3300006339 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT232_3_0500m | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006738 | Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG | Environmental | Open in IMG/M |
| 3300006754 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG | Environmental | Open in IMG/M |
| 3300006902 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_250_ad_251m_LV_A | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006927 | Marine viral communities from the Subarctic Pacific Ocean - 2_ETSP_OMZ_AT15125 metaG | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300009706 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_86 | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300010155 | Marine viral communities from the Subarctic Pacific Ocean - 12_ETSP_OMZ_AT15267 metaG | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
| 3300012936 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaG | Environmental | Open in IMG/M |
| 3300012952 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 Metagenome | Environmental | Open in IMG/M |
| 3300017703 | Marine viral communities from the Subarctic Pacific Ocean - ?Lowphox_02 viral metaG | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017738 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12 | Environmental | Open in IMG/M |
| 3300017775 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 55 SPOT_SRF_2014-07-17 | Environmental | Open in IMG/M |
| 3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020297 | Marine microbial communities from Tara Oceans - TARA_B000000437 (ERX555970-ERR598979) | Environmental | Open in IMG/M |
| 3300020353 | Marine microbial communities from Tara Oceans - TARA_B100000686 (ERX556093-ERR598998) | Environmental | Open in IMG/M |
| 3300020364 | Marine microbial communities from Tara Oceans - TARA_B100000097 (ERX556021-ERR599037) | Environmental | Open in IMG/M |
| 3300020409 | Marine microbial communities from Tara Oceans - TARA_A100001403 (ERX555912-ERR599106) | Environmental | Open in IMG/M |
| 3300020410 | Marine microbial communities from Tara Oceans - TARA_B100000519 (ERX555959-ERR599148) | Environmental | Open in IMG/M |
| 3300020411 | Marine microbial communities from Tara Oceans - TARA_B100000131 (ERX556098-ERR599130) | Environmental | Open in IMG/M |
| 3300020417 | Marine microbial communities from Tara Oceans - TARA_B100000073 (ERX556034-ERR599082) | Environmental | Open in IMG/M |
| 3300020436 | Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300020439 | Marine microbial communities from Tara Oceans - TARA_B100001939 (ERX556062-ERR599029) | Environmental | Open in IMG/M |
| 3300020441 | Marine prokaryotic communities collected during Tara Oceans survey from station TARA_078 - TARA_B100000524 (ERX556088-ERR599006) | Environmental | Open in IMG/M |
| 3300020448 | Marine microbial communities from Tara Oceans - TARA_B100000941 (ERX555919-ERR598954) | Environmental | Open in IMG/M |
| 3300020450 | Marine microbial communities from Tara Oceans - TARA_B100000575 (ERX555933-ERR599077) | Environmental | Open in IMG/M |
