


| Basic Information | |
|---|---|
| Family ID | F105129 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 100 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MTTKTRLSACGVSRRDMLRIGAGGLGFGLFGGIGPVPYVFSRAS |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 94.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 92.00 % |
| Associated GOLD sequencing projects | 84 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.26 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (62.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (10.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (44.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (61.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 27.78% β-sheet: 0.00% Coil/Unstructured: 72.22% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.26 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF10518 | TAT_signal | 5.00 |
| PF12796 | Ank_2 | 3.00 |
| PF13520 | AA_permease_2 | 3.00 |
| PF07969 | Amidohydro_3 | 2.00 |
| PF12276 | DUF3617 | 2.00 |
| PF13531 | SBP_bac_11 | 2.00 |
| PF02585 | PIG-L | 1.00 |
| PF01297 | ZnuA | 1.00 |
| PF08811 | DUF1800 | 1.00 |
| PF01557 | FAA_hydrolase | 1.00 |
| PF13432 | TPR_16 | 1.00 |
| PF10370 | DUF2437 | 1.00 |
| PF07681 | DoxX | 1.00 |
| PF13570 | PQQ_3 | 1.00 |
| PF01253 | SUI1 | 1.00 |
| PF08450 | SGL | 1.00 |
| PF11821 | ActD | 1.00 |
| PF12779 | WXXGXW | 1.00 |
| PF03992 | ABM | 1.00 |
| PF00589 | Phage_integrase | 1.00 |
| PF00664 | ABC_membrane | 1.00 |
| PF13671 | AAA_33 | 1.00 |
| PF07995 | GSDH | 1.00 |
| PF12852 | Cupin_6 | 1.00 |
| PF00004 | AAA | 1.00 |
| PF08592 | Anthrone_oxy | 1.00 |
| PF02738 | MoCoBD_1 | 1.00 |
| PF07883 | Cupin_2 | 1.00 |
| PF09537 | DUF2383 | 1.00 |
| PF04014 | MazE_antitoxin | 1.00 |
| PF00474 | SSF | 1.00 |
| PF12867 | DinB_2 | 1.00 |
| PF13453 | zf-TFIIB | 1.00 |
| PF11188 | DUF2975 | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG0023 | Translation initiation factor 1 (eIF-1/SUI1) | Translation, ribosomal structure and biogenesis [J] | 1.00 |
| COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 1.00 |
| COG2133 | Glucose/arabinose dehydrogenase, beta-propeller fold | Carbohydrate transport and metabolism [G] | 1.00 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 1.00 |
| COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 1.00 |
| COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 1.00 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 1.00 |
| COG5267 | Uncharacterized conserved protein, DUF1800 family | Function unknown [S] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 62.00 % |
| Unclassified | root | N/A | 38.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000953|JGI11615J12901_11700538 | All Organisms → cellular organisms → Bacteria | 1017 | Open in IMG/M |
| 3300000956|JGI10216J12902_102674031 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300000956|JGI10216J12902_113308274 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
