


| Basic Information | |
|---|---|
| Family ID | F105267 |
| Family Type | Metagenome |
| Number of Sequences | 100 |
| Average Sequence Length | 43 residues |
| Representative Sequence | ERARDLGNELADRLREGGFSVDRVLVEDLRPVPAVCAIGRPQGG |
| Number of Associated Samples | 66 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.00 % |
| % of genes from short scaffolds (< 2000 bps) | 92.00 % |
| Associated GOLD sequencing projects | 64 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.66 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (62.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil (25.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (60.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.83% β-sheet: 23.61% Coil/Unstructured: 55.56% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.66 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF01872 | RibD_C | 7.00 |
| PF12680 | SnoaL_2 | 4.00 |
| PF07969 | Amidohydro_3 | 2.00 |
| PF12697 | Abhydrolase_6 | 2.00 |
| PF00561 | Abhydrolase_1 | 2.00 |
| PF06441 | EHN | 1.00 |
| PF00293 | NUDIX | 1.00 |
| PF01523 | PmbA_TldD | 1.00 |
| PF07228 | SpoIIE | 1.00 |
| PF05598 | DUF772 | 1.00 |
| PF04542 | Sigma70_r2 | 1.00 |
| PF01738 | DLH | 1.00 |
| PF04954 | SIP | 1.00 |
| PF01609 | DDE_Tnp_1 | 1.00 |
| PF08309 | LVIVD | 1.00 |
| PF00589 | Phage_integrase | 1.00 |
| PF00801 | PKD | 1.00 |
| PF05694 | SBP56 | 1.00 |
| PF01850 | PIN | 1.00 |
| PF03372 | Exo_endo_phos | 1.00 |
| PF00248 | Aldo_ket_red | 1.00 |
| PF13460 | NAD_binding_10 | 1.00 |
| PF02417 | Chromate_transp | 1.00 |
| PF13535 | ATP-grasp_4 | 1.00 |
| PF03706 | LPG_synthase_TM | 1.00 |
| PF01726 | LexA_DNA_bind | 1.00 |
| PF08240 | ADH_N | 1.00 |
| PF07690 | MFS_1 | 1.00 |
| PF01391 | Collagen | 1.00 |
| PF03733 | YccF | 1.00 |
| PF08530 | PepX_C | 1.00 |
| PF01370 | Epimerase | 1.00 |
| PF01425 | Amidase | 1.00 |
| PF06026 | Rib_5-P_isom_A | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 7.00 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 7.00 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 1.00 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 1.00 |
| COG2059 | Chromate transport protein ChrA | Inorganic ion transport and metabolism [P] | 1.00 |
| COG2375 | NADPH-dependent ferric siderophore reductase, contains FAD-binding and SIP domains | Inorganic ion transport and metabolism [P] | 1.00 |
| COG2936 | Predicted acyl esterase | General function prediction only [R] | 1.00 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 1.00 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 1.00 |
| COG3304 | Uncharacterized membrane protein YccF, DUF307 family | Function unknown [S] | 1.00 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 1.00 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 1.00 |
| COG5276 | Uncharacterized secreted protein, contains LVIVD repeats, choice-of-anchor domain | Function unknown [S] | 1.00 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 1.00 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 1.00 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 1.00 |