| 3300020457 | Marine microbial communities from Tara Oceans - TARA_B100001113 (ERX555941-ERR599014) | Environmental | Open in IMG/M |
| 3300020468 | Marine microbial communities from Tara Oceans - TARA_A100000164 (ERX555914-ERR598993) | Environmental | Open in IMG/M |
| 3300020470 | Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX555976-ERR599053) | Environmental | Open in IMG/M |
| 3300021980 | Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Burke_FS924 _150kmer | Environmental | Open in IMG/M |
| 3300022902 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_135_MG | Environmental | Open in IMG/M |
| 3300022931 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_100_MG | Environmental | Open in IMG/M |
| 3300024256 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_120_MG | Environmental | Open in IMG/M |
| 3300024260 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_135_MG | Environmental | Open in IMG/M |
| 3300025084 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025099 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025114 | Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025118 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025141 | Marine viral communities from the Pacific Ocean - ETNP_6_85 (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025547 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_150m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025873 | Marine viral communities from the Pacific Ocean - ETNP_6_1000 (SPAdes) | Environmental | Open in IMG/M |
| 3300026079 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_Bottom_ad_4513_LV_A (SPAdes) | Environmental | Open in IMG/M |
| 3300026204 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306SV47 (SPAdes) | Environmental | Open in IMG/M |
| 3300026261 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV61 (SPAdes) | Environmental | Open in IMG/M |
| 3300027844 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300028173 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_150m | Environmental | Open in IMG/M |
| 3300028192 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_500m | Environmental | Open in IMG/M |
| 3300028277 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_120m | Environmental | Open in IMG/M |
| 3300028488 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_1320m | Environmental | Open in IMG/M |
| 3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
| 3300031774 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 34915 | Environmental | Open in IMG/M |
| 3300032820 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - S1503-DNA-20-500_MG | Environmental | Open in IMG/M |
| 3300034695 | Seawater microbial communities from the Northeast subarctic Pacific Ocean - P26_June_2012_500m | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| LPaug09P16500mDRAFT_10446982 | 3300000142 | Marine | MPTYLRRFYIQSAQKFYEEEKKQYDKSNKKSGGISRPGIPRG* |
| SI34jun09_200mDRAFT_10389303 | 3300000172 | Marine | EVYNMPTYLRRFYIESASKFYEEEKKQYDKSNKKSGVSRPGIPRG* |