| 3300001199|J055_10337180 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300004463|Ga0063356_100266275 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2092 | Open in IMG/M |
| 3300004463|Ga0063356_105673276 | Not Available | 535 | Open in IMG/M |
| 3300005178|Ga0066688_10275248 | Not Available | 1082 | Open in IMG/M |
| 3300005330|Ga0070690_101454723 | Not Available | 552 | Open in IMG/M |
| 3300005345|Ga0070692_11418015 | Not Available | 502 | Open in IMG/M |
| 3300005347|Ga0070668_100482819 | All Organisms → cellular organisms → Bacteria | 1070 | Open in IMG/M |
| 3300005353|Ga0070669_101334860 | Not Available | 621 | Open in IMG/M |
| 3300005354|Ga0070675_100482371 | All Organisms → cellular organisms → Bacteria | 1115 | Open in IMG/M |
| 3300005365|Ga0070688_101338340 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 579 | Open in IMG/M |
| 3300005366|Ga0070659_100422266 | All Organisms → cellular organisms → Bacteria | 1128 | Open in IMG/M |
| 3300005455|Ga0070663_100080805 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2388 | Open in IMG/M |
| 3300005457|Ga0070662_100539868 | Not Available | 976 | Open in IMG/M |
| 3300005466|Ga0070685_10926337 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300005467|Ga0070706_100412771 | All Organisms → cellular organisms → Bacteria | 1257 | Open in IMG/M |
| 3300005539|Ga0068853_100640579 | All Organisms → cellular organisms → Bacteria | 1011 | Open in IMG/M |
| 3300005544|Ga0070686_100246985 | Not Available | 1302 | Open in IMG/M |
| 3300005548|Ga0070665_100964311 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300005569|Ga0066705_10520402 | Not Available | 742 | Open in IMG/M |
| 3300005577|Ga0068857_102300909 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300005578|Ga0068854_101819304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 559 | Open in IMG/M |
| 3300005713|Ga0066905_100891817 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300005843|Ga0068860_100209806 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1889 | Open in IMG/M |
| 3300005844|Ga0068862_100920807 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300005844|Ga0068862_101306502 | Not Available | 727 | Open in IMG/M |
| 3300005844|Ga0068862_102371283 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_12_FULL_67_14b | 542 | Open in IMG/M |
| 3300006047|Ga0075024_100639610 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
| 3300006576|Ga0074047_10509831 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
| 3300006844|Ga0075428_100208946 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2110 | Open in IMG/M |
| 3300006847|Ga0075431_101781925 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300006852|Ga0075433_11768980 | Not Available | 531 | Open in IMG/M |
| 3300006854|Ga0075425_100768147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1105 | Open in IMG/M |
| 3300006871|Ga0075434_100638037 | All Organisms → cellular organisms → Bacteria | 1084 | Open in IMG/M |
