


| Basic Information | |
|---|---|
| Family ID | F105233 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 100 |
| Average Sequence Length | 46 residues |
| Representative Sequence | LAKDCYLESTEIEFNGEGEKPLGYVSLTFLTNYYVQETNPDVAV |
| Number of Associated Samples | 92 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 86.00 % |
| Associated GOLD sequencing projects | 86 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (70.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (27.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (75.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (87.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 59.09% Coil/Unstructured: 40.91% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF06199 | Phage_tail_2 | 24.00 |
| PF09718 | Tape_meas_lam_C | 6.00 |
| PF13550 | Phage-tail_3 | 2.00 |
| PF16778 | Phage_tail_APC | 1.00 |
| PF09931 | DUF2163 | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 70.00 % |
| All Organisms | root | All Organisms | 30.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000117|DelMOWin2010_c10027162 | All Organisms → Viruses → Predicted Viral | 2857 | Open in IMG/M |
| 3300001450|JGI24006J15134_10165841 | Not Available | 708 | Open in IMG/M |
| 3300001472|JGI24004J15324_10010772 | Not Available | 3308 | Open in IMG/M |
| 3300001748|JGI11772J19994_1023283 | Not Available | 876 | Open in IMG/M |
| 3300002488|JGI25128J35275_1092921 | Not Available | 613 | Open in IMG/M |
| 3300004461|Ga0066223_1091636 | Not Available | 1088 | Open in IMG/M |
| 3300006402|Ga0075511_1036162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → Rickettsiaceae → Rickettsieae → Rickettsia → spotted fever group → Rickettsia hoogstraalii | 1337 | Open in IMG/M |
| 3300006405|Ga0075510_10020787 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → Rickettsiaceae → Rickettsieae → Rickettsia → spotted fever group → Rickettsia hoogstraalii | 837 | Open in IMG/M |
| 3300006735|Ga0098038_1071448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → Rickettsiaceae → Rickettsieae → Rickettsia → spotted fever group → Rickettsia hoogstraalii | 1227 | Open in IMG/M |
| 3300006735|Ga0098038_1136499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → Rickettsiaceae → Rickettsieae → Rickettsia → spotted fever group → Rickettsia hoogstraalii | 824 | Open in IMG/M |
| 3300006737|Ga0098037_1087706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → Rickettsiaceae → Rickettsieae → Rickettsia → spotted fever group → Rickettsia hoogstraalii | 1087 | Open in IMG/M |
| 3300006737|Ga0098037_1257722 | Not Available | 558 | Open in IMG/M |
| 3300006789|Ga0098054_1322740 | Not Available | 550 | Open in IMG/M |
| 3300006802|Ga0070749_10402848 | Not Available | 755 | Open in IMG/M |
| 3300006810|Ga0070754_10135799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1187 | Open in IMG/M |
| 3300006916|Ga0070750_10127380 | All Organisms → Viruses → Predicted Viral | 1164 | Open in IMG/M |
| 3300006922|Ga0098045_1152054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → Rickettsiaceae → Rickettsieae → Rickettsia → spotted fever group → Rickettsia hoogstraalii | 532 | Open in IMG/M |
| 3300006925|Ga0098050_1005324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → Rickettsiaceae → Rickettsieae → Rickettsia → spotted fever group → Rickettsia hoogstraalii | 4001 | Open in IMG/M |
| 3300007236|Ga0075463_10022593 | Not Available | 2062 | Open in IMG/M |
| 3300007236|Ga0075463_10224826 | Not Available | 604 | Open in IMG/M |
