


| Basic Information | |
|---|---|
| Family ID | F105059 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 100 |
| Average Sequence Length | 44 residues |
| Representative Sequence | DGCCYDWGYDVFVDGEKIGQINDTPEELADLLNEYFNSKEK |
| Number of Associated Samples | 79 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 8.00 % |
| % of genes from short scaffolds (< 2000 bps) | 7.00 % |
| Associated GOLD sequencing projects | 71 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (93.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine (47.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (47.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (89.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 31.71% β-sheet: 14.63% Coil/Unstructured: 53.66% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF01844 | HNH | 8.00 |
| PF11645 | PDDEXK_5 | 5.00 |
| PF04466 | Terminase_3 | 3.00 |
| PF08800 | VirE_N | 2.00 |
| PF02195 | ParBc | 2.00 |
| PF13649 | Methyltransf_25 | 2.00 |
| PF01555 | N6_N4_Mtase | 1.00 |
| PF00149 | Metallophos | 1.00 |
| PF01145 | Band_7 | 1.00 |
| PF06356 | DUF1064 | 1.00 |
| PF04434 | SWIM | 1.00 |
| PF01467 | CTP_transf_like | 1.00 |
| PF07659 | DUF1599 | 1.00 |
| PF04488 | Gly_transf_sug | 1.00 |
| PF12684 | DUF3799 | 1.00 |
| PF05658 | YadA_head | 1.00 |
| PF03013 | Pyr_excise | 1.00 |
| PF05343 | Peptidase_M42 | 1.00 |
| PF08291 | Peptidase_M15_3 | 1.00 |
| PF09511 | RNA_lig_T4_1 | 1.00 |
| PF01507 | PAPS_reduct | 1.00 |
| PF11922 | DUF3440 | 1.00 |
| PF01464 | SLT | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG1783 | Phage terminase large subunit | Mobilome: prophages, transposons [X] | 3.00 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 1.00 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 1.00 |
| COG1362 | Aspartyl aminopeptidase | Amino acid transport and metabolism [E] | 1.00 |
| COG1363 | Putative aminopeptidase FrvX | Carbohydrate transport and metabolism [G] | 1.00 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 1.00 |
| COG2195 | Di- or tripeptidase | Amino acid transport and metabolism [E] | 1.00 |
| COG3774 | Mannosyltransferase OCH1 or related enzyme | Cell wall/membrane/envelope biogenesis [M] | 1.00 |
| COG4279 | Uncharacterized protein, contains SWIM-type Zn finger domain | Function unknown [S] | 1.00 |
| COG4715 | Uncharacterized protein, contains SWIM-type Zn finger domain | Function unknown [S] | 1.00 |
| COG5431 | Predicted nucleic acid-binding protein, contains SWIM-type Zn-finger domain | General function prediction only [R] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 93.00 % |
| All Organisms | root | All Organisms | 7.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001950|GOS2227_1040472 | Not Available | 1417 | Open in IMG/M |
| 3300005824|Ga0074474_1308370 | All Organisms → Viruses → Predicted Viral | 2433 | Open in IMG/M |
| 3300005824|Ga0074474_1322755 | Not Available | 44787 | Open in IMG/M |
| 3300006639|Ga0079301_1104995 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 862 | Open in IMG/M |
| 3300007692|Ga0102823_1063904 | Not Available | 980 | Open in IMG/M |
| 3300019200|Ga0180036_1049047 | All Organisms → Viruses → Predicted Viral | 1497 | Open in IMG/M |
