


| Basic Information | |
|---|---|
| Family ID | F105019 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 100 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MGKHHDKIAASLEIRKRNHKGPGGKVPGSMNKKKTGYNRVKANGAK |
| Number of Associated Samples | 67 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 72.97 % |
| % of genes near scaffold ends (potentially truncated) | 4.00 % |
| % of genes from short scaffolds (< 2000 bps) | 15.00 % |
| Associated GOLD sequencing projects | 65 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.34 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (81.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater (13.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (36.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (64.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.49% β-sheet: 0.00% Coil/Unstructured: 63.51% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF00085 | Thioredoxin | 8.00 |
| PF04820 | Trp_halogenase | 4.00 |
| PF02511 | Thy1 | 3.00 |
| PF01464 | SLT | 3.00 |
| PF02467 | Whib | 2.00 |
| PF00062 | Lys | 2.00 |
| PF01521 | Fe-S_biosyn | 1.00 |
| PF01755 | Glyco_transf_25 | 1.00 |
| PF04577 | Glyco_transf_61 | 1.00 |
| PF00860 | Xan_ur_permease | 1.00 |
| PF04973 | NMN_transporter | 1.00 |
| PF00166 | Cpn10 | 1.00 |
| PF00589 | Phage_integrase | 1.00 |
| PF00155 | Aminotran_1_2 | 1.00 |
| PF06067 | DUF932 | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG1351 | Thymidylate synthase ThyX, FAD-dependent family | Nucleotide transport and metabolism [F] | 3.00 |
| COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 1.00 |
| COG0316 | Fe-S cluster assembly iron-binding protein IscA | Posttranslational modification, protein turnover, chaperones [O] | 1.00 |
| COG3201 | Nicotinamide riboside transporter PnuC | Coenzyme transport and metabolism [H] | 1.00 |
| COG3306 | Glycosyltransferase involved in LPS biosynthesis, GR25 family | Cell wall/membrane/envelope biogenesis [M] | 1.00 |
| COG4841 | Uncharacterized conserved protein YneR, related to HesB/YadR/YfhF family | Function unknown [S] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 81.00 % |
| All Organisms | root | All Organisms | 19.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001836|RCM27_1004368 | Not Available | 888 | Open in IMG/M |
| 3300001849|RCM26_1256176 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 576 | Open in IMG/M |
| 3300001968|GOS2236_1054146 | Not Available | 1984 | Open in IMG/M |
| 3300005527|Ga0068876_10158196 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1329 | Open in IMG/M |
| 3300005758|Ga0078117_1009695 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3045 | Open in IMG/M |
| 3300005758|Ga0078117_1023691 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2833 | Open in IMG/M |
| 3300005805|Ga0079957_1004339 | Not Available | 11788 | Open in IMG/M |
| 3300005805|Ga0079957_1027603 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3815 | Open in IMG/M |
| 3300006802|Ga0070749_10020864 | Not Available | 4151 | Open in IMG/M |
| 3300007177|Ga0102978_1029791 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1983 | Open in IMG/M |