| 3300006903|Ga0075426_10490472 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
| 3300006954|Ga0079219_10941316 | Not Available | 706 | Open in IMG/M |
| 3300009053|Ga0105095_10087721 | All Organisms → cellular organisms → Bacteria | 1683 | Open in IMG/M |
| 3300009094|Ga0111539_12337547 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 620 | Open in IMG/M |
| 3300009147|Ga0114129_12975593 | Not Available | 558 | Open in IMG/M |
| 3300009156|Ga0111538_11183876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. | 966 | Open in IMG/M |
| 3300009176|Ga0105242_12622349 | Not Available | 553 | Open in IMG/M |
| 3300009239|Ga0103858_10020939 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1444 | Open in IMG/M |
| 3300010047|Ga0126382_12110197 | Not Available | 539 | Open in IMG/M |
| 3300010366|Ga0126379_10171571 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2051 | Open in IMG/M |
| 3300010398|Ga0126383_13467380 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300011432|Ga0137428_1114334 | Not Available | 775 | Open in IMG/M |
| 3300011445|Ga0137427_10466732 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
| 3300012039|Ga0137421_1186822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 610 | Open in IMG/M |
| 3300012200|Ga0137382_10986336 | Not Available | 605 | Open in IMG/M |
| 3300012685|Ga0137397_11175905 | Not Available | 554 | Open in IMG/M |
| 3300012917|Ga0137395_11075307 | Not Available | 572 | Open in IMG/M |
| 3300012976|Ga0134076_10631364 | Not Available | 503 | Open in IMG/M |
| 3300012986|Ga0164304_11076675 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 642 | Open in IMG/M |
| 3300012989|Ga0164305_10510794 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
| 3300013308|Ga0157375_13786891 | Not Available | 502 | Open in IMG/M |
| 3300014326|Ga0157380_12823015 | Not Available | 552 | Open in IMG/M |
| 3300015241|Ga0137418_10365735 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1186 | Open in IMG/M |
| 3300015371|Ga0132258_10142311 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5740 | Open in IMG/M |
| 3300015373|Ga0132257_102138559 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 723 | Open in IMG/M |
| 3300015374|Ga0132255_105581936 | Not Available | 532 | Open in IMG/M |
| 3300018089|Ga0187774_10729369 | Not Available | 660 | Open in IMG/M |
| 3300018476|Ga0190274_13922777 | Not Available | 504 | Open in IMG/M |
| 3300018481|Ga0190271_11059575 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 935 | Open in IMG/M |
| 3300018481|Ga0190271_12518505 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 616 | Open in IMG/M |
| 3300019361|Ga0173482_10292755 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 713 | Open in IMG/M |
| 3300019789|Ga0137408_1255396 | Not Available | 1085 | Open in IMG/M |
| 3300022214|Ga0224505_10298647 | Not Available | 611 | Open in IMG/M |
| 3300022309|Ga0224510_10571712 | Not Available | 667 | Open in IMG/M |
| 3300025923|Ga0207681_10067561 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2479 | Open in IMG/M |