| 3300021336|Ga0210307_1064250 | Not Available | 747 | Open in IMG/M |
| 3300022374|Ga0210311_1004497 | All Organisms → Viruses → Predicted Viral | 1656 | Open in IMG/M |
| 3300024346|Ga0244775_10034196 | All Organisms → Viruses → Predicted Viral | 4509 | Open in IMG/M |
| 3300025695|Ga0209653_1065289 | All Organisms → Viruses → Predicted Viral | 1303 | Open in IMG/M |
| 3300028416|Ga0228614_1006106 | All Organisms → Viruses → Predicted Viral | 3731 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 47.00% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 10.00% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 10.00% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 9.00% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 6.00% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 4.00% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 3.00% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.00% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 1.00% |
| Meromictic Pond | Environmental → Aquatic → Freshwater → Pond → Unclassified → Meromictic Pond | 1.00% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 1.00% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 1.00% |
| Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 1.00% |
| Marine Harbor | Environmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor | 1.00% |
| Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water | 1.00% |
| Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 1.00% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000853 | Marine plume microbial communities from the Columbia River - Metatranscriptome 15 PSU | Environmental | Open in IMG/M |
| 3300001950 | Marine microbial communities from Delaware Bay, New Jersey, USA - GS011 | Environmental | Open in IMG/M |
| 3300003216 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNA | Environmental | Open in IMG/M |
| 3300003345 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_90LU_22_DNA | Environmental | Open in IMG/M |
| 3300003346 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_74LU_5_DNA | Environmental | Open in IMG/M |
| 3300003617 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_105LU_22_DNA | Environmental | Open in IMG/M |
| 3300003621 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_85LU_5_DNA | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005824 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.180_BBC | Environmental | Open in IMG/M |
| 3300005825 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.184_BBB | Environmental | Open in IMG/M |
| 3300005826 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.186_BBA | Environmental | Open in IMG/M |
| 3300005828 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.182_BBI | Environmental | Open in IMG/M |
| 3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
| 3300005942 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757 | Environmental | Open in IMG/M |
| 3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007544 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 | Environmental | Open in IMG/M |
| 3300007545 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3 | Environmental | Open in IMG/M |