| 3300007276|Ga0070747_1035163 | Not Available | 1968 | Open in IMG/M |
| 3300007538|Ga0099851_1007323 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4582 | Open in IMG/M |
| 3300007540|Ga0099847_1220475 | Not Available | 550 | Open in IMG/M |
| 3300007963|Ga0110931_1101517 | Not Available | 867 | Open in IMG/M |
| 3300009001|Ga0102963_1380727 | Not Available | 553 | Open in IMG/M |
| 3300009086|Ga0102812_10198790 | Not Available | 1093 | Open in IMG/M |
| 3300009172|Ga0114995_10179073 | Not Available | 1180 | Open in IMG/M |
| 3300009334|Ga0103841_1001017 | Not Available | 996 | Open in IMG/M |
| 3300009422|Ga0114998_10066160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1844 | Open in IMG/M |
| 3300009422|Ga0114998_10155528 | Not Available | 1099 | Open in IMG/M |
| 3300009481|Ga0114932_10143079 | Not Available | 1473 | Open in IMG/M |
| 3300009497|Ga0115569_10443477 | Not Available | 556 | Open in IMG/M |
| 3300009512|Ga0115003_10222457 | Not Available | 1130 | Open in IMG/M |
| 3300009605|Ga0114906_1047055 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 1656 | Open in IMG/M |
| 3300009608|Ga0115100_10067008 | Not Available | 732 | Open in IMG/M |
| 3300009677|Ga0115104_10247751 | Not Available | 816 | Open in IMG/M |
| 3300009677|Ga0115104_10248986 | Not Available | 816 | Open in IMG/M |
| 3300009735|Ga0123377_1041375 | Not Available | 669 | Open in IMG/M |
| 3300009757|Ga0123367_1148463 | Not Available | 1006 | Open in IMG/M |
| 3300010150|Ga0098056_1269983 | Not Available | 562 | Open in IMG/M |
| 3300010151|Ga0098061_1348346 | Not Available | 503 | Open in IMG/M |
| 3300010297|Ga0129345_1002017 | Not Available | 7751 | Open in IMG/M |
| 3300010300|Ga0129351_1357161 | Not Available | 548 | Open in IMG/M |
| 3300010883|Ga0133547_10984892 | Not Available | 1633 | Open in IMG/M |
| 3300012525|Ga0129353_1814202 | All Organisms → Viruses → Predicted Viral | 1292 | Open in IMG/M |
| 3300012528|Ga0129352_10390230 | Not Available | 1915 | Open in IMG/M |
| 3300016727|Ga0182051_1004726 | Not Available | 1918 | Open in IMG/M |
| 3300016733|Ga0182042_1102746 | All Organisms → Viruses | 980 | Open in IMG/M |
| 3300016734|Ga0182092_1369088 | Not Available | 750 | Open in IMG/M |
| 3300016791|Ga0182095_1176496 | Not Available | 741 | Open in IMG/M |
| 3300017697|Ga0180120_10106418 | Not Available | 1216 | Open in IMG/M |
| 3300017725|Ga0181398_1033292 | Not Available | 1265 | Open in IMG/M |
| 3300017731|Ga0181416_1042434 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1069 | Open in IMG/M |
| 3300017751|Ga0187219_1191028 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured phage MedDCM-OCT-S08-C1731 | 570 | Open in IMG/M |
| 3300017764|Ga0181385_1039344 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1484 | Open in IMG/M |
| 3300017772|Ga0181430_1002933 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6563 | Open in IMG/M |
| 3300017776|Ga0181394_1243813 | Not Available | 539 | Open in IMG/M |
| 3300019459|Ga0181562_10119047 | Not Available | 1474 | Open in IMG/M |
| 3300020175|Ga0206124_10369984 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 537 | Open in IMG/M |
| 3300020391|Ga0211675_10029771 | All Organisms → Viruses | 2749 | Open in IMG/M |
| 3300020410|Ga0211699_10420304 | Not Available | 529 | Open in IMG/M |
| 3300020424|Ga0211620_10248579 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 759 | Open in IMG/M |
| 3300020436|Ga0211708_10383930 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured phage MedDCM-OCT-S08-C1731 | 575 | Open in IMG/M |
