


| Basic Information | |
|---|---|
| Family ID | F105178 |
| Family Type | Metagenome |
| Number of Sequences | 100 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MSYIIVLPEGFLTSEVRAKSITRELYNITVPLAVQEEYQ |
| Number of Associated Samples | 72 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.00 % |
| % of genes from short scaffolds (< 2000 bps) | 91.00 % |
| Associated GOLD sequencing projects | 56 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (56.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (57.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (85.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (91.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 58.97% β-sheet: 10.26% Coil/Unstructured: 30.77% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF09206 | ArabFuran-catal | 34.00 |
| PF11367 | DUF3168 | 2.00 |
| PF09956 | DUF2190 | 1.00 |
| PF13385 | Laminin_G_3 | 1.00 |
| PF05065 | Phage_capsid | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 56.00 % |
| All Organisms | root | All Organisms | 44.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10165280 | Not Available | 788 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10122397 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 812 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10161406 | Not Available | 756 | Open in IMG/M |
| 3300000973|BBAY93_10149758 | Not Available | 587 | Open in IMG/M |
| 3300006025|Ga0075474_10094729 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 968 | Open in IMG/M |
| 3300006484|Ga0070744_10030817 | All Organisms → Viruses → Predicted Viral | 1587 | Open in IMG/M |
| 3300006637|Ga0075461_10145114 | Not Available | 729 | Open in IMG/M |
| 3300006793|Ga0098055_1031352 | Not Available | 2204 | Open in IMG/M |
| 3300006802|Ga0070749_10172249 | Not Available | 1250 | Open in IMG/M |
| 3300006802|Ga0070749_10280248 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 939 | Open in IMG/M |
| 3300006869|Ga0075477_10256347 | Not Available | 703 | Open in IMG/M |
| 3300006919|Ga0070746_10163089 | Not Available | 1079 | Open in IMG/M |
| 3300006920|Ga0070748_1023078 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 2592 | Open in IMG/M |
| 3300007276|Ga0070747_1103144 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1051 | Open in IMG/M |
| 3300007276|Ga0070747_1109569 | All Organisms → Viruses → Predicted Viral | 1013 | Open in IMG/M |
| 3300007344|Ga0070745_1093230 | Not Available | 1184 | Open in IMG/M |
| 3300007344|Ga0070745_1102009 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1121 | Open in IMG/M |
| 3300007345|Ga0070752_1180672 | Not Available | 851 | Open in IMG/M |
| 3300007345|Ga0070752_1216773 | Not Available | 756 | Open in IMG/M |
| 3300007346|Ga0070753_1228699 | Not Available | 680 | Open in IMG/M |
| 3300007538|Ga0099851_1109005 | All Organisms → Viruses → Predicted Viral | 1051 | Open in IMG/M |
| 3300007540|Ga0099847_1141334 | Not Available | 719 | Open in IMG/M |
| 3300007540|Ga0099847_1183958 | Not Available | 613 | Open in IMG/M |
| 3300007640|Ga0070751_1104748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rickettsiales → unclassified Rickettsiales → Rickettsiales bacterium | 1166 | Open in IMG/M |
| 3300007960|Ga0099850_1167031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Aestuariivirgaceae → Aestuariivirga → Aestuariivirga litoralis | 879 | Open in IMG/M |