| 3300007547 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02 | Environmental | Open in IMG/M |
| 3300007550 | Estuarine microbial communities from the Columbia River estuary - metaG 1549A-3 | Environmental | Open in IMG/M |
| 3300007553 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.689 | Environmental | Open in IMG/M |
| 3300007554 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709 | Environmental | Open in IMG/M |
| 3300007557 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.715 | Environmental | Open in IMG/M |
| 3300007558 | Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.733 | Environmental | Open in IMG/M |
| 3300007590 | Estuarine microbial communities from the Columbia River estuary - metaG 1562A-02 | Environmental | Open in IMG/M |
| 3300007620 | Estuarine microbial communities from the Columbia River estuary - metaG 1546C-02 | Environmental | Open in IMG/M |
| 3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
| 3300007651 | Estuarine microbial communities from the Columbia River estuary - metaG 1555C-3 | Environmental | Open in IMG/M |
| 3300007681 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.753 | Environmental | Open in IMG/M |
| 3300007692 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.743 | Environmental | Open in IMG/M |
| 3300007715 | Estuarine microbial communities from the Columbia River estuary - metaG S.751 | Environmental | Open in IMG/M |
| 3300007778 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009024 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705 | Environmental | Open in IMG/M |
| 3300009050 | Estuarine microbial communities from the Columbia River estuary - metaG 1557A-02 | Environmental | Open in IMG/M |
| 3300009056 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 | Environmental | Open in IMG/M |
| 3300009059 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 | Environmental | Open in IMG/M |
| 3300009450 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 4m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
| 3300009917 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 7, 8m depth; RNA IDBA-UD | Environmental | Open in IMG/M |
| 3300017706 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaG | Environmental | Open in IMG/M |
| 3300019200 | Estuarine microbial communities from the Columbia River estuary - R.1175 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020335 | Marine microbial communities from Tara Oceans - TARA_B100000768 (ERX556030-ERR599035) | Environmental | Open in IMG/M |
| 3300021313 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.304 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021336 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1073 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022061 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v2) | Environmental | Open in IMG/M |
| 3300022068 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2) | Environmental | Open in IMG/M |
| 3300022374 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1166 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300023112 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_2_MG | Environmental | Open in IMG/M |