| 3300007177|Ga0102978_1058366 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1550 | Open in IMG/M |
| 3300007177|Ga0102978_1076936 | All Organisms → Viruses → Predicted Viral | 1446 | Open in IMG/M |
| 3300008107|Ga0114340_1004257 | Not Available | 7811 | Open in IMG/M |
| 3300008107|Ga0114340_1008225 | Not Available | 14053 | Open in IMG/M |
| 3300008107|Ga0114340_1010292 | Not Available | 4658 | Open in IMG/M |
| 3300008107|Ga0114340_1111417 | Not Available | 1075 | Open in IMG/M |
| 3300008107|Ga0114340_1113166 | Not Available | 1063 | Open in IMG/M |
| 3300008111|Ga0114344_1000371 | Not Available | 43404 | Open in IMG/M |
| 3300008116|Ga0114350_1017956 | All Organisms → Viruses → Predicted Viral | 2987 | Open in IMG/M |
| 3300009419|Ga0114982_1199519 | Not Available | 620 | Open in IMG/M |
| 3300010354|Ga0129333_10041494 | Not Available | 4328 | Open in IMG/M |
| 3300010354|Ga0129333_10090000 | All Organisms → Viruses → Predicted Viral | 2839 | Open in IMG/M |
| 3300010354|Ga0129333_10270154 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1528 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10066917 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2714 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10029015 | Not Available | 5402 | Open in IMG/M |
| 3300017788|Ga0169931_10042757 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5051 | Open in IMG/M |
| 3300020183|Ga0194115_10017836 | Not Available | 5758 | Open in IMG/M |
| 3300020204|Ga0194116_10147145 | Not Available | 1420 | Open in IMG/M |
| 3300021961|Ga0222714_10156652 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1360 | Open in IMG/M |
| 3300021962|Ga0222713_10039684 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3696 | Open in IMG/M |
| 3300021963|Ga0222712_10008683 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9555 | Open in IMG/M |
| 3300027710|Ga0209599_10023783 | All Organisms → Viruses → Predicted Viral | 1706 | Open in IMG/M |
| 3300027816|Ga0209990_10021491 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3627 | Open in IMG/M |
| 3300029930|Ga0119944_1000382 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7747 | Open in IMG/M |
| 3300031758|Ga0315907_10010502 | Not Available | 9209 | Open in IMG/M |
| 3300031857|Ga0315909_10659433 | Not Available | 687 | Open in IMG/M |
| 3300034073|Ga0310130_0001709 | Not Available | 11351 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 13.00% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 11.00% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 10.00% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 9.00% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 8.00% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 7.00% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 6.00% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 5.00% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 4.00% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 4.00% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 4.00% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 3.00% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.00% |