| COG0120 | Ribose 5-phosphate isomerase | Carbohydrate transport and metabolism [G] | 1.00 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 1.00 |
| COG0312 | Zn-dependent protease PmbA/TldA or its inactivated homolog | General function prediction only [R] | 1.00 |
| COG0392 | Predicted membrane flippase AglD2/YbhN, UPF0104 family | Cell wall/membrane/envelope biogenesis [M] | 1.00 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 1.00 |
| COG0596 | 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase fold | Coenzyme transport and metabolism [H] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 62.00 % |
| Unclassified | root | N/A | 38.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459013|GO6OHWN01DODY4 | Not Available | 511 | Open in IMG/M |
| 2170459013|GO6OHWN02FHWRT | Not Available | 528 | Open in IMG/M |
| 3300002568|C688J35102_118544196 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300002568|C688J35102_118640649 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 580 | Open in IMG/M |
| 3300002568|C688J35102_119999495 | Not Available | 841 | Open in IMG/M |
| 3300003321|soilH1_10152134 | Not Available | 1336 | Open in IMG/M |
| 3300004081|Ga0063454_101388527 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 594 | Open in IMG/M |
| 3300004081|Ga0063454_101625648 | Not Available | 559 | Open in IMG/M |
| 3300004156|Ga0062589_100458001 | All Organisms → cellular organisms → Bacteria | 1059 | Open in IMG/M |
| 3300004156|Ga0062589_101194938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 727 | Open in IMG/M |
| 3300004463|Ga0063356_104373515 | Not Available | 608 | Open in IMG/M |
| 3300005332|Ga0066388_100279498 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album | 2312 | Open in IMG/M |
| 3300005543|Ga0070672_101179063 | Not Available | 682 | Open in IMG/M |
| 3300005561|Ga0066699_11227025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 514 | Open in IMG/M |
| 3300005562|Ga0058697_10704152 | Not Available | 538 | Open in IMG/M |
| 3300005834|Ga0068851_10516834 | Not Available | 718 | Open in IMG/M |
| 3300005981|Ga0081538_10148222 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1068 | Open in IMG/M |
| 3300005981|Ga0081538_10261291 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300005981|Ga0081538_10361529 | Not Available | 525 | Open in IMG/M |
| 3300006038|Ga0075365_11338943 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300006051|Ga0075364_10788271 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 648 | Open in IMG/M |
| 3300006051|Ga0075364_10805072 | Not Available | 640 | Open in IMG/M |
| 3300006358|Ga0068871_101977964 | Not Available | 555 | Open in IMG/M |
| 3300006800|Ga0066660_11181766 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 601 | Open in IMG/M |
| 3300006844|Ga0075428_100743391 | Not Available | 1044 | Open in IMG/M |
| 3300007076|Ga0075435_101469631 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum | 597 | Open in IMG/M |
| 3300009093|Ga0105240_12023133 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 598 | Open in IMG/M |
| 3300009789|Ga0126307_10062521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 2921 | Open in IMG/M |