| 3300020448|Ga0211638_10508321 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured phage MedDCM-OCT-S08-C1731 | 567 | Open in IMG/M |
| 3300020459|Ga0211514_10001426 | Not Available | 14988 | Open in IMG/M |
| 3300021085|Ga0206677_10163185 | Not Available | 984 | Open in IMG/M |
| 3300021085|Ga0206677_10305659 | Not Available | 634 | Open in IMG/M |
| 3300021169|Ga0206687_1467573 | Not Available | 779 | Open in IMG/M |
| 3300021169|Ga0206687_1511419 | Not Available | 984 | Open in IMG/M |
| 3300021347|Ga0213862_10354840 | Not Available | 523 | Open in IMG/M |
| 3300021356|Ga0213858_10001751 | Not Available | 10382 | Open in IMG/M |
| 3300021373|Ga0213865_10440967 | Not Available | 568 | Open in IMG/M |
| 3300021957|Ga0222717_10698901 | Not Available | 519 | Open in IMG/M |
| 3300021959|Ga0222716_10000991 | Not Available | 23880 | Open in IMG/M |
| 3300022057|Ga0212025_1070241 | Not Available | 604 | Open in IMG/M |
| 3300022065|Ga0212024_1055358 | Not Available | 699 | Open in IMG/M |
| 3300022183|Ga0196891_1085128 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 559 | Open in IMG/M |
| 3300022308|Ga0224504_10140921 | Not Available | 988 | Open in IMG/M |
| (restricted) 3300023109|Ga0233432_10122150 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1419 | Open in IMG/M |
| (restricted) 3300024255|Ga0233438_10317507 | Not Available | 592 | Open in IMG/M |
| 3300025079|Ga0207890_1062475 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured phage MedDCM-OCT-S08-C1731 | 609 | Open in IMG/M |
| 3300025084|Ga0208298_1003336 | All Organisms → Viruses → Predicted Viral | 4986 | Open in IMG/M |
| 3300025084|Ga0208298_1068998 | Not Available | 667 | Open in IMG/M |
| 3300025102|Ga0208666_1143456 | Not Available | 540 | Open in IMG/M |
| 3300025128|Ga0208919_1111182 | Not Available | 875 | Open in IMG/M |
| 3300025610|Ga0208149_1152542 | Not Available | 526 | Open in IMG/M |
| 3300025655|Ga0208795_1065215 | Not Available | 1041 | Open in IMG/M |
| 3300025674|Ga0208162_1184899 | Not Available | 541 | Open in IMG/M |
| 3300025705|Ga0209374_1181585 | Not Available | 570 | Open in IMG/M |
| 3300025751|Ga0208150_1016439 | All Organisms → Viruses → Predicted Viral | 2633 | Open in IMG/M |
| 3300027757|Ga0208671_10034299 | Not Available | 1899 | Open in IMG/M |
| 3300027788|Ga0209711_10171575 | Not Available | 1023 | Open in IMG/M |
| 3300028125|Ga0256368_1013251 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1412 | Open in IMG/M |
| 3300031167|Ga0308023_1063033 | Not Available | 702 | Open in IMG/M |
| 3300031569|Ga0307489_10541958 | Not Available | 796 | Open in IMG/M |
| 3300031580|Ga0308132_1017747 | Not Available | 1467 | Open in IMG/M |
| 3300032088|Ga0315321_10085629 | Not Available | 2158 | Open in IMG/M |
| 3300032277|Ga0316202_10114307 | Not Available | 1250 | Open in IMG/M |
| 3300033742|Ga0314858_051901 | Not Available | 995 | Open in IMG/M |
| 3300034375|Ga0348336_099454 | Not Available | 990 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 27.00% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 20.00% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 10.00% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 6.00% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 5.00% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 3.00% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 3.00% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 3.00% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 2.00% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 2.00% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 2.00% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.00% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.00% |