| 3300007960|Ga0099850_1175196 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
| 3300008012|Ga0075480_10347861 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 741 | Open in IMG/M |
| 3300009071|Ga0115566_10280331 | Not Available | 989 | Open in IMG/M |
| 3300009071|Ga0115566_10630976 | Not Available | 598 | Open in IMG/M |
| 3300009172|Ga0114995_10407477 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300009434|Ga0115562_1162035 | Not Available | 826 | Open in IMG/M |
| 3300009437|Ga0115556_1263129 | Not Available | 612 | Open in IMG/M |
| 3300009438|Ga0115559_1211258 | Not Available | 698 | Open in IMG/M |
| 3300009438|Ga0115559_1365188 | Not Available | 502 | Open in IMG/M |
| 3300009472|Ga0115554_1079390 | All Organisms → Viruses → Predicted Viral | 1424 | Open in IMG/M |
| 3300009476|Ga0115555_1133954 | All Organisms → Viruses → Predicted Viral | 1047 | Open in IMG/M |
| 3300010316|Ga0136655_1202386 | Not Available | 591 | Open in IMG/M |
| 3300013010|Ga0129327_10249706 | Not Available | 907 | Open in IMG/M |
| 3300013010|Ga0129327_10441350 | Not Available | 696 | Open in IMG/M |
| 3300017697|Ga0180120_10302333 | Not Available | 640 | Open in IMG/M |
| 3300017710|Ga0181403_1084731 | Not Available | 659 | Open in IMG/M |
| 3300017755|Ga0181411_1011890 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 2876 | Open in IMG/M |
| 3300017769|Ga0187221_1030791 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1814 | Open in IMG/M |
| 3300017951|Ga0181577_10095008 | Not Available | 2069 | Open in IMG/M |
| 3300017951|Ga0181577_10115598 | All Organisms → Viruses → Predicted Viral | 1847 | Open in IMG/M |
| 3300017951|Ga0181577_10277722 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1094 | Open in IMG/M |
| 3300018065|Ga0180430_10413017 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
| 3300018065|Ga0180430_10693735 | Not Available | 703 | Open in IMG/M |
| 3300020175|Ga0206124_10198504 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae | 792 | Open in IMG/M |
| 3300021957|Ga0222717_10388441 | Not Available | 775 | Open in IMG/M |
| 3300021958|Ga0222718_10220098 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1025 | Open in IMG/M |
| 3300021959|Ga0222716_10267882 | Not Available | 1046 | Open in IMG/M |
| 3300022050|Ga0196883_1002136 | All Organisms → Viruses → Predicted Viral | 2228 | Open in IMG/M |
| 3300022050|Ga0196883_1040968 | Not Available | 563 | Open in IMG/M |
| 3300022057|Ga0212025_1046708 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium SW_4_49_11 | 746 | Open in IMG/M |
| 3300022065|Ga0212024_1040215 | Not Available | 810 | Open in IMG/M |
| 3300022068|Ga0212021_1063246 | Not Available | 757 | Open in IMG/M |
| 3300022068|Ga0212021_1118412 | Not Available | 542 | Open in IMG/M |
| 3300022072|Ga0196889_1013859 | Not Available | 1736 | Open in IMG/M |
| 3300022176|Ga0212031_1021823 | All Organisms → Viruses → Predicted Viral | 1001 | Open in IMG/M |
| 3300022176|Ga0212031_1059560 | Not Available | 646 | Open in IMG/M |
| 3300022176|Ga0212031_1097734 | Not Available | 502 | Open in IMG/M |
| 3300022178|Ga0196887_1003813 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 5680 | Open in IMG/M |
| 3300022183|Ga0196891_1086407 | Not Available | 554 | Open in IMG/M |
| 3300022934|Ga0255781_10099017 | All Organisms → Viruses → Predicted Viral | 1596 | Open in IMG/M |