| 3300009789|Ga0126307_10471251 | Not Available | 1013 | Open in IMG/M |
| 3300009789|Ga0126307_10478365 | Not Available | 1005 | Open in IMG/M |
| 3300009789|Ga0126307_11065292 | Not Available | 654 | Open in IMG/M |
| 3300009789|Ga0126307_11093453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 645 | Open in IMG/M |
| 3300009789|Ga0126307_11226426 | Not Available | 607 | Open in IMG/M |
| 3300009789|Ga0126307_11441394 | All Organisms → cellular organisms → Bacteria | 558 | Open in IMG/M |
| 3300009789|Ga0126307_11600022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → unclassified Nocardioides → Nocardioides sp. TF02-7 | 529 | Open in IMG/M |
| 3300009789|Ga0126307_11782306 | Not Available | 501 | Open in IMG/M |
| 3300009840|Ga0126313_10369461 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 1134 | Open in IMG/M |
| 3300009840|Ga0126313_11375060 | Not Available | 585 | Open in IMG/M |
| 3300010036|Ga0126305_10512869 | Not Available | 800 | Open in IMG/M |
| 3300010037|Ga0126304_10007926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5664 | Open in IMG/M |
| 3300010038|Ga0126315_10515377 | Not Available | 764 | Open in IMG/M |
| 3300010038|Ga0126315_10536213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 750 | Open in IMG/M |
| 3300010038|Ga0126315_10873006 | Not Available | 596 | Open in IMG/M |
| 3300010039|Ga0126309_10465421 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 771 | Open in IMG/M |
| 3300010039|Ga0126309_10554264 | Not Available | 716 | Open in IMG/M |
| 3300010040|Ga0126308_10817702 | Not Available | 646 | Open in IMG/M |
| 3300010040|Ga0126308_10951740 | Not Available | 600 | Open in IMG/M |
| 3300010041|Ga0126312_10011958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5817 | Open in IMG/M |
| 3300010045|Ga0126311_10523227 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 931 | Open in IMG/M |
| 3300010045|Ga0126311_11135499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 644 | Open in IMG/M |
| 3300010166|Ga0126306_10337987 | Not Available | 1167 | Open in IMG/M |
| 3300010166|Ga0126306_11565482 | Not Available | 548 | Open in IMG/M |
| 3300010397|Ga0134124_13003393 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Nitriliruptoria → Nitriliruptorales → Nitriliruptoraceae → Nitriliruptor → Nitriliruptor alkaliphilus | 515 | Open in IMG/M |
| 3300010403|Ga0134123_10190077 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1738 | Open in IMG/M |
| 3300012204|Ga0137374_10740747 | Not Available | 734 | Open in IMG/M |
| 3300012212|Ga0150985_109039197 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2120 | Open in IMG/M |
| 3300012355|Ga0137369_10170736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1708 | Open in IMG/M |
| 3300012355|Ga0137369_10406213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → Kribbella qitaiheensis | 981 | Open in IMG/M |
| 3300012355|Ga0137369_11131169 | Not Available | 509 | Open in IMG/M |
| 3300012492|Ga0157335_1043994 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300012904|Ga0157282_10061515 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 951 | Open in IMG/M |