| River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 1.00% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 1.00% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 1.00% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 1.00% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.00% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 1.00% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 1.00% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.00% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 1.00% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 1.00% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 1.00% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 1.00% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
| 3300001748 | Saline surface water microbial communities from Etoliko Lagoon, Greece - surface water (0 m) | Environmental | Open in IMG/M |
| 3300002488 | Marine viral communities from the Pacific Ocean - ETNP_2_60 | Environmental | Open in IMG/M |
| 3300004461 | Marine viral communities from Newfoundland, Canada BC-2 | Environmental | Open in IMG/M |
| 3300006402 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006405 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006922 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG | Environmental | Open in IMG/M |
| 3300006925 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG | Environmental | Open in IMG/M |
| 3300007236 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007963 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2) | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009086 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 | Environmental | Open in IMG/M |
| 3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
| 3300009334 | Microbial communities of water from the North Atlantic ocean - ACM46 | Environmental | Open in IMG/M |
| 3300009422 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009497 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 | Environmental | Open in IMG/M |
| 3300009512 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 | Environmental | Open in IMG/M |
| 3300009605 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9 | Environmental | Open in IMG/M |
| 3300009608 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009677 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009735 | Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_240_2m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009757 | Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_205_2m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010151 | Marine viral communities from the Subarctic Pacific Ocean - 22_ETSP_OMZ_AT15343 metaG | Environmental | Open in IMG/M |
| 3300010297 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNA | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300012525 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012528 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016727 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011510BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016733 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011501AT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016734 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041410CS metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016791 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041412BS metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017725 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29 | Environmental | Open in IMG/M |