| 3300025925|Ga0207650_11349282 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 607 | Open in IMG/M |
| 3300025930|Ga0207701_11182876 | Not Available | 631 | Open in IMG/M |
| 3300025934|Ga0207686_10758983 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300025934|Ga0207686_10940101 | Not Available | 699 | Open in IMG/M |
| 3300025936|Ga0207670_10187847 | Not Available | 1561 | Open in IMG/M |
| 3300025960|Ga0207651_11422499 | Not Available | 624 | Open in IMG/M |
| 3300025981|Ga0207640_10210309 | All Organisms → cellular organisms → Bacteria | 1481 | Open in IMG/M |
| 3300026116|Ga0207674_11999080 | Not Available | 545 | Open in IMG/M |
| 3300026116|Ga0207674_12042256 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
| 3300026121|Ga0207683_11069502 | Not Available | 748 | Open in IMG/M |
| 3300027748|Ga0209689_1334037 | Not Available | 581 | Open in IMG/M |
| 3300027765|Ga0209073_10424366 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
| 3300027909|Ga0209382_10085421 | All Organisms → cellular organisms → Bacteria | 3714 | Open in IMG/M |
| 3300027910|Ga0209583_10255412 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300028380|Ga0268265_11320147 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300028381|Ga0268264_10615291 | All Organisms → cellular organisms → Bacteria | 1072 | Open in IMG/M |
| 3300028381|Ga0268264_11181456 | Not Available | 774 | Open in IMG/M |
| 3300028536|Ga0137415_11404554 | Not Available | 520 | Open in IMG/M |
| 3300031231|Ga0170824_113181935 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 721 | Open in IMG/M |
| 3300031720|Ga0307469_10875362 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300031720|Ga0307469_12266439 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300031740|Ga0307468_102257533 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
| 3300031910|Ga0306923_11540533 | Not Available | 694 | Open in IMG/M |
| 3300031912|Ga0306921_10678733 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1186 | Open in IMG/M |
| 3300032144|Ga0315910_11263110 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
| 3300032180|Ga0307471_102750056 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 624 | Open in IMG/M |
| 3300032205|Ga0307472_102725784 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300032955|Ga0335076_10122476 | Not Available | 2523 | Open in IMG/M |
| 3300033412|Ga0310810_11470972 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 10.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 7.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 6.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 6.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.00% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 5.00% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 3.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.00% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.00% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 2.00% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.00% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.00% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 2.00% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.00% |