| (restricted) 3300024518|Ga0255048_10524148 | Not Available | 573 | Open in IMG/M |
| 3300025070|Ga0208667_1067050 | Not Available | 548 | Open in IMG/M |
| 3300025641|Ga0209833_1082766 | Not Available | 970 | Open in IMG/M |
| 3300025646|Ga0208161_1055997 | Not Available | 1236 | Open in IMG/M |
| 3300025646|Ga0208161_1113187 | Not Available | 728 | Open in IMG/M |
| 3300025646|Ga0208161_1151810 | Not Available | 577 | Open in IMG/M |
| 3300025647|Ga0208160_1123840 | Not Available | 650 | Open in IMG/M |
| 3300025652|Ga0208134_1145785 | Not Available | 602 | Open in IMG/M |
| 3300025655|Ga0208795_1080630 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 902 | Open in IMG/M |
| 3300025655|Ga0208795_1092834 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 819 | Open in IMG/M |
| 3300025685|Ga0209095_1047576 | All Organisms → Viruses → Predicted Viral | 1565 | Open in IMG/M |
| 3300025687|Ga0208019_1096087 | Not Available | 918 | Open in IMG/M |
| 3300025687|Ga0208019_1098074 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 904 | Open in IMG/M |
| 3300025699|Ga0209715_1092433 | All Organisms → Viruses → Predicted Viral | 1140 | Open in IMG/M |
| 3300025704|Ga0209602_1133051 | Not Available | 823 | Open in IMG/M |
| 3300025769|Ga0208767_1092479 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1234 | Open in IMG/M |
| 3300025769|Ga0208767_1096597 | Not Available | 1195 | Open in IMG/M |
| 3300025769|Ga0208767_1110984 | Not Available | 1074 | Open in IMG/M |
| 3300025769|Ga0208767_1167058 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 779 | Open in IMG/M |
| 3300025769|Ga0208767_1179737 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium SW_4_49_11 | 734 | Open in IMG/M |
| 3300025803|Ga0208425_1044983 | Not Available | 1112 | Open in IMG/M |
| 3300025803|Ga0208425_1063410 | Not Available | 903 | Open in IMG/M |
| 3300025803|Ga0208425_1091887 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 715 | Open in IMG/M |
| 3300025806|Ga0208545_1063047 | All Organisms → Viruses → Predicted Viral | 1058 | Open in IMG/M |
| 3300025815|Ga0208785_1019553 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 2241 | Open in IMG/M |
| 3300025815|Ga0208785_1046561 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1232 | Open in IMG/M |
| 3300025840|Ga0208917_1013948 | All Organisms → cellular organisms → Bacteria | 3503 | Open in IMG/M |
| 3300025853|Ga0208645_1116703 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1073 | Open in IMG/M |
| 3300025853|Ga0208645_1211948 | Not Available | 676 | Open in IMG/M |
| 3300025890|Ga0209631_10358463 | Not Available | 687 | Open in IMG/M |
| 3300027805|Ga0209229_10040975 | Not Available | 2050 | Open in IMG/M |
| 3300031565|Ga0307379_10671893 | Not Available | 935 | Open in IMG/M |
| 3300031578|Ga0307376_10407717 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 892 | Open in IMG/M |
| 3300033742|Ga0314858_058133 | Not Available | 947 | Open in IMG/M |