| 3300017731 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16 | Environmental | Open in IMG/M |
| 3300017751 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2) | Environmental | Open in IMG/M |
| 3300017764 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11 | Environmental | Open in IMG/M |
| 3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
| 3300017776 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23 | Environmental | Open in IMG/M |
| 3300019459 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020175 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2 | Environmental | Open in IMG/M |
| 3300020391 | Marine microbial communities from Tara Oceans - TARA_B100000989 (ERX556130-ERR598967) | Environmental | Open in IMG/M |
| 3300020410 | Marine microbial communities from Tara Oceans - TARA_B100000519 (ERX555959-ERR599148) | Environmental | Open in IMG/M |
| 3300020424 | Marine microbial communities from Tara Oceans - TARA_B100000242 (ERX556056-ERR599138) | Environmental | Open in IMG/M |
| 3300020436 | Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984) | Environmental | Open in IMG/M |
| 3300020448 | Marine microbial communities from Tara Oceans - TARA_B100000941 (ERX555919-ERR598954) | Environmental | Open in IMG/M |
| 3300020459 | Marine microbial communities from Tara Oceans - TARA_X000000368 (ERX555913-ERR599095) | Environmental | Open in IMG/M |
| 3300021085 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 | Environmental | Open in IMG/M |
| 3300021169 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021347 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266 | Environmental | Open in IMG/M |
| 3300021356 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245 | Environmental | Open in IMG/M |
| 3300021373 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300022057 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v2) | Environmental | Open in IMG/M |
| 3300022065 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2) | Environmental | Open in IMG/M |
| 3300022183 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3) | Environmental | Open in IMG/M |
| 3300022308 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_24 | Environmental | Open in IMG/M |
| 3300023109 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MG | Environmental | Open in IMG/M |
| 3300024255 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_10_MG | Environmental | Open in IMG/M |
| 3300025079 | Marine viral communities from the Pacific Ocean - LP-48 (SPAdes) | Environmental | Open in IMG/M |
| 3300025084 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025102 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025610 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025705 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_10m (SPAdes) | Environmental | Open in IMG/M |
| 3300025751 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027757 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 (SPAdes) | Environmental | Open in IMG/M |
| 3300027788 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 (SPAdes) | Environmental | Open in IMG/M |
| 3300028125 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SB | Environmental | Open in IMG/M |