| River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 3.00% |
| Lake Water | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water | 2.00% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 2.00% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 2.00% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.00% |
| Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 1.00% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.00% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001836 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM27, ROCA_DNA191_0.2um_MCP-N_C_3a | Environmental | Open in IMG/M |
| 3300001842 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM30, ROCA_DNA203_0.2um_MCP-S_C_2b | Environmental | Open in IMG/M |
| 3300001849 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM26, ROCA_DNA190_2.0um_MCP-N_C_2b | Environmental | Open in IMG/M |
| 3300001851 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM31, ROCA_DNA206_0.2um_MCP-S_C_3b | Environmental | Open in IMG/M |
| 3300001968 | Marine microbial communities from Lake Gatun, Panama - GS020 | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003413 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD | Environmental | Open in IMG/M |
| 3300005418 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel3S_1000h metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005758 | Cyanobacteria communities in tropical freswater systems - freshwater lake in Singapore | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300007177 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface and Bottom layers) 16 sequencing projects | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007546 | Estuarine microbial communities from the Columbia River estuary - metaG 1547A-02 | Environmental | Open in IMG/M |
| 3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008962 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5 | Environmental | Open in IMG/M |
| 3300009218 | Microbial communities of water from Amazon river, Brazil - RCM1 | Environmental | Open in IMG/M |
| 3300009225 | Microbial communities of water from Amazon river, Brazil - RCM4 | Environmental | Open in IMG/M |
| 3300009385 | Microbial communities of water from Amazon river, Brazil - RCM5 | Environmental | Open in IMG/M |
| 3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
| 3300012968 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
| 3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
| 3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
| 3300020204 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015008 Mahale S9 surface | Environmental | Open in IMG/M |
| 3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020570 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021091 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015055 Kigoma Offshore 40m | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300024289 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h | Environmental | Open in IMG/M |