| 3300034375|Ga0348336_088424 | All Organisms → Viruses → Predicted Viral | 1093 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 57.00% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 12.00% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 4.00% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 4.00% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 3.00% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 3.00% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 3.00% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 3.00% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 2.00% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 1.00% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.00% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 1.00% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.00% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.00% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 1.00% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000973 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY93 | Host-Associated | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006869 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
| 3300007345 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
| 3300009434 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 | Environmental | Open in IMG/M |
| 3300009437 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414 | Environmental | Open in IMG/M |
| 3300009438 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110506 | Environmental | Open in IMG/M |
| 3300009472 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 | Environmental | Open in IMG/M |
| 3300009476 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 | Environmental | Open in IMG/M |
| 3300010316 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017710 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28 | Environmental | Open in IMG/M |
| 3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
| 3300017769 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2) | Environmental | Open in IMG/M |
| 3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018065 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_S_2 metaG | Environmental | Open in IMG/M |
| 3300020175 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300022050 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v3) | Environmental | Open in IMG/M |
| 3300022057 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v2) | Environmental | Open in IMG/M |
| 3300022065 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2) | Environmental | Open in IMG/M |
| 3300022068 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2) | Environmental | Open in IMG/M |
| 3300022072 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3) | Environmental | Open in IMG/M |
| 3300022176 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022178 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3) | Environmental | Open in IMG/M |
| 3300022183 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3) | Environmental | Open in IMG/M |
| 3300022934 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG | Environmental | Open in IMG/M |
| 3300024518 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_2 | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025641 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110506 (SPAdes) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
| 3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025685 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 (SPAdes) | Environmental | Open in IMG/M |
| 3300025687 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025699 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 (SPAdes) | Environmental | Open in IMG/M |