| 3300024226 | Seawater microbial communities from Monterey Bay, California, United States - 81D | Environmental | Open in IMG/M |
| 3300024255 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_10_MG | Environmental | Open in IMG/M |
| 3300024264 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_10_MG | Environmental | Open in IMG/M |
| 3300024296 | Seawater microbial communities from Monterey Bay, California, United States - 36D | Environmental | Open in IMG/M |
| 3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024520 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_1 | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025695 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_116LU_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025879 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_85LU_5_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300027197 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.743 (SPAdes) | Environmental | Open in IMG/M |
| 3300027198 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.753 (SPAdes) | Environmental | Open in IMG/M |
| 3300027219 | Estuarine microbial communities from the Columbia River estuary - metaG 1546A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027221 | Estuarine microbial communities from the Columbia River estuary - metaG 1548A-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027228 | Estuarine microbial communities from the Columbia River estuary - metaG 1550A-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027229 | Estuarine microbial communities from the Columbia River estuary - metaG 1549B-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027235 | Estuarine microbial communities from the Columbia River estuary - metaG 1553A-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027238 | Estuarine microbial communities from the Columbia River estuary - metaG 1555C-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027245 | Estuarine microbial communities from the Columbia River estuary - metaG 1556B-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027246 | Estuarine microbial communities from the Columbia River estuary - metaG 1555B-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027278 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 (SPAdes) | Environmental | Open in IMG/M |
| 3300027416 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757 (SPAdes) | Environmental | Open in IMG/M |
| 3300027751 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 (SPAdes) | Environmental | Open in IMG/M |
| 3300027753 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 (SPAdes) | Environmental | Open in IMG/M |
| 3300027956 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300028416 | Seawater microbial communities from Monterey Bay, California, United States - 15D | Environmental | Open in IMG/M |
| 3300029293 | Marine harbor viral communities from the Indian Ocean - SCH2 | Environmental | Open in IMG/M |
| 3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| NpTDRAFT_1040353 | 3300000853 | Freshwater And Marine | MKISVEYWDYTCGDGCCYDWGYDVFVDGEKIGQINDTPEELADLLNEYFNTKEK* |