| 3300012977|Ga0134087_10126829 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1091 | Open in IMG/M |
| 3300014326|Ga0157380_12556326 | Not Available | 577 | Open in IMG/M |
| 3300015077|Ga0173483_10472039 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300017965|Ga0190266_11303428 | Not Available | 510 | Open in IMG/M |
| 3300018422|Ga0190265_10337945 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1589 | Open in IMG/M |
| 3300018429|Ga0190272_13146495 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 513 | Open in IMG/M |
| 3300018432|Ga0190275_10295699 | All Organisms → cellular organisms → Bacteria | 1585 | Open in IMG/M |
| 3300018432|Ga0190275_12897736 | Not Available | 555 | Open in IMG/M |
| 3300018476|Ga0190274_11904734 | Not Available | 690 | Open in IMG/M |
| 3300018481|Ga0190271_10150948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium 13_1_20CM_3_63_8 | 2243 | Open in IMG/M |
| 3300018481|Ga0190271_11942527 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300018481|Ga0190271_13170098 | Not Available | 551 | Open in IMG/M |
| 3300027809|Ga0209574_10076669 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 907 | Open in IMG/M |
| 3300028379|Ga0268266_12107860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Seohaeicola → Seohaeicola zhoushanensis | 537 | Open in IMG/M |
| 3300028771|Ga0307320_10078167 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1242 | Open in IMG/M |
| 3300028782|Ga0307306_10080686 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 847 | Open in IMG/M |
| 3300028791|Ga0307290_10102273 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1045 | Open in IMG/M |
| 3300028802|Ga0307503_10333291 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 772 | Open in IMG/M |
| 3300028807|Ga0307305_10175600 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 987 | Open in IMG/M |
| 3300028814|Ga0307302_10491360 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 609 | Open in IMG/M |
| 3300028819|Ga0307296_10054724 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2110 | Open in IMG/M |
| 3300028875|Ga0307289_10354784 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 603 | Open in IMG/M |
| 3300028884|Ga0307308_10086464 | All Organisms → cellular organisms → Bacteria | 1488 | Open in IMG/M |
| 3300028885|Ga0307304_10088613 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 1217 | Open in IMG/M |
| 3300030006|Ga0299907_10054000 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3207 | Open in IMG/M |
| 3300030006|Ga0299907_10292300 | Not Available | 1331 | Open in IMG/M |
| 3300030514|Ga0268253_10109009 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300031228|Ga0299914_10480535 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1075 | Open in IMG/M |
| 3300031228|Ga0299914_10978275 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 692 | Open in IMG/M |
| 3300031229|Ga0299913_10969690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 818 | Open in IMG/M |
| 3300031229|Ga0299913_11782661 | Not Available | 564 | Open in IMG/M |
| 3300031229|Ga0299913_11847328 | Not Available | 552 | Open in IMG/M |