| 3300024298 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepC_8d | Environmental | Open in IMG/M |
| 3300024350 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8d | Environmental | Open in IMG/M |
| 3300024352 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_0h | Environmental | Open in IMG/M |
| 3300024507 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8d | Environmental | Open in IMG/M |
| 3300024552 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024557 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024570 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026473 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8d | Environmental | Open in IMG/M |
| 3300026566 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028286 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| RCM27_10043682 | 3300001836 | Marine Plankton | MGKHHDKIAAALEIRKTVAQRSKNGGKIPGSMNKKKTGYRGIKANNAR* |
| RCM30_10462276 | 3300001842 | Marine Plankton | MGKHHDKIAAALEIRKAVAQRSKNGGKIPGSMNKKKTGYRGIKANNAR* |
| RCM26_12561763 | 3300001849 | Marine Plankton | MGKHHEKIAKSLEIRKANHKGPGGKVPGSMNKKKTGYNRNKANGAK* |
| RCM31_101044311 | 3300001851 | Marine Plankton | AKALEMRIAVAQRSKNPGGKIPGSMNKKKTGYRGIKANNAR* |
| GOS2236_10339316 | 3300001968 | Marine | KHHEKIAASLEIRKRNHKGPGGKIPGSMNKKKTGYNRVKARAK* |
| GOS2236_10541466 | 3300001968 | Marine | MGKHHDKIAASLEIRKRNHKGPGGKVPGSMNRKKTGYNRVKANNAR* |
| B570J40625_1000569488 | 3300002835 | Freshwater | MGKHLDKIQASLEVRKANHKGPGGKVPGSMNKKKTGYSSIKSNEAKTRLGK* |
| JGI25922J50271_100050536 | 3300003413 | Freshwater Lake | MGKHLKKIEAALKIRQANHKGPGGKLPGSMNKKKTGYAKAK* |
| Ga0068881_15150181 | 3300005418 | Freshwater Lake | MGKHHDKIAASLEIRRRNHKGPGGKVPGSMNKKKTGYNRVKAKKS* |
| Ga0070374_100515805 | 3300005517 | Freshwater Lake | MGKHLKKIEAALKIRQANHKGPGGKLPGSMNKKKTGYAR |
| Ga0068876_101581963 | 3300005527 | Freshwater Lake | MGKHHDKIAKSLEIRQRNHKGPGGKVPGSMNKKKTGYNRVKANNAK* |
| Ga0068876_102112353 | 3300005527 | Freshwater Lake | MGKHHDKIAASLEIRKRNHKGPGGKVPGSMNKKKTGYNRVKANNAK* |
| Ga0068876_107858811 | 3300005527 | Freshwater Lake | MGKHHDKIAASLEIRRRNHKGPGGKVPGSMNKKKTGYNRVKARKS* |
| Ga0078894_102944482 | 3300005662 | Freshwater Lake | MGKHLDKIQASLEVRKANHKGPGGKVPGSMNKKKTGYSSIKSNEAKSRLGK* |
| Ga0078117_10096959 | 3300005758 | Lake Water | MGKHHDKIAASLEIRKRNHKGPGGKVPGSMNRKKTGYNRVKAKKS* |
| Ga0078117_10236917 | 3300005758 | Lake Water | MGKHHDKIAKSLEIRKNNHKGPGGKVAGSMNKKKTGYNRVKANNAK* |
| Ga0079957_100433913 | 3300005805 | Lake | MGKHHDKIEASLEIRKRNHKGPGGKVPGSMNKKKTGYNRVRANRSK* |
| Ga0079957_10276037 | 3300005805 | Lake | MGKHHDKIAASLEIRKKNHKGPGGKVPGSMNKKKTGYNRVKANGSK* |
| Ga0079957_10539904 | 3300005805 | Lake | MGKHHDKIAKSLEIRKANHKGPGGKVPGSMNKKKTGYNRQKANGAR* |
| Ga0079957_10832511 | 3300005805 | Lake | MGKHHDKIAGSLEIRKKNHKGPGGKVPGSMNKKKTGY |
| Ga0079957_11893322 | 3300005805 | Lake | MGKHHEKIAASLEIRKRNHKGPGGKVPGSMNKKKTGYNRVKANNAR* |
| Ga0075471_102784341 | 3300006641 | Aqueous | GKHHEKIAASLEIRRRNHKGPGGKVPGSMNKKKTGYNRVKANGAK* |
| Ga0070749_100208642 | 3300006802 | Aqueous | MGKHHDKIAKSLEIRKSNHKGPGGKVPGSMNKKKTGYNRQKANGAR* |