| GOS2227_10404721 | 3300001950 | Marine | GYDVYVDGKKIGQTIGEDAQELADLLNETFNTKEK* |
| JGI26079J46598_10102296 | 3300003216 | Marine | MKISVEYWDYTCGDGCCYDWGYDVFVDGEKIGQINDTPEELADLLNEYFNSKEK* |
| JGI26080J50196_10108047 | 3300003345 | Marine | MKISVEYWDYTCGDGCCYDWGYDVFVDGEKIGQINDTPEDLADLLNEYFNSKEK* |
| JGI26080J50196_10368655 | 3300003345 | Marine | CGDGCCYDWGYDVFVDGEKIGQINDTPEELADLLNEYFNSKEK* |
| JGI26081J50195_100780611 | 3300003346 | Marine | YWDYTCGDGCCYDWGYDVFVDGEKIGQINDTPEDLADLLNEYFNSKEK* |
| JGI26082J51739_100187131 | 3300003617 | Marine | MKISVEYWDYTCGDGCCYDWGYDVFVDGEKIGXINDTPEXLADLLNEYFNSKEK* |
| JGI26083J51738_100460712 | 3300003621 | Marine | MKISVEYWDYTCGDGCCYDWGYDVFVDGEKIGQINDTPEELADLLNEYFNSKEKWKQEK* |
| Ga0078894_108137341 | 3300005662 | Freshwater Lake | GYDVWVDGKRIGFTTGEDAQELAELLNETFNTNEK* |
| Ga0074474_13083707 | 3300005824 | Sediment (Intertidal) | CYDWGYDVFVDGEKIGQINDTPEELADLLNEYFNSKEK* |
| Ga0074474_132275551 | 3300005824 | Sediment (Intertidal) | CGDGCCYDWGYDVFVDGEKIGQINDTPEELADLLNEYFNTKEK* |
| Ga0074476_109016151 | 3300005825 | Sediment (Intertidal) | CCYDWGYDVFVDGEKIGQINDTPEELADLLNEYFNTKEK* |
| Ga0074476_15797751 | 3300005825 | Sediment (Intertidal) | YDWGYDVFVDGEKIGQINDTPEELADLLNEYFNSKEK* |
| Ga0074477_16863401 | 3300005826 | Sediment (Intertidal) | DGCCYDWGYDVFVDGEKIGQINDTPEELADLLNEYFNTKEK* |
| Ga0074475_108203774 | 3300005828 | Sediment (Intertidal) | CCYDWGYDVFVDGEKIGQINDTPEELADLLNEYFNSKEK* |
| Ga0070743_100046471 | 3300005941 | Estuarine | GYDVFVDGEKIGQINDTPEELADLLNEYFNTKEK* |
| Ga0070743_101712311 | 3300005941 | Estuarine | GCCYDWGYDVFVDGEKIGQINDTPEELADLLNEYFNTKER* |
| Ga0070742_100416491 | 3300005942 | Estuarine | GDGCCYDWGYDVFVDGEKIGQINDTPEELADLLNEYFNTKEK* |
| Ga0075461_102593091 | 3300006637 | Aqueous | MKISVEYWDYTCGDGCCHDWGYDVFVDGEKIGQINDTPEELADLLNEYFNSKEK* |
| Ga0079301_11049951 | 3300006639 | Deep Subsurface | CGDGCCDTYGYDVFVDGEKIGSIGEDAQELADLLNKTFNINDRHN* |
| Ga0070749_101613109 | 3300006802 | Aqueous | CCYTTGYDVYVDGEKIGFTTCEDATELVELLNEYFNTKEK* |
| Ga0070753_10642425 | 3300007346 | Aqueous | ADGCCYTTGYDVFIDGEKIGHTIGEDAQELAELLNETFNTNEK* |
| Ga0070753_12699494 | 3300007346 | Aqueous | ADGCCYTTGYDVFIDGEKIGHTIGEDAQELAELLNETFNTKEK* |
| Ga0102861_10847802 | 3300007544 | Estuarine | DWGYDVFVDGEKIGQINDTPEELADLLNEYFNSKEK* |
| Ga0102873_10000511 | 3300007545 | Estuarine | TCGDGCCYDWGYDVFVDGEKIGQINDTPEELADLLNEYFNTKEK* |
| Ga0102875_11013651 | 3300007547 | Estuarine | EMKISVEYWDYTCGDGCCYDWGYDVFVDGEKIGQINDTPEDLADLLNEYFNSKEK* |
| Ga0102880_10711154 | 3300007550 | Estuarine | SVEYWDYTCGDGCCYDWGYDVFVDGEKIGQINDTPEDLADLLNEYFNSKEK* |
| Ga0102819_10191871 | 3300007553 | Estuarine | CYDWGYDVFVDGEKIGQINDTPEELADLLNEYFNTKEK* |
| Ga0102819_10275543 | 3300007553 | Estuarine | GYDVFVDGEKIGQINDTPEELADLLNEYFNSKEK* |
| Ga0102820_10115294 | 3300007554 | Estuarine | GCCYDWGYDVFVDGEKIGQINDTPEELADLLNEYFNSKEKWDM* |
| Ga0102821_10072331 | 3300007557 | Estuarine | WGYDVFVDGEKIGQINDTPEELADLLNEYFNTKEK* |
| Ga0102821_10146796 | 3300007557 | Estuarine | DGCCYDWGYDVFVDGEKIGQINDTPEELADLLNEYFNTKER* |
| Ga0102822_10194034 | 3300007558 | Estuarine | CYDWGYDVFVDGEKIGQINDTPEELADLLNEYFNSKEKWDM* |
| Ga0102917_11365162 | 3300007590 | Estuarine | TCGDGCCYDWGYDVFVDGEKIGQINDTPEELADLLNEYFNSKEK* |