| Lotic | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Lotic | 1.00% |
| River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 1.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.00% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001199 | Lotic microbial communities from nuclear landfill site in Hanford, Washington, USA - IFRC combined assembly | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006576 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009239 | Microbial communities of water from Amazon river, Brazil - RCM11 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011432 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT718_2 | Environmental | Open in IMG/M |
| 3300011445 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2 | Environmental | Open in IMG/M |
| 3300012039 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT534_2 | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300022214 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_4_1 | Environmental | Open in IMG/M |
| 3300022309 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_4_1 | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI11615J12901_117005382 | 3300000953 | Soil | MPTRKLSQCGVSRRDMLRIGAGGLGFGLFGGIGPVPYVFSRASE |
| JGI10216J12902_1026740311 | 3300000956 | Soil | MATKNPLSDCGVSRRDMIRLGAGGLGFSLVGGLGPVPFVLNRASLEAAAEQ |
| JGI10216J12902_1133082741 | 3300000956 | Soil | MATKNPLSECGVSRRDMIRLGAGGLGFSLVGGLGPVPFVLNRASLEAAAEQ |
| J055_103371801 | 3300001199 | Lotic | MTIKSPLSGCGVSRRDMLRIGASGLGLGLYGGLGPVPYVLAQASRASAAATSGR |
| Ga0063356_1002662751 | 3300004463 | Arabidopsis Thaliana Rhizosphere | VTPRTRLTDSGVSRRDLMRLGAGGLGFGLFGGIGPVPYALSQVSQ |
| Ga0063356_1056732761 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MASRDRLSDSGVSRRDMMRLGAGGLGFGLFGGIGPVPYVLSQASQ |
| Ga0066688_102752482 | 3300005178 | Soil | MPTKHLLSGSGVTRRDMIRIGAGGLGFGLFGGFGPVPRVF |
| Ga0070690_1014547232 | 3300005330 | Switchgrass Rhizosphere | VTTKTGLSDSSGVSRRDMMRLGAGGIGFGLFGGLGPVPYVLNQ |
| Ga0070692_114180151 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MPTKHPLSDSGVTRRDMIRIGAGGLGFGLFGGFGPVPRVFSQASLQAA |
| Ga0070668_1004828192 | 3300005347 | Switchgrass Rhizosphere | VTTKNGLSDSGVSRRDMMRIGAGGLGFGLFGGLGPVPYVL |
| Ga0070669_1013348601 | 3300005353 | Switchgrass Rhizosphere | MPTRKLCQCGVSRRDMLRIGAGGLGFGLFGGIGPVPHVFSRASEVA |
| Ga0070675_1004823711 | 3300005354 | Miscanthus Rhizosphere | VTTKDGLSDSSGVSRRDMMRLGAGGIGFGLFGGLGPVPFVLNQASLDAATNQSGRI |
| Ga0070688_1013383402 | 3300005365 | Switchgrass Rhizosphere | MPSRGPLSGCGVSRRDLMRLGAGGFGFGLFGGIGPVPFVLGQASRAAA |
| Ga0070659_1004222662 | 3300005366 | Corn Rhizosphere | MPTRKLCQCGVSRRDMLRIGAGGLGFGLFGGIGPVPHVFSRASEV |