| Ga0070749_107509222 | 3300006802 | Aqueous | MGKHHEKIAASLEIRKRNYKGPGGKVPGSMNKKKTGYNRQKANGAR* |
| Ga0102978_10297915 | 3300007177 | Freshwater Lake | MGKHHDKIAASLEIRRKNHKGPGGKVPGSMNKKKTGYNRVKAKRS* |
| Ga0102978_10583667 | 3300007177 | Freshwater Lake | MAKHHDKIAASLEIRKRNHKGPGGKVPGSMNKKKTGYNRVKANGAK* |
| Ga0102978_10769368 | 3300007177 | Freshwater Lake | AASLEIRRRNHKGPGGKVPGSMNKKKTGYNRVKAKKS* |
| Ga0102978_11109372 | 3300007177 | Freshwater Lake | MGKHHDKIAKSLEIRKNNHKGPGGKVPGSMNKKKTGYNRIKANGAK* |
| Ga0099848_11694824 | 3300007541 | Aqueous | LEIRKANHKGPGGKVPGSMNKKKTGYNRQKANGAR* |
| Ga0102874_11142122 | 3300007546 | Estuarine | MGKHLKKIEAALKVRQANHKGPGGKLPGSMNKKKTGYAKAK* |
| Ga0099850_13546141 | 3300007960 | Aqueous | IAKSLEIRKSNHKGPGGKVPGSMNKKKTGYNRQKANGAR* |
| Ga0114340_100425710 | 3300008107 | Freshwater, Plankton | MGKHHEKIAKALEIRRSNWKNPAGKAPGSMNKKKTGYNRVKANGAK* |
| Ga0114340_100822516 | 3300008107 | Freshwater, Plankton | MAKHHDKIAKSLEIRRANWKNPAGKAPGSMNKKKTGYNRQKANGAK* |
| Ga0114340_10102926 | 3300008107 | Freshwater, Plankton | MAKHHDKIAKALEIRRSNWKNPAGKAPGSMNKKKTGYNRVRANGSK* |
| Ga0114340_11114173 | 3300008107 | Freshwater, Plankton | MAKHHDKIAKSLEIRRSNWKNPAGKAPGSMNKKKTGYNRVKANNAK* |
| Ga0114340_11131661 | 3300008107 | Freshwater, Plankton | MAKHHEKIAKSLEIRRANWKNPAGKAPGSMNKKKTGYNRQKANGAK* |
| Ga0114343_12073462 | 3300008110 | Freshwater, Plankton | IAKALEIRKANHKGPGGKIPGSMNKKKTGYRGVKSNNAK* |
| Ga0114344_100037152 | 3300008111 | Freshwater, Plankton | MAKHLDKIAKSLEIRRSNWKNPAGKAPGSMNKKKTGYSRVKANGSK* |
| Ga0114344_12538581 | 3300008111 | Freshwater, Plankton | HLDKIQASLEVRKANHKGPGGKVPGSMNKKKTGYSSIKSNEAKTRLGK* |
| Ga0114346_10521193 | 3300008113 | Freshwater, Plankton | MGKHLNKIQASLEVRKANHKGPGGKVPGSMNKKKTGYSSIKSNEAKTRLGK* |
| Ga0114350_10179564 | 3300008116 | Freshwater, Plankton | MGKHHDKIAKSLEIRKSHHKGPGGKVPGSMNKKKTGYNRVKANGSK* |
| Ga0114350_10553824 | 3300008116 | Freshwater, Plankton | MGKHHDKIAKSLEIRRSNHKGPGGKVPGSMNKKKTGYNRVKANGSK* |
| Ga0104242_10859961 | 3300008962 | Freshwater | MGKHLDKIQASLEIRRANHKDKGGKVPGSMNKKKTGYSSIKANEAKKRLGK* |
| Ga0103848_10365231 | 3300009218 | River Water | MGKHHDKILKSLEIRKAAHKVPGGKAPGSMNKKKTGYYGVKANGAK* |
| Ga0103851_10049381 | 3300009225 | River Water | MEGNMGKHHDKILKSLEIRKAAHKVPGGKAPGSMNKKKTGYYGVKANGAK* |
| Ga0103852_10027342 | 3300009385 | River Water | MGKHYDKILKSLEIRKAAHKVPGGKAPGSMNKKKTGYYGVKANGAK* |
| Ga0114982_11995193 | 3300009419 | Deep Subsurface | AKALEIRKANHKGPGGKVPGSMNKKKTGYRGVKSNTAK* |
| Ga0129333_100414942 | 3300010354 | Freshwater To Marine Saline Gradient | MGKHHEKIAKSLEIRKANHKGPGGKVPGSMNKKKTGYNRQKANGAK* |
| Ga0129333_100900004 | 3300010354 | Freshwater To Marine Saline Gradient | MGKHHDKIAASLEIRKRNHKGPGGKVPGSMNRKKTGYNRVKANGAK* |
| Ga0129333_102438233 | 3300010354 | Freshwater To Marine Saline Gradient | MGKHHDKIAASLQISKKKHKVPGVKVPGSMNRKKT |
| Ga0129333_102701544 | 3300010354 | Freshwater To Marine Saline Gradient | MGKHHDKIAKSLEIRKANHKGPGGKVPGSMNKKKTGYNRNKANGAK* |
| Ga0129333_110066622 | 3300010354 | Freshwater To Marine Saline Gradient | MGKHHDKIAASLEIRKKNHKGPGGKVPGSMNRKKTGYSGIKANQAKKS* |