| 3300031824|Ga0307413_10862073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 766 | Open in IMG/M |
| 3300031852|Ga0307410_10219687 | All Organisms → cellular organisms → Bacteria | 1461 | Open in IMG/M |
| 3300031852|Ga0307410_11563055 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Blastococcus | 582 | Open in IMG/M |
| 3300032002|Ga0307416_101789642 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. CWNU-1 | 718 | Open in IMG/M |
| 3300032002|Ga0307416_103849352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 503 | Open in IMG/M |
| 3300032013|Ga0310906_10194164 | Not Available | 1226 | Open in IMG/M |
| 3300032126|Ga0307415_101493292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 646 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 25.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 23.00% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 6.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 5.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 5.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.00% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 3.00% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 3.00% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 3.00% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.00% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 2.00% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.00% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.00% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.00% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.00% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459013 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis soil at the rocks surface 0-21cm | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005562 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e | Host-Associated | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006051 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Host-Associated | Open in IMG/M |
| 3300012904 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1 | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300027809 | Agave microbial communities from Guanajuato, Mexico - Mg.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028782 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193 | Environmental | Open in IMG/M |
| 3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300030514 | Agave microbial communities from Guanajuato, Mexico - Mg.Ma.rz (v2) | Host-Associated | Open in IMG/M |
| 3300031228 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 | Environmental | Open in IMG/M |
| 3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| N57_03703120 | 2170459013 | Grass Soil | ERARDLGNELADRLREGGFSVDRVLVEDLRPVPAVCAIGRPQGG |
| N57_04808740 | 2170459013 | Grass Soil | LADRLREGGFSVDRVLVDDLRPVPAVCVTGRPQGGRT |
| C688J35102_1185441961 | 3300002568 | Soil | ERARDLGNELADRLREGGFSVDKVLVEDLRPVPAVCAIGRPQGG* |
| C688J35102_1186406492 | 3300002568 | Soil | AQDLGNELADRLRGGGFSVDRVLVEDLRPVPAVCVIGRPQGG* |
| C688J35102_1199994951 | 3300002568 | Soil | HSAPERARDLGNELADRLREGGFSVDRVLVEDLRPVPAVCAIGRPQGG* |