| 3300025704 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 (SPAdes) | Environmental | Open in IMG/M |
| 3300025769 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes) | Environmental | Open in IMG/M |
| 3300025803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025806 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025815 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025840 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025890 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300033742 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater | Environmental | Open in IMG/M |
| 3300034375 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_101652801 | 3300000101 | Marine | MNGYIIVLPEGVLSSEQRAERISRELYCVTAPLATQEPYQH |
| DelMOSum2011_101223971 | 3300000115 | Marine | MNGFIIVLPEGVLSSEQRAERISRELYCVTAPLATQEP |
| DelMOSpr2010_101614062 | 3300000116 | Marine | MNGYIIVLPEGVLSSEQRAERISRELYCVTAPLATQEPYQHDG |
| BBAY93_101497583 | 3300000973 | Macroalgal Surface | MQYIIVLPEGTLTSEKRAKSITRELYNITTPLAVQQPYQKD |
| Ga0075474_100947291 | 3300006025 | Aqueous | MQYIIVLPEGTLTSEKRAKSITRELYNITTPLAIQQPYQKD |
| Ga0070744_100308172 | 3300006484 | Estuarine | MNGYIIVLPEGVLSSEQRAERISRELYCVTAPLATQEPYQHDGKV |
| Ga0075461_101451141 | 3300006637 | Aqueous | MSQYIIVLPEGFLTSEVRAKSITRELYNITVPVAVQEEYQKDATV |
| Ga0098055_10313522 | 3300006793 | Marine | MSKYIIVLPVGVLTSETRAKQITRELYNITVPLAVQADYQKDG |
| Ga0070749_101722491 | 3300006802 | Aqueous | MSKYIIVLPVGVLDSATRAKQITRELYNITVPLAVQADYQKD |
| Ga0070749_102802482 | 3300006802 | Aqueous | MSNYIIVLPVGVLDSATRAKQITRELYNITVPLAVQ |
| Ga0075477_102563471 | 3300006869 | Aqueous | MNGYIIVLPVGLLSSEARAKAITRELYNITVPVAV |
| Ga0070746_101630891 | 3300006919 | Aqueous | MSYIIVLPEGFLTSEVRAKSITRELYITVPVAIQEEYQKDATV |
| Ga0070748_10230782 | 3300006920 | Aqueous | MNGYIIVLPEGVLSSEQRAERISRELYCVTAPLATQEPYQHDGKVFGMV |
| Ga0070747_11031441 | 3300007276 | Aqueous | MNGYIIVLPEGTLTGEHRAKAITRELYNITAPLVTQEPYQKDGT |
| Ga0070747_11095692 | 3300007276 | Aqueous | MNGYIIVLPEGVLTSEQRAERISRELYCVTAPLATQEP |
| Ga0070745_10932301 | 3300007344 | Aqueous | MSKYIIVLPEGTLTSEKRAKSITRELYNITTPLAVQQPYQKD |
| Ga0070745_11020091 | 3300007344 | Aqueous | MSNYIIVLPVGVLDSATRAKQITRELYNITVPLAVQA |
| Ga0070752_11806722 | 3300007345 | Aqueous | MSNYIIVLPVGVLDSATRAKQITRELYNITVPLAVQADYQK |
| Ga0070752_12167731 | 3300007345 | Aqueous | MSKYIIVLPVGVLDSATRAKQITRELYNITVPLAVQADYQKDGQVF |
| Ga0070753_12286992 | 3300007346 | Aqueous | MSQYIIVLPEGTLTSEKRAKSITRELYNITTPLAIQQPYQKDGT |
| Ga0099851_11090052 | 3300007538 | Aqueous | MSYIIVLPEGFLTSEVRAKSITRELYNITVPLAVQEEYQKD |
| Ga0099847_11413342 | 3300007540 | Aqueous | MSKYIIVLPVGVLDSATRATQITRELYNITVPLAVQADYQKDG |
| Ga0099847_11839582 | 3300007540 | Aqueous | MNGYIIVLPEGVLTSEQRAERISRELYCVTAPLATQEPYQH |
| Ga0070751_11047481 | 3300007640 | Aqueous | MSKYIIVLPVGVSDSATRAKQITRELYNITVPLAVQA |
| Ga0099850_11670312 | 3300007960 | Aqueous | MSYIIVLPEGFLTSEVRAKSITRELYNITVPLAVQEEYQKDG |
| Ga0099850_11751962 | 3300007960 | Aqueous | MSYIIVLPEGFLTSEVRAKSITRELYNITVPLAVQEEY |
| Ga0075480_103478612 | 3300008012 | Aqueous | MSQYIIVLPEGFLTSEVRAKSITRELYNITVPVAIQKEY* |
| Ga0115566_102803312 | 3300009071 | Pelagic Marine | MNGYIIVLPEGTLTSEHRAKAITRELYNITAPLVT |
| Ga0115566_106309761 | 3300009071 | Pelagic Marine | MAQYIIVLPEGTLTSEHRAKAITRELYNITAPLVTQE |