| BBAY94_100565192 | 3300000949 | Macroalgal Surface | MPTYLRRFYIAKASKFYDEEKKQMDKATKKAKGGGISRPGVTRGR* |
| JGI24656J20076_10324492 | 3300001740 | Deep Ocean | MPTYLRRFYIQSAAKFYEEEKKEYDKASKKKSGISRP |
| JGI25127J35165_10532512 | 3300002482 | Marine | MPTYLRRYYITKASKFYEEEKKQMDKAQKKGGISRPGITRGR* |
| JGI25132J35274_10012306 | 3300002483 | Marine | MPTYLRHFYIKKAQQYYDKEKEQYEKANKKSSSGISRPGITRGR* |
| JGI25128J35275_10045434 | 3300002488 | Marine | MPTYLRHFYIKKAQQYYEKEKEQIDKANKKHSSGISRPGISRGG* |
| JGI25134J35505_100149552 | 3300002518 | Marine | MPTYLRRFYIESASKFYEEEKKEYDKSSKKKSGISRPGIPRG* |
| Ga0008650_10170763 | 3300004109 | Marine | MPTYLRRFYIESASKFYEEEKKQYDKSNKKSGVSRPGIPRG* |
| Ga0008651_100498882 | 3300004111 | Marine | MPVYLRRFYIQSASEFYKEEKKEYEKSNKKSGISRPGIPRG* |
| Ga0066867_101966833 | 3300005400 | Marine | EVYNMPTYLRRFYIQSAAKFYEEEKKEYDKASKKKSGISRPGIPRG* |
| Ga0066856_104554971 | 3300005404 | Marine | MPTYLRRYYIQKASKYYEEEKKEMDKATKKKPSGISRPGISRGR* |
| Ga0066826_100110481 | 3300005424 | Marine | EVYNMPTYLRRFYIQSASKFYEEEKKQYDKASKKKSGISRPGIPRG* |
| Ga0066826_100618991 | 3300005424 | Marine | MPTYLRRFYIQSAAKFYEEEKKEYDKASKKKSGISRPGIPR |
| Ga0066859_100229102 | 3300005425 | Marine | MPTYLRRFYIQKASEFYEEEQKQIKKSNKKSGGISRPGIPRG* |
| Ga0066863_103404382 | 3300005428 | Marine | MPTYLRRFYIQSAAKFYEEEKKEYDKASKKKSGISRPGIPRG* |
| Ga0066849_103007852 | 3300005430 | Marine | MPTYLRRFYIQSASKFYENEKKEYDKANKKPSGLARPGIKRG* |
| Ga0066839_102851111 | 3300005594 | Marine | FTEVYNMPTYLRRFYIQSASKFYKDEKKEYDKSFKKKSGISRPGIPRG* |
| Ga0066840_101031971 | 3300005608 | Marine | MPVYLRQFYIKKAQQFYDSEKAQYEKANNKHSSGISRPGIQRGG* |
| Ga0066380_102484012 | 3300005948 | Marine | TYLRRFYIQSASKFYEEEKKQYDKANKKSSGISRPGIPRG* |
| Ga0066369_100566062 | 3300005969 | Marine | MPTYLRRFYIQAAAKFYEEEKKEYDKSSKKKSGGISRPGIPRG* |
| Ga0066370_102354922 | 3300005971 | Marine | MPTYLRRFYIKKAQEFYDNEKKEYDKANKKSSPGISRPGITRGR* |
| Ga0066368_101872951 | 3300006002 | Marine | MPTYLRRFYIKSASKFYEEEKKEYDKATKKKSGISRPGIPRG* |
| Ga0066368_102368712 | 3300006002 | Marine | MPTYLRRFYIQAAAKFYEEEKKEYDKSSKKKSGISRPGIPR |
| Ga0066375_102435091 | 3300006019 | Marine | MPTYLRRFYIQAAAKFYEEEKKEYDKSSKKKSGISRPGIPRR* |
| Ga0081592_11720762 | 3300006076 | Diffuse Hydrothermal Fluids | MPTYLRRFYIQSASKFYEEEKKEYNKSSKKKSGVSRPGIPRG* |
| Ga0082018_11050562 | 3300006091 | Marine | MPTYLRRFYIQSAQKFYEEEKKEYDKSSKKKSGISRPGIPRG* |
| Ga0068481_10386751 | 3300006339 | Marine | MPTYLRRFYIQSAVKFYEEEKKEYNKSNKKSGITRPGIPRH* |
| Ga0098038_10521672 | 3300006735 | Marine | MPTYLRRFYIQKASQFYKEEKAAYDKQGKKSSGISRPGISRG* |
| Ga0098035_11611403 | 3300006738 | Marine | FTEVYNMPVYLRRFYIQKASEFYEEEQKQIKKSNKKSGGISRPGIPRG* |
| Ga0098044_11795222 | 3300006754 | Marine | MPTYLRRFYIQSASKFYEEEQKEYKKSSKKKSGISRPGIPRG* |
| Ga0098044_13004232 | 3300006754 | Marine | FNFTEVYNMPTYLRRFYIQSAAKFYEEEKKEYDKASKKKSGISRPGIPRG* |
| Ga0066372_105642201 | 3300006902 | Marine | MPTYLRRFYIQKASKFYEEEKKQYDKASKKKSGISRPGIPRG* |
| Ga0098060_10600543 | 3300006921 | Marine | RFYIKKAQQFYDSEKEQYDKANKKQSPGISRPGVTRGR* |