| soilH1_101521343 | 3300003321 | Sugarcane Root And Bulk Soil | DLGNALADRLRQGGFSVDRVLVEDLRPVPAVCAIGRPQGG* |
| Ga0063454_1013885271 | 3300004081 | Soil | ERARDLGNELADRLREGGFCVDRVLVEDLRPVPAVCVVGRPGGG* |
| Ga0063454_1016256482 | 3300004081 | Soil | APERAGDLGNELADRLREGGFSVDRVLVEDLRPVPAVCAIGRPQGG* |
| Ga0062589_1004580013 | 3300004156 | Soil | RHYAPERARDLGNELADRLREGGFSLDRVLVEDLRPVPAVCAIGRPRGG* |
| Ga0062589_1011949381 | 3300004156 | Soil | SAPERVRDLGNELADRLREGGFVVERVLVEGVRPVPAVCVMGRPEGN* |
| Ga0063356_1043735152 | 3300004463 | Arabidopsis Thaliana Rhizosphere | DLGNELADRLREGGFSVDRVLVEDLRPVPAVCAIGRPQGRSTSRASAIA* |
| Ga0066388_1002794983 | 3300005332 | Tropical Forest Soil | WAPERARDLGNELAERLREGGFSVDSVLVEDLRPVPAVCAMGRPQGG* |
| Ga0070672_1011790631 | 3300005543 | Miscanthus Rhizosphere | LADRLREGGLSIDRVLVEDLRPVLAACVIGRPQGR* |
| Ga0066699_112270252 | 3300005561 | Soil | PERARDLGNELADRLREGGFSVDRVLVEDLRPVPAVCAMGRPQGG* |
| Ga0058697_107041522 | 3300005562 | Agave | RDLGNELADRLREGGFSVDRVLVENLRPVPAVCAMGRPQGG* |
| Ga0068851_105168343 | 3300005834 | Corn Rhizosphere | APERARDLGNELADRLREGGLSIDRVLVEDLRPVLAACVIGRPQGR* |
| Ga0081538_101482221 | 3300005981 | Tabebuia Heterophylla Rhizosphere | RARDLGNELADRLREGGFSVDRVLVEDLRPVPAVCAMGRPQGKSS* |
| Ga0081538_102612912 | 3300005981 | Tabebuia Heterophylla Rhizosphere | PERARDLGNELADRLREGGFSVDRVLVEDLRPVPAVCAIGRPQRKSSSA* |
| Ga0081538_103615291 | 3300005981 | Tabebuia Heterophylla Rhizosphere | STSTLSTENPPSRHFAPERARDLGNELADRLREGGFSVDSVLVEDLRPVPAVCAMGRPQDG* |
| Ga0075365_113389431 | 3300006038 | Populus Endosphere | SAPERARDLGNDLADRLREGGFSVDRVLVEDLRPVPAVCAIGRPHCGS* |
| Ga0075364_107882712 | 3300006051 | Populus Endosphere | RHFTPEGARDLGDELSGRLRLGGFSIERVLVEELRPVPAVCVMGRPEDG* |
| Ga0075364_108050721 | 3300006051 | Populus Endosphere | DARHFTPELAPELGGELADRLREGGFSVDTVLVEDLRPVPAVCAIGRPRTVVSRTRRS* |
| Ga0068871_1019779641 | 3300006358 | Miscanthus Rhizosphere | APERARDLGNELADRLREGGLSIDRVLVEDLRPVLAACVMGRPQGR* |
| Ga0066660_111817661 | 3300006800 | Soil | DARHSAPERARDLGNELADRLREGGFSVDRVLVEDLRPVPAVCAMGRPQGG* |
| Ga0075428_1007433911 | 3300006844 | Populus Rhizosphere | LADRLREGGFSVDRVLVQDLRPVPAVCAIGRPAGSTP* |
| Ga0075435_1014696312 | 3300007076 | Populus Rhizosphere | ELADRLRESGFSVDGVLVEDLRPVPAVCAMGRPQGG* |
| Ga0105240_120231331 | 3300009093 | Corn Rhizosphere | QLADRLREGGFSVDRVLVEDLRPVPAVCAIGRPRGG* |
| Ga0126307_100625211 | 3300009789 | Serpentine Soil | ARDLGNELANRLREGGFSVNRVLVEDLRPVPAVCVMGRPRGG* |
| Ga0126307_104712511 | 3300009789 | Serpentine Soil | RHSAPERARDLGNELADRLREGGFSVDRVLVEDLRPVPAVCAIGRPKGG* |
| Ga0126307_104783651 | 3300009789 | Serpentine Soil | RARDLGNELADRLREGGFSVDRVLVEDLRPVPAVCAMGRPQGG* |
| Ga0126307_110652921 | 3300009789 | Serpentine Soil | RHSAPERARDLGNELADRLREGGFSVDRVLVEDLRPVPAVCAMGRPQGG* |
| Ga0126307_110934532 | 3300009789 | Serpentine Soil | ARDLGNELADRLREGGFSVDRVLVEDLRPVPAVCAMGRPQGG* |
| Ga0126307_112264261 | 3300009789 | Serpentine Soil | DLGNELADRLREGGFSVDRVLVEDLRPVPAVCVIGRPPGG* |
| Ga0126307_114413942 | 3300009789 | Serpentine Soil | DLGNELADRLREGGFSVDRVLVEDLRPVPAVCVMGQP* |
| Ga0126307_116000222 | 3300009789 | Serpentine Soil | NELADRLREGGFSVDRVLVEDLRPVPAACAIGRPQGE* |