| Ga0114995_104074771 | 3300009172 | Marine | MNGYIIVLPEGVLSSEQRAERISRELYCVTAPLATQEPYQHDGK |
| Ga0115562_11620352 | 3300009434 | Pelagic Marine | MDGYIIVLPEGTLTSEHRAKAITRELYNITAPLVTQEPYQ |
| Ga0115556_12631292 | 3300009437 | Pelagic Marine | MNGFIIVLPEGTLTSEHRAKAITRELYNITAPLVTQE |
| Ga0115559_12112582 | 3300009438 | Pelagic Marine | MNGFIIVLPEGVLTSEQRAERISRELYCVTAPLATQEP |
| Ga0115559_13651882 | 3300009438 | Pelagic Marine | MNGYIIVLPEGVLSSEQRAERISRELYCVTAPLATQ |
| Ga0115554_10793902 | 3300009472 | Pelagic Marine | MNGFIIVLPEGTLTSEHRAKAITRELYNITAPLVTQ |
| Ga0115555_11339542 | 3300009476 | Pelagic Marine | MDGYIIVLPEGTLTSEHRAKAITRELYNITAPLVTQEPYQKDG |
| Ga0136655_12023862 | 3300010316 | Freshwater To Marine Saline Gradient | MNGYIIVLPEGVLTSEQRAERISRELYCVTAPLATQEPY |
| Ga0129327_102497062 | 3300013010 | Freshwater To Marine Saline Gradient | MNYIIVLPEGVLNSEQRANRISEELYNITAPLAIQQPYQ |
| Ga0129327_104413501 | 3300013010 | Freshwater To Marine Saline Gradient | MNGFIIVLPEGVLSSEQRAERISRELYCVTAPLATQEPYQHDGK |
| Ga0180120_103023331 | 3300017697 | Freshwater To Marine Saline Gradient | MNGYIIVLPEGVLSSEQRAERISRELYCVTAPLAT |
| Ga0181403_10847312 | 3300017710 | Seawater | MAQQYIIVLAEGTLTSEKRANSITRELYNITTPLAVQEPY |
| Ga0181411_10118902 | 3300017755 | Seawater | MQYIIVLPEGTLTSEKRANSITRELYNITTPLAVQEP |
| Ga0187221_10307912 | 3300017769 | Seawater | MAQQYIIVLPEGTLTSEKRAKSITRELYNITTPLAVQEPYQKDG |
| Ga0181577_100950082 | 3300017951 | Salt Marsh | MSQYIIVLPAGVLTSETRAKQITRELYNITLPIAVQ |
| Ga0181577_101155982 | 3300017951 | Salt Marsh | MSKYIIVLPAGVLTSETRAKQITRELYNITLPIAVQQEY |
| Ga0181577_102777222 | 3300017951 | Salt Marsh | MSKYIIVLPAGVLTSETRAKQITRELYNITLPIAVQEEYHKG |
| Ga0180430_104130172 | 3300018065 | Hypersaline Lake Sediment | MNGYIIVLPEGVLTSKERAEAITRELYCITTPRAVQEPHQ |
| Ga0180430_106937352 | 3300018065 | Hypersaline Lake Sediment | MHGYIIVLPEGVLTSKERAEAITRELYCITTPRAVQEP |
| Ga0206124_101985042 | 3300020175 | Seawater | MNGYIIVLPEGVLSSEQRAERISRELYCVTAPLATQEPYQHP |
| Ga0222717_103884412 | 3300021957 | Estuarine Water | MAQYIIVLPEGTLTSEHRAKAITRELYNITAPLVTQEPYQKDGTVLGV |
| Ga0222718_102200982 | 3300021958 | Estuarine Water | MSKYIIVLPVGVLDSATRAKQITRELYNITVPLAVQADYQKDG |
| Ga0222716_102678821 | 3300021959 | Estuarine Water | MNYIIVLPEGVLNSEQRANRISEELYNITAPLAIQQP |
| Ga0196883_10021361 | 3300022050 | Aqueous | MSYIIVLPEGFLTSEVRAKSITRELYNITVPVAVQEE |
| Ga0196883_10409682 | 3300022050 | Aqueous | MSQYIIVLPEGFLTSEVRAKSITRELYNITVPVAIQKEYQKDATV |
| Ga0212025_10467081 | 3300022057 | Aqueous | MQYIIVLPEGTLTSEKRAKSITRELYNITTPLAVQQ |
| Ga0212024_10402152 | 3300022065 | Aqueous | MSKYIIVLPVGVLDSATRAKQITRELYNITVPLAVQADYQ |
| Ga0212021_10632462 | 3300022068 | Aqueous | MSNYIIVLPVGVLDSATRAKQITRELYNITVPLAVQADYQKDGQVF |
| Ga0212021_11184122 | 3300022068 | Aqueous | MQYIIVLPEGTLTSEKRAKSITRELYNITTPLAVQEPYQK |
| Ga0196889_10138591 | 3300022072 | Aqueous | MDGYIIVLPEGVLSSEQRAERISRELYCVTAPLATQE |
| Ga0212031_10218232 | 3300022176 | Aqueous | MNGYIIVLPEGVLTSKERAEAITRELYCITTPRAVQEPYQADGTVF |
| Ga0212031_10595602 | 3300022176 | Aqueous | MSHYIIVLPVGVLDSATRAKQITRELYNITVPLAVQADYQKDG |
| Ga0212031_10977341 | 3300022176 | Aqueous | MNGYIIVLPQGIHNSKERAEAITRELYCITTPRAVQEPYQHDG |
| Ga0196887_10038136 | 3300022178 | Aqueous | MNGYIIVLPEGVLSSEQRAERISRELYCVTAPLATQEPYQHDGKVFGM |