| 3300031167 | Marine microbial communities from water near the shore, Antarctic Ocean - #418 | Environmental | Open in IMG/M |
| 3300031569 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2 | Environmental | Open in IMG/M |
| 3300031580 | Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1111_SCM (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032088 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 21515 | Environmental | Open in IMG/M |
| 3300032277 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotite | Environmental | Open in IMG/M |
| 3300033742 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater | Environmental | Open in IMG/M |
| 3300034375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOWin2010_100271626 | 3300000117 | Marine | RTLDGLAKDCYLESTEIEFNGEGEKPLGYVSLTFLTNYYVQETNPDVAV* |
| JGI24006J15134_101658411 | 3300001450 | Marine | IAIAADPTLNGLAKDCFLESTEIDFNAEGEAPLATATLNFLTNYYVKEQAPDVAV* |
| JGI24004J15324_100107721 | 3300001472 | Marine | STEIEFNAEGEKPLGYVSLTFLTNYYVKEKNPDVAL* |
| JGI11772J19994_10232831 | 3300001748 | Saline Water And Sediment | TLDGLAKDCYLESTEIEFNGEGEKPLGYVSLTFLTNYYVQETNPDVAV* |
| JGI25128J35275_10929213 | 3300002488 | Marine | TYLESTEIEFNAEGEKPLGYVSMTFLTNYYVQETNPDVAV* |
| Ga0066223_10916361 | 3300004461 | Marine | VEEAIAADRTLGGLAKDCYLESTEIEFNAEGEKPLGYVSLTFLTNYYVKETNPDVAV* |
| Ga0075511_10361625 | 3300006402 | Aqueous | CYLESTEIEFNGEGEKPLGYVSLTFLTNYYVKETNPDVAV* |
| Ga0075510_100207871 | 3300006405 | Aqueous | AKDTYLESTEIEFNAEGEKPLGYVSLTFLTNYYVKENAPDVAV* |
| Ga0098038_10714481 | 3300006735 | Marine | LAKDCYLESTEIEFNAEGEKPLGYVSLTFLTNYYVKETNPDVAV* |
| Ga0098038_11364991 | 3300006735 | Marine | LAKDCYLESTEIEFNAEGEKPLGYVSLTFLTNYYVKETNPDIAV* |
| Ga0098037_10877064 | 3300006737 | Marine | ATDTTLGGLAKDCYLESTEIEFNAEGEKPLGYVSLTFLTNYYVKETNPDIAV* |
| Ga0098037_12577221 | 3300006737 | Marine | LTKDCFLDSTEIEFNSEAETPLAVATLIFLTNYYVKEQAPDVA |
| Ga0098054_13227403 | 3300006789 | Marine | ESTEIEFNGEGEKPLGYVSLTFLTNYYVKETNPDVAV* |
| Ga0070749_104028484 | 3300006802 | Aqueous | AKDTYLESTEIDFNGEAEKPLGYVSLTFLTNYYVQETNPDVAV* |
| Ga0070754_101357991 | 3300006810 | Aqueous | QAIAADPTLSGKAKDCYIESTEIEFNAEGEKPLAFCTLTFLTSYYVQEQNPDVAV* |
| Ga0070750_101273801 | 3300006916 | Aqueous | KDCYLESTEIEFNGEGEKPLGYVSLTFLTNYYVQETNPDVAV* |
| Ga0098045_11520543 | 3300006922 | Marine | LAKDCYLESTEIEFNGEGEKPLGYVSLTFLTNYYVKETNPDIAV* |
| Ga0098050_10053241 | 3300006925 | Marine | STEIEFNGEGEKPLGYVSLTFLTNYYVKETNPDIAV* |
| Ga0075463_100225935 | 3300007236 | Aqueous | DPTLSGKAKDCHLESTEIEFNSEGEKPLAYATLTFLTNYYVQEQNPDVAV* |
| Ga0075463_102248263 | 3300007236 | Aqueous | RTLGGLAKDTFIESTEISFNAEGEKPLGFVSLTFISNYYVKEKNPDVAV* |
| Ga0070747_10351636 | 3300007276 | Aqueous | AKDTYLESTEIEFNGEGEKPLGYVSLTFLTNYYVKEKNPDVAV* |
| Ga0099851_10073239 | 3300007538 | Aqueous | LAKDTYLESTEIEFNAEGEKPLGYVSLTFLTNYYVKENTPDVAV* |
| Ga0099847_12204751 | 3300007540 | Aqueous | ADRTLDGLAKDCYLESTEISFNAEGEKPLGFVSLTFISNYYVKEKNPDVAV* |
| Ga0110931_11015174 | 3300007963 | Marine | LAKDTYLESTEIEFNSEGEKPLGYVSLTFLTNYYVKENAPDVAV* |
| Ga0102963_13807271 | 3300009001 | Pond Water | GLAKDCYLESTEIEFNGEGEKPLGYVSLTFLANYYVQETNPDVAV* |
| Ga0102812_101987904 | 3300009086 | Estuarine | YLESTEIEFNGEGEKPLGYVSLTFLTNYYVQETNPDVAV* |
| Ga0114995_101790734 | 3300009172 | Marine | DDTIDTSSKEVETAIAADPTLNGLAKDCYLESTEIEFNAEGEQPLASATLIFLTNYYVKAQAPDVAV* |
| Ga0103841_10010171 | 3300009334 | River Water | DRTLDGLAKDTYLESTEIEFNGEGEKPLGYVSLTFLTNYYVQETNPDIAV* |