| Ga0102871_11014774 | 3300007620 | Estuarine | WGYDVFVDGEKIGQINDTPEELADLLNEYFNSKEK* |
| Ga0070751_12159161 | 3300007640 | Aqueous | REMKISVEYWDYTCGDGCCYDWGYDVFVDGEKIGQINDTPEELADLLNEYFNSKEK* |
| Ga0102900_10495644 | 3300007651 | Estuarine | WDYTCGDGCCYDWGYDVFVDGEKIGQINDTPEDLADLLNEYFNSKEK* |
| Ga0102824_11404244 | 3300007681 | Estuarine | CGDGCCYDWGYDVFVDGEKIGQINDTPEELADLLNEYFNTNEK* |
| Ga0102823_10639043 | 3300007692 | Estuarine | YDWGYDVFVDGEKIGQINDTPEELADLLNEYFNTNEK* |
| Ga0102823_11674811 | 3300007692 | Estuarine | REMKISVEYWDYTCGDGCCYDWGYDVFVDGEKIGQINDTPAELADLLNEYFNTKEK* |
| Ga0102827_10598024 | 3300007715 | Estuarine | MKISVEYWDYTCGDGCCYDWGYDVFVDGEKIGQINDTPEELADLLNEYFN |
| Ga0102954_11362853 | 3300007778 | Water | TGYDVFVDGKKIGQTLGEDAQELADLLNETFNTKER* |
| Ga0102811_10304631 | 3300009024 | Estuarine | GCCYDWGYDVFVDGEKIGQINDTPEELADLLNEYFNSKEK* |
| Ga0102909_11486343 | 3300009050 | Estuarine | KISVEYWDYTCGDGCCYDWGYDVFVDGEKIGQINDTPEDLADLLNEYFNSKEK* |
| Ga0102860_12313883 | 3300009056 | Estuarine | DGCCYDWGYDVFVDGEKIGQINDTPEELADLLNEYFNSKEQ* |
| Ga0102830_10182405 | 3300009059 | Estuarine | GCCYDWGYDVFVDGEKIGQINDTPEELADLLNEYFNTNEK* |
| Ga0102830_11387361 | 3300009059 | Estuarine | GCCYDWGYDVFVDGEKIGQINDTPEELADLLNEYFNTKEK* |
| Ga0102830_12185913 | 3300009059 | Estuarine | CCYDWGYDVFVDGEKIGQINDTPEELADLLNEYFNSKER* |
| Ga0127391_10384352 | 3300009450 | Meromictic Pond | MKISVEYWDYTCGDGCCYNWGYDVFVDGEKIGQINDTPEELADLLNEYFNTKEK* |
| Ga0132239_1043041 | 3300009917 | Meromictic Pond | CYNWGYDVFVDGEKIGQINDTPEELADLLNEYFNTKEK* |
| Ga0181377_10902272 | 3300017706 | Marine | MKISVEYWDYTCGDGCCYDWGYDVFVDGEKIGQINDTPEDLADLLNEYFNSKEK |
| Ga0180036_10490475 | 3300019200 | Estuarine | MKISVEYWDYTCGDGCCYDWGYDVFVDGEKIGQINDTPEELADLLNEYFNSKEK |
| Ga0211690_11209243 | 3300020335 | Marine | YTCGDGCCYDWGYDVFVDGEKIGQINDTPEELADLLNEYFNSKEK |
| Ga0210333_13068904 | 3300021313 | Estuarine | MKISVEYWDYTCGDGCCYDWGYDVFVDGEKIGQINDTPEELADLLNEYFNTKEK |
| Ga0210307_10642501 | 3300021336 | Estuarine | VLWCCYDWGYDVFVDGEKIGQINDTPEELADLLNEYFNSKEK |
| Ga0212023_10547512 | 3300022061 | Aqueous | MKISVEYWDYTCGDGCCYDWGYDVFVDGEKIGQINDTPEELADLLNEYFNSKDFS |
| Ga0212021_11210392 | 3300022068 | Aqueous | ADGCCYTTGYDVFVDGEKIGSIGEDAQELAELLNEIFNTKEK |
| Ga0210311_10044975 | 3300022374 | Estuarine | MKISVEYWDYTCGDGCCYDWGYDVFVDGEKIGQINDTPEELADLLNEYFNTNEK |
| (restricted) Ga0233411_100154987 | 3300023112 | Seawater | MKISVEYWDYTCGDGCCYDWGYDVFVDGEKIGQINDTPEELADLLNEYFNSKEKWKQEK |
| Ga0228667_10145671 | 3300024226 | Seawater | MKISVEYWDYTCGDGCCYDWGYDVFVDGEKIGQINDTPEELADLLNE |
| (restricted) Ga0233438_102653011 | 3300024255 | Seawater | MEISVEYWDYTCGDGCCYDWGYDVFVDGEKIGQINDTPEELADLLNEYFNTKEKWKQ |
| (restricted) Ga0233444_103084234 | 3300024264 | Seawater | DWGYDVFVDGEKIGQINDTPEELADLLNEYFNSKEK |
| Ga0228629_11681532 | 3300024296 | Seawater | MKISVEYWDYTCGDGCCYDWGYDVFVDGEKIGQINDTPEELADLLNEYFNSKEKXKHQ |
| Ga0244777_1000758211 | 3300024343 | Estuarine | GCCYDWGYDVFVDGEKIGQINDTPEELADLLNEYFNSKEK |
| Ga0244777_101248821 | 3300024343 | Estuarine | WGYDVFVDGEKIGQINDTPEELADLLNEYFNTKEK |
| Ga0244777_103411251 | 3300024343 | Estuarine | REMKISVEYWDYTCGDGCCYDWGYDVFVDGEKIGQINDTPEDLADLLNEYFNSKEK |