| Ga0196891_10864072 | 3300022183 | Aqueous | MSKYIIVLPVGVLDSATRAKQITRELYNITVPLAVQADYQKDGQVFG |
| Ga0255781_100990171 | 3300022934 | Salt Marsh | MSKYIIVLPAGVLTSETRAKQITRELYNITLPIAVQQ |
| (restricted) Ga0255048_105241481 | 3300024518 | Seawater | MSKYIIVLPVGVLDSATRAKQITRELYNITVPLAI |
| Ga0208667_10670501 | 3300025070 | Marine | MGYIIILPEGFLTSEVRAKSITRELYNITVPVAIQEEYQKD |
| Ga0209833_10827661 | 3300025641 | Pelagic Marine | MDGYIIVLPEGTLTSEHRAKAITRELYNITAPLVTQEPYQKDGT |
| Ga0208161_10559971 | 3300025646 | Aqueous | MSKYIIVLPVGVLDSATRAKQITRELYNITVPLAVQA |
| Ga0208161_11131872 | 3300025646 | Aqueous | MSNYIIVLPVGVLDSATRAKQITRELYNITVPLAVQADYQKDG |
| Ga0208161_11518102 | 3300025646 | Aqueous | MNGYIIVLPQGVHNSKERAESITRELYCITTPRAVQ |
| Ga0208160_11238401 | 3300025647 | Aqueous | MSYIIVLPEGFLTSEVRAKSITRELYNITVPLAVQAE |
| Ga0208134_11457851 | 3300025652 | Aqueous | MNYIIVLPEGVLNSEQRANRISQELYNITAPLAIQ |
| Ga0208795_10806302 | 3300025655 | Aqueous | MSYIIVLPEGFLTSEVRAKSITRELYNITVPLAVQE |
| Ga0208795_10928341 | 3300025655 | Aqueous | MNGYIIVLPQGIHNSKERAEAITRELYCITTPRAVQEPYQ |
| Ga0209095_10475762 | 3300025685 | Pelagic Marine | MAQYIIVLPEGTLTSEHRAKAITRELYNITAPLVTQEPYQKDGT |
| Ga0208019_10960871 | 3300025687 | Aqueous | MSYIIVLPEGFLTSEVRAKSITRELYNITVPLAVQEE |
| Ga0208019_10980742 | 3300025687 | Aqueous | MSYIIVLPEGFLTSEVRAKSITRELYNITVPLAVQEEYQ |
| Ga0209715_10924331 | 3300025699 | Pelagic Marine | MNGFIIVLPEGTLTSEHRAKAITRELYNITAPLVTQEPYQKD |
| Ga0209602_11330512 | 3300025704 | Pelagic Marine | MNGYIIVLPEGVLSSEQRAERISRELYCVTAPLATQEPYQHDGKVF |
| Ga0208767_10924791 | 3300025769 | Aqueous | MAQQYIIVLAEGTLTSEKRAKSITRELYNITTPLAVQEPYQK |
| Ga0208767_10965972 | 3300025769 | Aqueous | MSKYIIVLPVGVLDSATRAKQITRELYNITVPLAVQAD |
| Ga0208767_11109841 | 3300025769 | Aqueous | MSKYIIVLPVGVLDSSTRAKQITRELYNITVPLAVQADYQKDG |
| Ga0208767_11670582 | 3300025769 | Aqueous | MSKYIIVLPVGVLDSATRAKQITRELYNITVPLAVQADY |
| Ga0208767_11797372 | 3300025769 | Aqueous | MSYIIVLPEGFLTSEVRAKSITRELYNITVPVAIQEEYQ |
| Ga0208425_10449832 | 3300025803 | Aqueous | MSKYIIVLPVGVLDSATRAKQITRELYNITVPLAVQADYQKDGQV |
| Ga0208425_10634101 | 3300025803 | Aqueous | MSKYIIVLPVGVLDSATRAKQITRELYNITVPLAVQ |
| Ga0208425_10918871 | 3300025803 | Aqueous | MAQYIIVLPEGTLTSEKRAKSITRELYNITTPLAIQEPYQKDGAV |
| Ga0208545_10630472 | 3300025806 | Aqueous | MNGYIIVLPEGVLSSEQRAERISRELYCVTAPLATQEPYQHDGKVFGMVE |
| Ga0208785_10195531 | 3300025815 | Aqueous | VLPEGTLTSEKRAKSITRELYNITTPLAIQQPYQKDGTVFGVI |
| Ga0208785_10465612 | 3300025815 | Aqueous | MAQQYIIVLPEGTLTSEKRAKSITRELYNITTPLAI |
| Ga0208917_10139481 | 3300025840 | Aqueous | MNGYIIVLPVGLLSSEARAKAITRELYNITVPVAVQ |
| Ga0208645_11167032 | 3300025853 | Aqueous | MQYIIVLPEGTLTSEKRAKSITRELYNITTPLAIQQPYQKDGTV |
| Ga0208645_12119481 | 3300025853 | Aqueous | MQYIIVLPEGTLTSEKRAKSITRELYNITTPLAIQQPYQ |
| Ga0209631_103584632 | 3300025890 | Pelagic Marine | MNGFIIVLPEGTLTSEHRAKAITRELYNITAPLVTQEPY |
| Ga0209229_100409752 | 3300027805 | Freshwater And Sediment | MGYIIVLPQSPLNSAQRAAAISRELYCITTPVAVQQPYQAEGNVFGVIA |
| Ga0307379_106718931 | 3300031565 | Soil | MNGYIIVLPEGVLSSEQRAERISRELYCVTAPLATQEPYQHDGKVFGIVE |
| Ga0307376_104077172 | 3300031578 | Soil | MNGYIIVLPEGVLSSEQRAERISRELYCVTAPLATQEPYQ |
| Ga0314858_058133_813_947 | 3300033742 | Sea-Ice Brine | MNGYIIVLPEGVLSSEQRAERISRELYCVTAPLATQEPYQHDGIL |
| Ga0348336_088424_3_107 | 3300034375 | Aqueous | MSYIIVLPEGFLTSEVRAKSITRELYNITVPLAVQ |
| ⦗Top⦘ |