| Ga0114998_100661601 | 3300009422 | Marine | KDTYLESTEIEFNAEGEKPLGYVSMTFLTNYYVKEKNPDVAL* |
| Ga0114998_101555281 | 3300009422 | Marine | DCYLESTEIEFNAEGETPLAYATLTFLTNYYVKAQAPDVAV* |
| Ga0114932_101430791 | 3300009481 | Deep Subsurface | KDCFLQSTEIEYNTEGEQPLSYAVLTFLTNYYVQETAPDVAV* |
| Ga0115569_104434771 | 3300009497 | Pelagic Marine | ESTEIEFNSEGEKPLGYVSLTFLTNYYVKENAPDVAV* |
| Ga0115003_102224571 | 3300009512 | Marine | DRTLGGLAKDTYLESTEIEFNAEGEKPLGYVSMTFLTNYYVKEKNPDVAL* |
| Ga0114906_10470551 | 3300009605 | Deep Ocean | TEIEYNAEGEKPVGYATLTFNVNYYNQEQAPDVAR* |
| Ga0115100_100670083 | 3300009608 | Marine | TYLESTEIEFNGEGEKPLGYVSLTFLTNYYVKENNPDVAV* |
| Ga0115104_102477511 | 3300009677 | Marine | LGGLAKDCYLESTEIEFNAEGEKPLGYVSLTFLTNYYVKETNPDVAV* |
| Ga0115104_102489861 | 3300009677 | Marine | LGGLAKDCYLESTEIEFNAEGEKPLGYVSLTFLTNYYVKENNPDIAV* |
| Ga0123377_10413753 | 3300009735 | Marine | LGGLAKDTYIESTEIEYTGDGEQPVGYVSLTFLTNYYVQETNPDIAV* |
| Ga0123367_11484631 | 3300009757 | Marine | DCYLESTEIEFNGEGEKPLGYVSLTFLTNYYVQETNPDVAV* |
| Ga0098056_12699833 | 3300010150 | Marine | EAIAADRTLGGLAKDTYLESTEIEFNAEGEKPLGYVSMTFLTNYYVKEKNPDVAL* |
| Ga0098061_13483461 | 3300010151 | Marine | ESTEIDFTGEGEQPVGSVTLTYLTNYYVQETNPDVAV* |
| Ga0129345_10020171 | 3300010297 | Freshwater To Marine Saline Gradient | AKDTYLESTEIEFNSEGEKPLGYVSLTFLTNYYVKENAPDVAV* |
| Ga0129351_13571613 | 3300010300 | Freshwater To Marine Saline Gradient | AADRTLDGLAKDTYLESTEIEFNAEGEKPLGYVSLTFLTNYYVQETNPDVAV* |
| Ga0133547_109848926 | 3300010883 | Marine | SSKEVETAIAADPTLNGLAKDCYLESTEIEFNAEGEQPLASATLIFLTNYYVKAQAPDVAV* |
| Ga0129353_18142021 | 3300012525 | Aqueous | LGGLAKDTYIESTDIEYTGDGEQPVGYVTLTFLTNYYVQETNPDVAV* |
| Ga0129352_103902301 | 3300012528 | Aqueous | EAIAADRTLGGLAKDTYLESTEIDFNGEAEKPLGYVSLTFLTNYYVQETNPDVAV* |
| Ga0182051_10047265 | 3300016727 | Salt Marsh | LDGLAKDTYLESTEIEFNSEGEKPLGYVSLTFLTNYYVKENAPDVAV |
| Ga0182042_11027461 | 3300016733 | Salt Marsh | EAITADRTLGGLAKDTYIESTEIEYTGEGEQPVGFVTLTFLTNYYVQETNPDVAV |
| Ga0182092_13690883 | 3300016734 | Salt Marsh | RTLDGLAKDCYLESTEIEFNGEGEKPLGYVSLTFLTNYYVQETNPDVAV |
| Ga0182095_11764961 | 3300016791 | Salt Marsh | KDTYVESTEIEYTGEGEQPVGYVTLTFLTNYYVQETNPDVAV |
| Ga0180120_101064181 | 3300017697 | Freshwater To Marine Saline Gradient | ADPTLSGKAKDCYIESTEIEFNAEGEKPLAFCTLTFLTSYYVQEQNPDVAV |
| Ga0181398_10332921 | 3300017725 | Seawater | DRTLDGKAKDTYLESTEIEFNGEGEKPLGYVSLTFLTNYYVKENNPDVAV |
| Ga0181416_10424344 | 3300017731 | Seawater | DTTLNSLAKDCFLQSTEIEYNTEGEQPLSYAVLTFLTNYYVQETEPDVAV |
| Ga0187219_11910281 | 3300017751 | Seawater | LAKDCFLQSTEIEYNTEGEQPLSYAVLTFLTNYYIQETAPDVAV |
| Ga0181385_10393441 | 3300017764 | Seawater | TEIEFNAEGESPVGYATLTFLTTYHVKETNPDVAV |
| Ga0181430_10029331 | 3300017772 | Seawater | TYVESTEIEYTGDGEQPVGYVTLTFLTNYYVQETNPDVAV |
| Ga0181394_12438131 | 3300017776 | Seawater | TYLESTEIEFNGEGEKPLGYVSLTFLTNYYVKENNPDVAV |
| Ga0181562_101190475 | 3300019459 | Salt Marsh | ESTEIEFNGEGEKPLGYVSLTFLTNYYVQETNPDVAV |
| Ga0206124_103699843 | 3300020175 | Seawater | LSGKAKDCYIESTEIEFNAEGEKPLAFATLTFLTSYYVQEQNPDVAV |
| Ga0211675_100297711 | 3300020391 | Marine | GLAKDCFLQSTSIEYNTEGEQPLSFAVLTFLTNYYVQETAPDVAV |
| Ga0211699_104203043 | 3300020410 | Marine | TFLESTEIEYNAEGEKPVGYATLTFNVNYYNQEQAPDVAR |
| Ga0211620_102485793 | 3300020424 | Marine | TLNGLAKDCFLQSTEIEYNTEGEQPLSYAVLTFLTNYYVQETAPDVAV |
| Ga0211708_103839303 | 3300020436 | Marine | AKDAFLESTDIDFNSEAENPVGFASLTFLIKYYVQETNPDIAV |
| Ga0211638_105083211 | 3300020448 | Marine | KDIFIQSTEIEFNAEGESPVGYATLTFLTTYHVKETNPDVAV |