| Ga0098034_10322743 | 3300006927 | Marine | YLRRFYIQSAAKFYEEEKKEYDKASKKKSGISRPGIPRG* |
| Ga0098034_12385691 | 3300006927 | Marine | MPVYLRRFYIQKASEFYEEEQKQIKKSNKKSGGISRPGIPRG* |
| Ga0098036_11663562 | 3300006929 | Marine | MPTYLRHFYIKKAQQFYEKEKEQYDKANKKSSSGISRPGVSRGR* |
| Ga0115002_104391793 | 3300009706 | Marine | MPVYLRRFYTQSASEFYKEEKKEYDKSNKKSGGVSRPGIPRG* |
| Ga0115012_105622132 | 3300009790 | Marine | MPTYLRRFYIAKASSFYDEEKKQMDKATKKSKAGGLSRPGITRGR* |
| Ga0098047_101615772 | 3300010155 | Marine | MPVYLRRFYIQKASEFYEEEQKQIKKSNKKSGGISRPG |
| Ga0133547_106844661 | 3300010883 | Marine | MPTYLRRFYIQSASEFYKEEKKEYEKSNKKSGISRPGIPRG* |
| Ga0160423_102264472 | 3300012920 | Surface Seawater | MPTYLRRFYIAKASKFYEEEKKEMDKATKKAKGGGISRPGVTRGR* |
| Ga0163110_100171092 | 3300012928 | Surface Seawater | MPTYLRRFYIAKASSFYDEEKKQMDKATKKAKSGGISRPGVTRGR* |
| Ga0163110_105298071 | 3300012928 | Surface Seawater | MPTYLRRFYIKKAQEHYDTEKKEYDKANKKSSPGISRPGITRGR* |
| Ga0163110_110206411 | 3300012928 | Surface Seawater | NHTEVYEMPTYLRRYYIKKAEQFYKEEKKQMDKAQKKGGISRPGITRGR* |
| Ga0163109_102310652 | 3300012936 | Surface Seawater | MPTYLRRFYIAKASSFYDEEKKQMDKATKKAKGGGISRPGVTRGR* |
| Ga0163180_101160964 | 3300012952 | Seawater | MPTYLRRYYITKASKFYDKEKEQMDKATKKSKAGGLSRPGIPRGR* |
| Ga0163180_101819032 | 3300012952 | Seawater | MPTYLRHFYIKKAQQYYEKEKEQIDKANKKPSGISRPGISRGG* |
| Ga0181367_10094563 | 3300017703 | Marine | TYLRRFYIESASKFYEEEKKEYDKASKKKSGISRPGIPRG |
| Ga0181412_10856442 | 3300017714 | Seawater | MPTYLRRFYIQKASQFYKEEKAAYDKQGKKSSGISRPGI |
| Ga0181428_10811961 | 3300017738 | Seawater | MPTYLRRFYIQKASQFYKEEKAAYDKQGKKSSGISRP |
| Ga0181432_13030462 | 3300017775 | Seawater | LRRFYIQSASKFYEEEQKEYKKSSKKKSGISRPGIPRG |
| Ga0181577_103498051 | 3300017951 | Salt Marsh | MPTYLRRFYIAKASKFYEEEKKEMDKATKKAKGGGISRPGVTRGR |
| Ga0181563_107348822 | 3300018420 | Salt Marsh | MPTYLRRFYIAKASKFYDEEKKQMDKATKKAKGGGISRPGVTRGR |
| Ga0211490_10748813 | 3300020297 | Marine | LRRYYITKASKHYEKEKEQMDKAQKKSKAGGISRPGITRGR |
| Ga0211613_10819792 | 3300020353 | Marine | MPTYLRRFYIQSAQKFYDEEKKEYDKANKKQTGISRPGIKRG |
| Ga0211538_10211712 | 3300020364 | Marine | MPTYLRRFYIQSAAKFYEEEKKEYDKASKKKSGISRPGIPRG |
| Ga0211472_101258762 | 3300020409 | Marine | MPTYLRRFYIAKASKFYDEEKKEMDKATKKAKGGGISRPGVTRGR |
| Ga0211699_100182932 | 3300020410 | Marine | MPTYLRRYYITKASKHYEKEKEQMDKAQKKSKAGGISRPGITRGR |
| Ga0211587_101105792 | 3300020411 | Marine | MPTYLRHFYIKKAQQYYEKEKEQIDKANKKPSGISRPGISRGG |
| Ga0211528_103311972 | 3300020417 | Marine | MPTYLRRFYIKKAQEHYDNEKKEYDKANKKSSPGISRPGITRGR |
| Ga0211708_100050054 | 3300020436 | Marine | MPTYLRRYYIQKASKFYEEEKKEMDKATKKKPSGISRPGISRGR |
| Ga0211708_100250313 | 3300020436 | Marine | TYLRRYYITKASKHYEKEKEQMDKAQKKSKAGGISRPGITRGR |
| Ga0211576_1000053615 | 3300020438 | Marine | MPTYLRRFYIQKASQFYKEEKAAYDKQGKKSSGISRPGISRG |
| Ga0211558_103250712 | 3300020439 | Marine | MPTYLRRFYIKKAQEFYDNEKKEYDKANKKSSPGISRPGIT |
| Ga0211695_101786832 | 3300020441 | Marine | MPTYLRRYYITKASKHYEKEKEQMDKAQKKSKAGGLSRPGITRGR |
| Ga0211638_103277503 | 3300020448 | Marine | YLRRYYIQKASKFYEEEKKEMDKATKKKPSGISRPGISRGR |