| Ga0126307_117823061 | 3300009789 | Serpentine Soil | RARDLGNELADRLREGGFSVDGVLVEDLRPIPAVCAIGRPQGG* |
| Ga0126313_103694611 | 3300009840 | Serpentine Soil | APERARDLGNELADRLREGGFSVDRVLVEDLRPVPAVCAMGRPQGG* |
| Ga0126313_113750602 | 3300009840 | Serpentine Soil | GNELADRLREGGFSVDSVLVENLRPVPAVCVMGRPQGG* |
| Ga0126305_105128691 | 3300010036 | Serpentine Soil | ADRLREGGFSVDRVLVEDLRPVPAVCAMGRPQGG* |
| Ga0126304_100079261 | 3300010037 | Serpentine Soil | ARDLGNELADRLREGGFSVDRVLVEDLRPVPAVCAIGRPKGG* |
| Ga0126315_105153771 | 3300010038 | Serpentine Soil | LADRLREGGFSVDRVLVEDLRPVPAVCAIGRPQGG* |
| Ga0126315_105362131 | 3300010038 | Serpentine Soil | ELADRLREGGFSVDRILVEDLRPVPAVCAVGRPRYSDS* |
| Ga0126315_108730061 | 3300010038 | Serpentine Soil | ERARDLGNELADRLREGGFSVDRVLVEDLRPVPAVCAMGRPQGG* |
| Ga0126309_104654211 | 3300010039 | Serpentine Soil | HSAPERARDLGNELADRLREGGFSVDRVLVEDLRPVPAVCAIGRPQGE* |
| Ga0126309_105542641 | 3300010039 | Serpentine Soil | HSAPERARDLGNELADRLREGGFSVDRVLVEDLRPVPAVCAMGRPQGG* |
| Ga0126308_108177021 | 3300010040 | Serpentine Soil | RHSAPERARDLGNELADRLRESGFSVDRVLVEHLRPVPAVCAIGRPQGG* |
| Ga0126308_109517401 | 3300010040 | Serpentine Soil | VYLFWDALHSAPERVRDLGNELADRLREGGFSVDSVLVEDLRPVPAVCAIGRPQGG* |
| Ga0126312_100119587 | 3300010041 | Serpentine Soil | SAPERARDLGNELADRLREGGFSVDRVLVEDLRPVPAVCAIGRPKGG* |
| Ga0126311_105232271 | 3300010045 | Serpentine Soil | LADRLRAGGFSGDRVLVEDLRPVPAVCAIGRLRADEHG* |
| Ga0126311_111354992 | 3300010045 | Serpentine Soil | ELAGRLREGGFSVDRVLVEDLRPVPAVCAMGRPQGG* |
| Ga0126306_103379871 | 3300010166 | Serpentine Soil | HSAPERARDLGNELADRLREGGFSVDRVLVEDLRPVPAVCAIGRPQGR* |
| Ga0126306_115654822 | 3300010166 | Serpentine Soil | ERARDLGNELADRLREGGFSVDRVLVEDLRPVLAVCVMGRPQGG* |
| Ga0134124_130033931 | 3300010397 | Terrestrial Soil | ADRLRQGGFSVDSVLVEDLCPVPAVCAIGRPQGGT* |
| Ga0134123_101900771 | 3300010403 | Terrestrial Soil | SAPERARDLGNELADRLREGGFSVDRVLVEDLRPVPAVCATGRPQRSS* |
| Ga0137374_107407471 | 3300012204 | Vadose Zone Soil | HSAPERARDLGNELADRLREGGFSVDRVLVEDLRPVPAVCAMGRPQVG* |
| Ga0150985_1090391975 | 3300012212 | Avena Fatua Rhizosphere | MVLSPERAQELGSELADRLHGAGFSVDRVLVKNLRPVPAVCAIGRPTGG* |
| Ga0137369_101707364 | 3300012355 | Vadose Zone Soil | DLGNELADRLREGGFSVDRVLVEDLRPVPAVCAMGRPQGG* |
| Ga0137369_104062132 | 3300012355 | Vadose Zone Soil | ELADRLREGGFSVDRVLVEDLRPVPAVCAMGRPQGG* |
| Ga0137369_111311692 | 3300012355 | Vadose Zone Soil | RDLGNELADRLRDGGFSVDRVLVEDLRPVPAVCAMGRPQGG* |
| Ga0157335_10439941 | 3300012492 | Arabidopsis Rhizosphere | RDLGNVLADRLRQGGFSVDRVLVEDLRPVPAVCAIGRPQGGT* |
| Ga0157282_100615151 | 3300012904 | Soil | RDLGNELAGRLREGGFSIDRVLAEDLRPVPAVCVIGRP* |
| Ga0134087_101268291 | 3300012977 | Grasslands Soil | APERARDLGNELADRLRDGGFSVDRVLVEDLRPVPAVCAIGRPQGE* |
| Ga0157380_125563262 | 3300014326 | Switchgrass Rhizosphere | CHSAPERARHLGNELADRLRDGGFSVDRVLVEDLRPVPAVCVMGRPQGA* |
| Ga0173483_104720391 | 3300015077 | Soil | ELAERLRAGGLSVDRVLVEDLRPVPAVCVIGRSEGR* |
| Ga0190266_113034281 | 3300017965 | Soil | RARDLGNELADRLREGGFSVDRVLVEDLRPVPAVCAMGRPQGG |
| Ga0190265_103379454 | 3300018422 | Soil | RHSAPERARDLGNELADRLREGGFSVDRVLVEDLRPVPAACAIGRRQGGEAGALGLSSTR |