| Ga0211514_1000142619 | 3300020459 | Marine | DCFLQSTEIEYNTEGEQPLSYAVLTFLTNYYVQETAPDVAV |
| Ga0206677_101631851 | 3300021085 | Seawater | DTYVESTEIEYTGDGEQPVGYVTLTFLTNYYVQETNPDVAV |
| Ga0206677_103056591 | 3300021085 | Seawater | LGGLAKDCFLESTEIDFNPEGEAPLAFATLNFLTNYYVQEQAPDVAV |
| Ga0206687_14675731 | 3300021169 | Seawater | AISADRTLGGLAKDTYVESTEIEYTGDGEQPVGYVTLTFLTNYYVQETNPDVAV |
| Ga0206687_15114191 | 3300021169 | Seawater | LGGLAKDVYIESTEIEFTGDGEQPVGYVTLSFLTNYYVQETNPDVAV |
| Ga0213862_103548403 | 3300021347 | Seawater | KEVEQAIAADPTLSGKAKDCYIESTEIEFNAEGERPLAFATLTFLTSYYVQEQNPDVAV |
| Ga0213858_100017511 | 3300021356 | Seawater | VEEAIAADRTLGGLAKDTYLESTEIEFNAEGEKPLGYVSMTFLTNYYVQETNPDVAV |
| Ga0213865_104409673 | 3300021373 | Seawater | DTYVESTEIEYTGEGEQPVGYVTLTFLTNYYVQETNPDVAV |
| Ga0222717_106989013 | 3300021957 | Estuarine Water | TLDGLAKDCYLESTEIEFNGEGEKPLGYVSLTFLTNYYVQETNPDVAV |
| Ga0222716_100009911 | 3300021959 | Estuarine Water | TVCKEVEQAIAADPTLSGKAKDCYIESTEIEFNAEGERPLAFGTLIFLTSYYVQEQNPDVAV |
| Ga0212025_10702413 | 3300022057 | Aqueous | YLESTEIEFNGEGEKPLGYVSLTFLTNYYVKETNPDVAV |
| Ga0212024_10553581 | 3300022065 | Aqueous | EADPTLSGKAKDCHLESTEIEFNSEGEKPLAYATLTFLTNYYVQEQNPDVAV |
| Ga0196891_10851283 | 3300022183 | Aqueous | EVEQAIAADPTLSGKAKDCYIESTEIEFNAEGERPLAFATLTFLTSYYVQEQNPDVAV |
| Ga0224504_101409211 | 3300022308 | Sediment | AKDTYLESTEIEFNGEGEKPLGYVSLTFLTNYYVKENNPDVAV |
| (restricted) Ga0233432_101221505 | 3300023109 | Seawater | AISADRTLGGLAKDTYIESTDIEYTGDGEQPVGYVTLTFLTNYYVQETNPDVAV |
| (restricted) Ga0233438_103175073 | 3300024255 | Seawater | LAKDCYLESTEIEFNGEGEKPLGYVSLTFLTNYYVKETNPDIAV |
| Ga0207890_10624753 | 3300025079 | Marine | AIAADTTLGGLAKDCYLESTEIEFNAEGEKPLGYVSLTFLTNYYVKENNPDIAV |
| Ga0208298_10033361 | 3300025084 | Marine | RTLDGLAKDCYLESTEIEFNGEGEKPLGYVSLTFLTNYYVKETNPDIAV |
| Ga0208298_10689983 | 3300025084 | Marine | KDCYIESTEIEFNAEGEKPLAFATLTFLTSYYVQEQNPDVAV |
| Ga0208666_11434561 | 3300025102 | Marine | LSGKAKDCHLESTEIEFNSEGEKPLAYATLTFLTNYYVQEQNPDVAV |
| Ga0208919_11111824 | 3300025128 | Marine | LAKDTYLESTEIEFNSEGEKPLGYVSLTFLTNYYVKENAPDVAV |
| Ga0208149_11525421 | 3300025610 | Aqueous | AADRTLDGKAKDTYLESTEIEFNGEGEKPLGYVSLTFLTNYYVKEKNPDVAV |
| Ga0208795_10652151 | 3300025655 | Aqueous | TYLESTEIEFNAEGEKPLGYVSLTFLTNYYVKENAPDVAV |
| Ga0208162_11848991 | 3300025674 | Aqueous | KDTYLESTEIEFNAEGEKPLGYVSMTFLTNYYVQETNPDVAV |
| Ga0209374_11815853 | 3300025705 | Marine | IAKDTFIESTEISFNAEGEKPLGFVSLTFISNYYVKEQNPDVAV |
| Ga0208150_10164391 | 3300025751 | Aqueous | RTLDGLAKDCYLESTEIEFNGEGEKPLGYVSLTFLTNYYVKETNPDVAV |
| Ga0208671_100342996 | 3300027757 | Estuarine | LAKDCYLESTEIEFNGEGEKPLGYVSLTFLTNYYVQETNPDVAV |
| Ga0209711_101715751 | 3300027788 | Marine | SGKAKDCYLESTEIEFNAEGEKPLAFATLTFLTSYYVQEQSPDVAV |
| Ga0256368_10132516 | 3300028125 | Sea-Ice Brine | STEIEYNAEGEKPVGYATLTFNVNYFNQEQAPDVAR |
| Ga0308023_10630333 | 3300031167 | Marine | KEVETAIAADPTLNGLAKDCYLESTEIEFNAEGETPLAYATLTFLTNYYVQAQAPDVAV |
| Ga0307489_105419581 | 3300031569 | Sackhole Brine | AKDTYLESTEIEFNAEGEKPLGYVSMTFLTNYYVKETNPDVAL |
| Ga0308132_10177471 | 3300031580 | Marine | KDCYLESTEIEFNAEGEKPLAFCSLTFLTSYYVQEQSPDVAV |
| Ga0315321_100856291 | 3300032088 | Seawater | ADRTLDGLAKDCYLESTEIEFNGEGEKPLGYVSLTFLTNYYVQETNPDVAV |
| Ga0316202_101143076 | 3300032277 | Microbial Mat | LESTEIEFNGEGEKPLGYVSLTFLTNYYVKENNPDVAV |
| Ga0314858_051901_872_994 | 3300033742 | Sea-Ice Brine | TYLESTEIEFNAEGEKPLGYVSLTFLTNYYVKEKAPDVAV |
| Ga0348336_099454_1_120 | 3300034375 | Aqueous | YLESTEIEFNGEGEKPLGYVSLTFLTNYYVQETNPDVAV |
| ⦗Top⦘ |