| Ga0070663_1000808054 | 3300005455 | Corn Rhizosphere | MTTKDGLSDASGVSRRDLMRLGAGGIGFGLFGGLGPVPYVLNQASLAAATNT |
| Ga0070662_1005398681 | 3300005457 | Corn Rhizosphere | MSVHDKLAASGVSRRDMLRIGAGGVGFSLFGGIGPVPAVFG |
| Ga0070685_109263372 | 3300005466 | Switchgrass Rhizosphere | VTTKNPWNKINVSRRDMLRLGAGGIGLGLFGGIGPVPPVL |
| Ga0070706_1004127711 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MPTKHLVGGSGVTRRDMIRMGAGGLGFGLFGGLGPVPRVF |
| Ga0068853_1006405791 | 3300005539 | Corn Rhizosphere | MPTRKLCQCGVSRRDMLRIGAGGLGFGLFGGIGPVRHVFSRASQVA |
| Ga0070686_1002469851 | 3300005544 | Switchgrass Rhizosphere | VRGACEALMSVHDKLAASGVSRRDMLRIGAGGVGFSLFGGIGPV |
| Ga0070665_1009643111 | 3300005548 | Switchgrass Rhizosphere | VTTKNGLSDSGVSRRDMMRIGAGGLGFGLFGGLGPVPYV |
| Ga0066705_105204022 | 3300005569 | Soil | MTTKTRLSGCGVSRRDMLRIGAGGLGFGLFGGIGPVPYLFSRASEVAAQTASDK |
| Ga0068857_1023009092 | 3300005577 | Corn Rhizosphere | MTTRNPLTGTGVSRRDMLRLGAGGIGLGLFGGIGSVPPVLSQASSSVAAK |
| Ga0068854_1018193041 | 3300005578 | Corn Rhizosphere | MTIPTKLCDCGISRRDLIRLGAGGLGFGLFGGLGPVPYVFSRASEVAAATD |
| Ga0066905_1008918172 | 3300005713 | Tropical Forest Soil | MSTTTWSGCGVSRRDMIRLGAGGLGFGLFGGIGPVPYVFRTASEV |
| Ga0068860_1002098061 | 3300005843 | Switchgrass Rhizosphere | MTAKTRLSDSGVSRRDMLRIGAGGLGFGLFGGIGPVPYVFSR |
| Ga0068862_1009208072 | 3300005844 | Switchgrass Rhizosphere | VTTKNPWNKINVSRRDMLRLGAGGIGLGLFGGIGPVPPVLAQASR |
| Ga0068862_1013065021 | 3300005844 | Switchgrass Rhizosphere | VTTRNGLSDSGVSRRDMMRLGAGGIGFGLFGGLGPVPYVLNQASLAA |
| Ga0068862_1023712832 | 3300005844 | Switchgrass Rhizosphere | MPIKSPLCGCGVSRRDMLRIGASGLGLGLYGGLGPVPYVLAQASRASAAST |
| Ga0075024_1006396101 | 3300006047 | Watersheds | MTTNCRLSACGVSRRDMLRIGAGGLGFGLFGGIGPVPYVFSRASE |
| Ga0074047_105098311 | 3300006576 | Soil | MTTKTRLSACGVSRRDMLRIGAGGLGFGLFGGIGPVPYVFSRAS |
| Ga0075428_1002089461 | 3300006844 | Populus Rhizosphere | MPTKDLLSGSGVTRRDMIRIGAGGLGFGLLGGFGPVPRVFSQASLQAAA |
| Ga0075431_1017819252 | 3300006847 | Populus Rhizosphere | MPSKHLLSDSGVTRRDMIRIGAGGLGFGLLGGFGPVPRVFSQA |
| Ga0075433_117689801 | 3300006852 | Populus Rhizosphere | MPGRNRSDDSGVSRRDMMRLGAGGLGFGLFGGVGPVPFVFSQASR |
| Ga0075425_1007681471 | 3300006854 | Populus Rhizosphere | MPKHDPLSASGLSRRDLLRLGAGGIGLGLAGGLGTVPT |
| Ga0075434_1006380372 | 3300006871 | Populus Rhizosphere | MPSKHLLSDSGVTRRDMIRMGAGGLGLGLFGGFGPVPRVFSQASLQAAAH |
| Ga0075426_104904721 | 3300006903 | Populus Rhizosphere | MPTKHLVGGSGVTRRDMIRLGAGGLGFGLFGGLGPVPRVFSEA |
| Ga0079219_109413162 | 3300006954 | Agricultural Soil | MTTTDGLSDASGVSRRDLMRLGVGGIGFGLFGGLGPVPYVLNQA |
| Ga0105095_100877213 | 3300009053 | Freshwater Sediment | MTIKSPLRGCGVSRRDMLRIGASGLGLGLYGGLGPVPYVLAQASRASAAA |
| Ga0111539_123375472 | 3300009094 | Populus Rhizosphere | MSTKNPLIDSGISRRDMIRIGAGGMGFNLLGGIGPVP |
| Ga0114129_129755932 | 3300009147 | Populus Rhizosphere | MATKRRLTDCGVSRRDIIRIGASGLGFGLFGGIGP |
| Ga0111538_111838763 | 3300009156 | Populus Rhizosphere | MARSRLSDGSGVSRRELIRLGAGGVGFGLFGGLGPVPYVLAQAS |