| Ga0211641_105231622 | 3300020450 | Marine | MPTYLRHFYIKKAQQYYEKEKEQIDKANKKHSSGISRPGISRGG |
| Ga0211643_100456353 | 3300020457 | Marine | MPTYLRRYYIQKASEFYKEEKKEMDKAQKKNKGGISRPSISRGR |
| Ga0211475_102299342 | 3300020468 | Marine | MPTYLRRYYIKKAEQFYKEEKKQMDKAQKKGGVSRPGITRGR |
| Ga0211543_101421783 | 3300020470 | Marine | MPTYLRRFYIQSAQKFYDEEKKEYDKASKKQTGISRPGITRR |
| Ga0232637_103490242 | 3300021980 | Hydrothermal Vent Fluids | MPTYLRRYYIQKAAEFYEEEKKQYDKASKKKSGGISRPGIPRG |
| (restricted) Ga0233429_10524331 | 3300022902 | Seawater | YNMPIYLRRFYIQSASEFYKDEKKEYDKSNKKSGGVSRPGIPRG |
| (restricted) Ga0233433_101183262 | 3300022931 | Seawater | MPTYLRRFYIQSASEFYKEEKKEYEKSNKKSGISRPGIPRG |
| (restricted) Ga0233446_10210825 | 3300024256 | Seawater | MPVYLRRFYIQSASEFYKEEKKEYEKSNKKSGISRPGIPRG |
| (restricted) Ga0233441_10351091 | 3300024260 | Seawater | YLRRFYIQSASEFYKEEKKQYDKSNKKSGVSRPGIPRG |
| Ga0208298_10005489 | 3300025084 | Marine | MPTYLRRFYIESASKFYEEEKKEYDKSSKKKSGISRPGIPRG |
| Ga0208669_10410373 | 3300025099 | Marine | RFYIKKAQQFYDSEKEQYDKANKKQSPGISRPGVTRGR |
| Ga0208433_10362591 | 3300025114 | Marine | MPTYLRRFYIQSAAKFYEEEKKEYDKSSKKKSGISRPG |
| Ga0208433_11153383 | 3300025114 | Marine | MPTYLRRFYIQSASKFYEEEQKEYKKSSKKKSGISRPGIPRG |
| Ga0208790_11498683 | 3300025118 | Marine | TYLRRFYIQSASKFYEEEQKEYKKSSKKKSGISRPGIPRG |
| Ga0208919_10760592 | 3300025128 | Marine | MPTYLRHFYIKKAQQFYEKEKEQYDKANKKSSSGISRPGVTRGR |
| Ga0209232_11041302 | 3300025132 | Marine | MPTYLRRYYITKASKFYEEEKKQMDKAQKKGGISRPGITRGR |
| Ga0209756_10315373 | 3300025141 | Marine | LRRFYIESASKFYEEEKKEYDKSSKKKSGISRPGIPRG |
| Ga0209645_10039335 | 3300025151 | Marine | MPTYLRHFYIKKAQQYYDKEKEQYEKANKKSSSGISRPGITRGR |
| Ga0209556_10666103 | 3300025547 | Marine | MPTYLRRFYIESASKFYEEEKKQYDKSNKKSGVSRPGIPRG |
| Ga0209757_100464861 | 3300025873 | Marine | MPTYLRRFYIQKASEFYEEEQKQIKKSNKKSGGIS |
| Ga0208748_10929832 | 3300026079 | Marine | MPIYLRRFYIQKASKFYEEEKKEYDKASKKKSGISR |
| Ga0208521_11406891 | 3300026204 | Marine | MPTYLRRFYIQSASKFYKDEKKEYDKSSKKKSGISRPGIP |
| Ga0208524_10409363 | 3300026261 | Marine | RFYIQSAQKFYEEEKKEYDKSSKKKSGISRPGIPRG |
| Ga0209501_103322373 | 3300027844 | Marine | MPVYLRRFYTQSASEFYKEEKKEYDKSNKKSGGVSRPGIPRG |
| Ga0257118_10267871 | 3300028173 | Marine | FTEVYNMPIYLRRFYIQSASEFYKDEKKEYDKSNKKSGGVSRPGIPRG |
| Ga0257107_10448913 | 3300028192 | Marine | MPTYLRRFYIQSASKFYEEEKKEYDKSSKKKSGVSRPGIPQG |
| Ga0257116_10466721 | 3300028277 | Marine | FTEVYNMPVYLRRFYIQSASEFYKEEKKEYEKSNKKSGISRPGIPRG |
| Ga0257113_12360392 | 3300028488 | Marine | EVYNMPTYLRRFYIQSASKFYEEEKKQYDKASKKKSGVSRPGIPRG |
| Ga0183755_10016408 | 3300029448 | Marine | MPTYLRRYYIKKAEQFYKEEKKQMDKAQKKGGISRPGVTRGR |
| Ga0315331_103625523 | 3300031774 | Seawater | MPTYLRRFYIKKAQQFYDSEKEQYDKANKKQSAGISRPGVPRGR |
| Ga0310342_1000384194 | 3300032820 | Seawater | MPTYLRRFYIQSAAKFYEEEKKEYDKSNKKSGGISRPGIPRG |
| Ga0310342_1029564203 | 3300032820 | Seawater | PTYLRRFYIQSASKFYEEEQKEYKKSSKKKSGISRPGIPRG |
| Ga0372840_090364_613_741 | 3300034695 | Seawater | MPTYLRRFYIQSAQKFYEEEKKQYDKSNKKSGGISRPGIPRG |
| ⦗Top⦘ |