| Ga0190272_131464952 | 3300018429 | Soil | GNKLADRLREGGFSVDRVLVEDLHPVPAVCAMGRPQGG |
| Ga0190275_102956991 | 3300018432 | Soil | APERARDLGNELADRLREGGFSVDRVLVEDLRPVPAVCAIGLSSTR |
| Ga0190275_128977361 | 3300018432 | Soil | ERARDLGNELADRLREGGFSVDRVLVEDLRPVPAVCAMGRPQGG |
| Ga0190274_119047341 | 3300018476 | Soil | RHSAPERARDLGNELADRLREGGFSVDRVLVEDLRPVPAVCAIGRPQCG |
| Ga0190271_101509481 | 3300018481 | Soil | APERARDLGNELADRLREGGFSVDRVLVEDLRPVPAVCAIGRPQGG |
| Ga0190271_119425271 | 3300018481 | Soil | LADRLREGGFSVDRVLVEDLRPVPAVCVIGRPQGG |
| Ga0190271_131700982 | 3300018481 | Soil | DLGNELADRLREGGFSVDRVLVEDLRPVPAVCVIGRPHAG |
| Ga0209574_100766691 | 3300027809 | Agave | ARDLGNELAERLREGGFSVDRVLVEDLRPFPAVCVTGRLRYT |
| Ga0268266_121078601 | 3300028379 | Switchgrass Rhizosphere | HSAPERARHLGNELADRLRDGGFSVDRVLVEHLRPVPAVCVMGRPQGA |
| Ga0307320_100781672 | 3300028771 | Soil | RDLANELADRLREGRFSVDRLLVEDLRPVPAVCAIGRPQGR |
| Ga0307306_100806861 | 3300028782 | Soil | GNELADRLREGGFSVGRVLVEDVRPVPAVCAMGRPQGG |
| Ga0307290_101022731 | 3300028791 | Soil | HSAPERARDLGNELADRLREGGFSVDRVLVEDLRPVPAVCAIGRPQGG |
| Ga0307503_103332911 | 3300028802 | Soil | APERARDLGNELADRLREGGFSVDRVLVEDLRPVPAVCAIGRPQG |
| Ga0307305_101756002 | 3300028807 | Soil | PERARDLGNELADRLREGGFSVGRVLVEDVRPVPAVCAMGRPQGG |
| Ga0307302_104913602 | 3300028814 | Soil | GRARDLGNELADRLREGGFSVDRVLVEDLRPVPAVCAIGRPQGE |
| Ga0307296_100547241 | 3300028819 | Soil | RARELGNELADRLREGGFSVDRVLVEDLRPVPAVCVMGRPQGS |
| Ga0307289_103547841 | 3300028875 | Soil | RHSAPERARDLGNELADRLREGGFSVDRVLVEDLRPVPAVCVMGRPQGS |
| Ga0307308_100864643 | 3300028884 | Soil | NELADRLREGGFSVDGVLVEDLRPVPAVCAMGRPQGG |
| Ga0307304_100886131 | 3300028885 | Soil | NELADRLREGGFSVDRVLVEDLRPVPAVCAMGRPQGG |
| Ga0299907_100540001 | 3300030006 | Soil | DLGNELADRLREGGFSVDRVLVEDLRPVPAVCAMGRLQRG |
| Ga0299907_102923001 | 3300030006 | Soil | RDLGNELADRLREGGFSVDRVLVEDLRPVPAVCAMGRPQGG |
| Ga0268253_101090091 | 3300030514 | Agave | ARDLGNELAERLREGGFSVDRVLVEDLRPFPAVCVTGRP |
| Ga0299914_104805353 | 3300031228 | Soil | LGNELADRLREGGFSVDRVLVEDLRPVPAVCAIGRPQGG |
| Ga0299914_109782751 | 3300031228 | Soil | PERARDLGNELADRLREGGFSVDRVLVEDLRPVPAVCAIGRPQGG |
| Ga0299913_109696901 | 3300031229 | Soil | ELADRLREGGFSVDRVLVEDLRPVPAVCAMGRPQGG |
| Ga0299913_117826612 | 3300031229 | Soil | ARDLGNELADRLREGGFSVDRVLVEDLSPVPAVCAMGRPQGG |
| Ga0299913_118473281 | 3300031229 | Soil | ELADRLREGGFSVDRVLVEDLRPVSAVCVMGRPQGG |
| Ga0307413_108620732 | 3300031824 | Rhizosphere | ERARDLGNELADRLCEGGFSVDRVLVKDLRPVPAVCAMGRPQGG |
| Ga0307410_102196873 | 3300031852 | Rhizosphere | APERARDLGNDLADRLREGGFAVDRVLVEHLRPGPAVCAIGRPHVV |
| Ga0307410_115630552 | 3300031852 | Rhizosphere | GNDLADRLRTGGFAIDRVLVEDLRPVPAVCVIGRPQGR |
| Ga0307416_1017896422 | 3300032002 | Rhizosphere | ELADRLREGGFSVDRVLVEDLRPVPAVCAIGRPQGG |
| Ga0307416_1038493521 | 3300032002 | Rhizosphere | RHSAPERARDLGNELADRLREAGFSVDRVLVEDLRPVPAVCAIGRPEGG |
| Ga0310906_101941643 | 3300032013 | Soil | NELADRLREGGFSVDRVLVEDLRPVPAVCAIGRPQGR |
| Ga0307415_1014932922 | 3300032126 | Rhizosphere | GDRLSEKIRSAGFSVDRVLVKELRPVPAVCVTARP |
| ⦗Top⦘ |