| Ga0105242_126223492 | 3300009176 | Miscanthus Rhizosphere | MTTRSRLSACGVSRRDMLRIGAGGLGFGLFGGIGPVPYV |
| Ga0103858_100209391 | 3300009239 | River Water | MTTHKELCDCGVSRRDMMKIGAGGLGFALTGGIGS |
| Ga0126382_121101971 | 3300010047 | Tropical Forest Soil | MSLKSPLDGCGVSRRDMLRIGASGLGLGLYGGLGPVPYVLAQAS |
| Ga0126379_101715715 | 3300010366 | Tropical Forest Soil | MTTKNPLTGTGVSRRDMLRLGAGGIGLGLFGGIGQVPPVLSQASY |
| Ga0126383_134673802 | 3300010398 | Tropical Forest Soil | MSIHHKLSDCGVSRRDMIRIGAGGLGFGLFGGLGPVPYVFGKASAAAATTSSGKI |
| Ga0137428_11143342 | 3300011432 | Soil | MTIKNPLSSCGVSRRDLLRIGASGLGLGLYGGLGPVPYVL |
| Ga0137427_104667321 | 3300011445 | Soil | MNITSRLRDSGVSRREMMRIGAGGLGFSLFGGIGPVPHVLSQASWAAAA |
| Ga0137421_11868221 | 3300012039 | Soil | MTKWDETGVSRRDLMRLGAGGLGLGLLGGVGSVPSVLAQAARSVSA |
| Ga0137382_109863361 | 3300012200 | Vadose Zone Soil | MPTKHLLSGSGGTRRDMIRMGAGGLGFSLFGGLGPVPRVFNQSS |
| Ga0137397_111759051 | 3300012685 | Vadose Zone Soil | MPTKHLLSGSGVTRRDMIRMGAGGLGFGLFGGLGPVPRVF |
| Ga0137395_110753071 | 3300012917 | Vadose Zone Soil | MTIPKKLCDCGISRRDLIRLGAGGLGFGLFGGLGPVPYLFSKAS |
| Ga0134076_106313641 | 3300012976 | Grasslands Soil | MSMHKTLAHCGVSRRDLMRLGAGGLGFGLFGGFGPVPYVFSKASE |
| Ga0164304_110766752 | 3300012986 | Soil | MPTKQLLGGSGVTRRDMIRLGAGGLGFGLIGGLGPV |
| Ga0164305_105107942 | 3300012989 | Soil | MSAHKKLTDCGISRRDLMRLGTGGLGFGLFGGIGPVPYVFSKAS |
| Ga0157375_137868911 | 3300013308 | Miscanthus Rhizosphere | MTTKSRLSDCGVSRRDMIRIGAGGLGFGLFGGFGPVPAVLAQASRAASAP |
| Ga0157380_128230151 | 3300014326 | Switchgrass Rhizosphere | MTAKNLLTGTNISRRDMLRFGAGGVGLGLFGGIGPVPPVLAQASRS |
| Ga0137418_103657351 | 3300015241 | Vadose Zone Soil | MPTKHLLSGSGVTRRDMIRMGAGGLGFSLFGGFGPVPRVFNQASL |
| Ga0132258_101423111 | 3300015371 | Arabidopsis Rhizosphere | MSSGNRLQRDSGVSRRDMMRIGAGGLGFGLFGGIGPVPYL |
| Ga0132257_1021385592 | 3300015373 | Arabidopsis Rhizosphere | MSTHDKLSDCGVSRRDMILIGAGGLGFGLFGGIGPVPSVFGQASAAAAAAN |
| Ga0132255_1055819361 | 3300015374 | Arabidopsis Rhizosphere | MATKNPWNEINVSRRDMLRIGAGGIGLGLFGGIGPVPPVLSQASRS |
| Ga0187774_107293691 | 3300018089 | Tropical Peatland | MITKKVLADCGVSRRDMLRIGAGGLGFGLFGGLGPVPYIFSKATEAA |
| Ga0190274_139227771 | 3300018476 | Soil | MSSKSRLSDCGVSRRDMMRIGAGGLGFGLFGGIGPVPYVLAQASQAAATNTSGK |
| Ga0190271_110595752 | 3300018481 | Soil | VTTKNGLSDSGVSRRDMMRLGAGGLGFGLFGGLGPVPYVLNQASLAA |
| Ga0190271_125185052 | 3300018481 | Soil | MTTKNPLSGCGVSRRDMLRIDASGLGLGLYGGLGPVP |
| Ga0173482_102927551 | 3300019361 | Soil | MPIKHPLSGSGVTRRDMIRIGAGGLGFGLFGGFGPVPRVFGQAS |
| Ga0137408_12553962 | 3300019789 | Vadose Zone Soil | MTNKNPLTGTGVSRRDMLRLGAGGIGLGLFGGVGPVPP |
| Ga0224505_102986472 | 3300022214 | Sediment | MKNRLSECGVSRRDMIRIGAGGLGFGLFGGLGPVPFVFSRATL |
| Ga0224510_105717122 | 3300022309 | Sediment | MKNRLSECGVSRRDMIRIGAGGLGFGLFGGLGPVPFVFSRATLEA |
| Ga0207681_100675611 | 3300025923 | Switchgrass Rhizosphere | MTTSNGLSDSSGVSRRDMMRLGAGGIGFGLFGGLGPVPY |
| Ga0207650_113492821 | 3300025925 | Switchgrass Rhizosphere | MASKSRLTDCGVSRRDMIRIGAGGLGFGLLGGIGPVPFVLNRATLQAAAEESG |