| Ga0244775_100104821 | 3300024346 | Estuarine | CCYDWGYDVFVDGEKIGQINDTPEELADLLNEYFNSKEK |
| Ga0244775_100180761 | 3300024346 | Estuarine | GCCYDWGYDVFVDGEKIGQINDTPEELADLLNEYFNTKEK |
| Ga0244775_100341961 | 3300024346 | Estuarine | DGCCYDWGYDVFVDGEKIGQINDTPEELADLLNEYFNSKEKWDM |
| Ga0244775_100397691 | 3300024346 | Estuarine | DGCCYDWGYDVFVDGEKIGQINDTPEELADLLNEYFNTKEK |
| Ga0244775_101647666 | 3300024346 | Estuarine | WGYDVFVDGEKIGQINDTPEELADLLNEYFNSKEK |
| Ga0244775_110322561 | 3300024346 | Estuarine | YDWGYDVFVDGEKIGQINDTPEELADLLNEYFNSKEK |
| (restricted) Ga0255047_100451815 | 3300024520 | Seawater | MKISVEYWDYTCGDGCCYDWGYDVFVDGEKIGQINDTPEDLADLLNEYFNTKEK |
| Ga0208898_11282001 | 3300025671 | Aqueous | GDGCCYDWGYDVFVDGEKIGQINDTPEELADLLNEYFNSKEK |
| Ga0209653_10652891 | 3300025695 | Marine | YDWGYDVFVDGEKIGQINDTPEELADLLNEYFNSKER |
| Ga0208543_10647321 | 3300025810 | Aqueous | TTGYDVFVDGEKIGSIGEDAQELAELLNETFNTKEK |
| Ga0209555_100146491 | 3300025879 | Marine | KISVEYWDYTCGDGCCYDWGYDVFVDGEKIGQINDTPEDLADLLNEYFNSKEK |
| Ga0208644_10770898 | 3300025889 | Aqueous | GCCYTTGYDVYVDGEKIGFTTCEDATELVELLNEYFNTKEK |
| Ga0208922_100015433 | 3300027197 | Estuarine | DYTCGDGCCYDWGYDVFVDGEKIGQINDTPEELADLLNEYFNTKEK |
| Ga0208922_10091224 | 3300027197 | Estuarine | DVFVDGEKIGQINDTPEELADLLNEYFNSKEKWDM |
| Ga0208163_10005081 | 3300027198 | Estuarine | DYTCGDGCCYDWGYDVFVDGEKIGQINDTPEELADLLNEYFNSKEK |
| Ga0208167_10008271 | 3300027219 | Estuarine | DLGYDVFVDGEKIGQINDTPEELADLLNEYFNSKEK |
| Ga0208557_10350801 | 3300027221 | Estuarine | GCCYDWGYDVFVDGEKIGQINDTPEDLADLLNEYFNSKEK |
| Ga0208308_10222232 | 3300027228 | Estuarine | TCGDGCCYDWGYDVFVDGEKIGQINDTPEELADLLNEYFNSKEK |
| Ga0208442_10356631 | 3300027229 | Estuarine | EYWDYTCGDGCCYDWGYDVFVDGEKIGQINDTPEDLADLLNEYFNSKEK |
| Ga0208804_10000221 | 3300027235 | Estuarine | DWGYDVFVDGEKIGQINDTPEELADLLNEYFNTKEK |
| Ga0208808_10203134 | 3300027238 | Estuarine | WDYTCGDGCCYDWGYDVFVDGEKIGQINDTPEDLADLLNEYFNSKEK |
| Ga0208445_10042156 | 3300027245 | Estuarine | YTCGDGCCYDWGYDVFVDGEKIGQINDTPEELADLLNEYFNTKEK |
| Ga0208931_10433604 | 3300027246 | Estuarine | DYTCGDGCCYDWGYDVFVDGEKIGQINDTPEDLADLLNEYFNSKEK |
| Ga0208439_100070814 | 3300027278 | Estuarine | GCCYDWGYDVFVDGEKIGQINDTPEELADLLNEYFNSKEKWDM |
| Ga0207994_10314111 | 3300027416 | Estuarine | TCGDGCCYDWGYDVFVDGEKIGQINDTPEELADLLNEYFNTNEK |
| Ga0208304_100005121 | 3300027751 | Estuarine | DGCCYDWGYDVFVDGEKIGQINDTPEELADLLNEYFNSKEK |
| Ga0208304_100059571 | 3300027751 | Estuarine | CCYDWGYDVFVDGEKIGQINDTPEELADLLNEYFNTNEK |
| Ga0208305_100012041 | 3300027753 | Estuarine | WGYDVFVDGEKIGQINDTPEELADLLNEYFNSKEKWDM |
| Ga0208305_100013801 | 3300027753 | Estuarine | DYTCGDGCCYDWGYDVFVDGEKIGQINDTPEELADLLNEYFNTNEK |
| Ga0208305_100634304 | 3300027753 | Estuarine | DYTCGDGCCYDWGYDVFVDGEKIGQINDTPEELADLLNEYFNTKER |
| Ga0209820_11265214 | 3300027956 | Freshwater Sediment | CCDTYGYDVFLDGEKIGSIGEDAQELAELLNETFKTNEK |
| Ga0228614_10061062 | 3300028416 | Seawater | MKISVEYWDYTCGDGCCYDWGYDVFVDGEKIGQINDTPEELADLLNEYFKTKEK |
| Ga0135211_10526481 | 3300029293 | Marine Harbor | DGCCYTTGYDVFVDGEKVGSIGEDATELAELLNETFNTKEK |
| Ga0307377_106121853 | 3300031673 | Soil | GCCTTYGYDVFVDGEKIGFTTGEDATELADLLNEYFDFK |
| ⦗Top⦘ |