| Ga0207701_111828762 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MASKSRLTDCGVSRRDMIRIGAGGLGFGLLGGIGPVPFVLNRATLQAAAEE |
| Ga0207686_107589831 | 3300025934 | Miscanthus Rhizosphere | MPTKHLLSGSGVTRRDMIRLGAGGLGFGLFGGFGPVPRV |
| Ga0207686_109401012 | 3300025934 | Miscanthus Rhizosphere | MTTKSRLSASGVSRRDMLRIGASGLGFGLFGGIGPVPY |
| Ga0207670_101878473 | 3300025936 | Switchgrass Rhizosphere | VTTKTGLSDSSGVSRRDMMRLGAGGIGFGLFGGLGPV |
| Ga0207651_114224991 | 3300025960 | Switchgrass Rhizosphere | MPTRKLSQCGVSRRDMLRIGAGGLGFGLFGGIGPVPHVFSRASEVAAAAESGKI |
| Ga0207640_102103091 | 3300025981 | Corn Rhizosphere | MPTRKLCQCGVSRRDMLRIGAGGLGFGLFGGIGPVPHVFSRASQVAAAAESGK |
| Ga0207674_119990801 | 3300026116 | Corn Rhizosphere | MATKHLVNASGVTRRDMIRLGAGGLGFGLFGGFGPVPEVFSEASLQAAAHDSGRILVVF |
| Ga0207674_120422562 | 3300026116 | Corn Rhizosphere | MTTRNPLTGTGVSRRDMLRLGAGGIGLGLFGGIGSVPPVLSQASSSVAAKQ |
| Ga0207683_110695023 | 3300026121 | Miscanthus Rhizosphere | MTTNDRLGETGLSRRDMLRLGAGGLGLGLFGGIGSVPPVLAQASRSVATNGAA |
| Ga0209689_13340371 | 3300027748 | Soil | MPTKHLLSGSGVTRRDMIRIGAGGIGFGLFGGIGPVPRL |
| Ga0209073_104243661 | 3300027765 | Agricultural Soil | MTTKNPLTETSVSRRDMLRLGAGGLGLGLFGGIGHVPPVFSQASYSVAAKQ |
| Ga0209382_100854215 | 3300027909 | Populus Rhizosphere | MPTNSRLTGCGVSRRDMIRIGAGGLGFGLFGGLGPVPYVFGKASEVAAAANSGKIL |
| Ga0209583_102554121 | 3300027910 | Watersheds | MTTKTRLSGCGVSRRDMLRIGAGGLGFGLFGGIGPVPYLFSRASEVAAQTA |
| Ga0268265_113201471 | 3300028380 | Switchgrass Rhizosphere | VTTKNPWNKINVSRRDMLRLGAGGIGLGLFGGIGPVPPVLAQ |
| Ga0268264_106152911 | 3300028381 | Switchgrass Rhizosphere | VTTKNGLSDSGVSRRDMMRIGAGGLGFGLFGGIGPVP |
| Ga0268264_111814562 | 3300028381 | Switchgrass Rhizosphere | MTTRSRLSACGVSRRDMLRIGAGGLGFGLFGGIGPVPYVFSRASEVVAEAASNKILV |
| Ga0137415_114045541 | 3300028536 | Vadose Zone Soil | MTIPKKLADCGISRRDLIRLGTGGLGFSLVGGIGPVP |
| Ga0170824_1131819351 | 3300031231 | Forest Soil | MTTKTRLSDCGVSRRDMLRIGASGLGFGLFGGIGPVPYVFSRASE |
| Ga0307469_108753622 | 3300031720 | Hardwood Forest Soil | MTTMRRLSKCGVSRRDMMRLGAGGLGFGLFGGLGPVPYVLSQASLAAATRSGRI |
| Ga0307469_122664391 | 3300031720 | Hardwood Forest Soil | MTTRTRLSACGVSRRDMLRIGASGLGFGLFGGIGPVPYVFSRASEVVAQ |
| Ga0307468_1022575331 | 3300031740 | Hardwood Forest Soil | MTIRNPLCGCGVSRRDMLRIGASGLGLGLYGGLGPVP |
| Ga0306923_115405331 | 3300031910 | Soil | MTTKNPLTETSVSRRDMLRLGAGGLGLGLFGGIGYVPPVFSQASYSIAAKQS |
| Ga0306921_106787332 | 3300031912 | Soil | MSTQKLNESGISRRDMIRIGTGGLGFGLFGGIGPVPYL |
| Ga0315910_112631102 | 3300032144 | Soil | MTKRLSDCGVSRRDMIRIGAGGVGFGLFGGLGPVPFVFSQASLE |
| Ga0307471_1027500562 | 3300032180 | Hardwood Forest Soil | MPTRKLCRCDVSRRDMLRIGAGGLGFGLFGGIGPVPRVFSRASEVAAA |
| Ga0307472_1027257841 | 3300032205 | Hardwood Forest Soil | MSTHDKLSDCGVSRRDMIRIGAGGLGFGLFGGIGPVPSVFGQASAAAAAANNSGKILV |
| Ga0335076_101224761 | 3300032955 | Soil | MASNDPFRNCDISRRDVIRIGSAGLGFGLFGGIGPVPYIFSRASEVAA |
| Ga0310810_114709722 | 3300033412 | Soil | MPTKQLLGGSGVTRRDMIRLGAGGLGFGLIGGLGPVPRVFSEA |
| ⦗Top⦘ |