| Ga0129333_112236293 | 3300010354 | Freshwater To Marine Saline Gradient | MAKHHDKIAASLEIRKRNHKGPGGKVPGSMNKKKTGYNRVKANNAK* |
| Ga0129333_117618072 | 3300010354 | Freshwater To Marine Saline Gradient | MGKHHEKIAASLEIRKRNHKGPGGKVPGSMNKKKTGYNRVKANGAK* |
| Ga0151620_10162882 | 3300011268 | Freshwater | MGKHLKKIEAALKIRQANHKGPGGKLPGSMNKKKTGYAKVK* |
| Ga0129337_12746243 | 3300012968 | Aqueous | MGKHHDKIAASLEIRKRNHKGPGGKVPGSMNKKKTGYNRNKANGAK* |
| Ga0164293_103889591 | 3300013004 | Freshwater | MGKHLDKIQASLEVRKANHKGPGGKVPGSMNKKKTGYSSIKSNEAKTRL |
| (restricted) Ga0172367_100669175 | 3300013126 | Freshwater | MGKHHDKIAKSLEIRQRNWKNPAGKAPGSMNKKKTGYNRVKANGSK* |
| (restricted) Ga0172367_105039233 | 3300013126 | Freshwater | MAKHHDKIAASLEIRRKNHKGPGGKVPGSMNKKKTGYNRVKARKS* |
| (restricted) Ga0172373_1002901512 | 3300013131 | Freshwater | MGKHHDKIAGSLEIRKKNHKGPGGKVPGSMNKKKTGYNRIKANKAR* |
| Ga0177922_103964325 | 3300013372 | Freshwater | MGKHHDKIEASLEIRKRNHKGPGGKVPGSMNKKKTGYNRVKAKKS* |
| (restricted) Ga0172376_1001497815 | 3300014720 | Freshwater | MAKHHDKIAASLEIRKKNHKGPGGKVPGSMNKKKTGYNRVKANGAK* |
| (restricted) Ga0172376_103839772 | 3300014720 | Freshwater | MGKHHDKIAASLEIRRKNHKGPGGKVPGSMNKKKTGYNRVKARKS* |
| Ga0169931_100427573 | 3300017788 | Freshwater | MGKHHDKIAKSLEIRQRNWKNPAGKAPGSMNKKKTGYNRVKANGSK |
| Ga0169931_105414792 | 3300017788 | Freshwater | MAKHHDKIAASLEIRRKNHKGPGGKVPGSMNKKKTGYNRVKARKS |
| Ga0194113_104902632 | 3300020074 | Freshwater Lake | MGKHHDKILASLELRKKHHKGPGGKVPGSMNKKKTGYSGIRANQARNK |
| Ga0194113_106718334 | 3300020074 | Freshwater Lake | MGKHHDKIAASLEIRRKNHKGPGGKVPGSMNKKKTGYNRVKARKS |
| Ga0211733_106404032 | 3300020160 | Freshwater | MGKHHDKIAAALEVRKANHKSGQGGKVPGSMNKKKTGY |
| Ga0194115_100178364 | 3300020183 | Freshwater Lake | VGKHHDKIAASLEIRRKNHKGPGGKVPGSMNKKKTGYNRVKARKS |
| Ga0194116_101471453 | 3300020204 | Freshwater Lake | MGKHHDKIAGSLEIRKKNHKGPGGKVPGSMNKKKTGYNRIKANRAR |
| Ga0208050_10078282 | 3300020498 | Freshwater | MGKHLDKIQASLEVRKANHKGPGGKVPGSMNKKKTGYSSIKSNEAKTRLGK |
| Ga0208465_10336932 | 3300020570 | Freshwater | MGKHHDKIAKSLEIRKSHHKGPGGKVPGSMNKKKTGYNRVKANGSK |
| Ga0194133_104520754 | 3300021091 | Freshwater Lake | VGKHHDKIAGSLEIRKKNHKGPGGKVPGSMNKKKTGYNRIKANRAR |
| Ga0222714_101566523 | 3300021961 | Estuarine Water | MGKHHDKIAASLEIRRRNHKGPGGKVPGSMNKKKTGYNRVKARKS |
| Ga0222713_100396845 | 3300021962 | Estuarine Water | MAKHHDKIAKSLEIRRSNWKNPAGKAPGSMNKKKTGYNRVKANNAK |
| Ga0222712_1000868320 | 3300021963 | Estuarine Water | MGKHLKKIEAALKIRQANHKGPGGKLPGSMNKKKTGYAKVK |
| Ga0222712_101163291 | 3300021963 | Estuarine Water | MGKHLKKIEAALKIRQANHKGPGGKLPGSMNKKKTGYAKAK |
| Ga0255147_10158863 | 3300024289 | Freshwater | MGKHHEKIAKSLAIRQANHKGPGGKVPGSMNKKKTGYNRNKANGAK |
| Ga0255178_10999061 | 3300024298 | Freshwater | MGKHHEKIAASLEIRRRNHKGPGGKVPGSMNRKKTGYNRVKANGAK |
| Ga0255167_10317003 | 3300024350 | Freshwater | MGKHHDKIAASLEIRKRNHKGPGGKVPGSMNKKKTGYNRVKAKRS |
| Ga0255142_10288652 | 3300024352 | Freshwater | MGKHHDKIAASLEIRRRNHKGPGGKVPGSMNKKKTGYNRVKAKRS |
| Ga0255176_10157047 | 3300024507 | Freshwater | MGKHHEKIAASLEIRRRNHKGPGGKVPGSMNKKKTGYNRVKANGAK |
| Ga0256345_10448971 | 3300024552 | Freshwater | SLEIRKRNHKGPGGKVPGSMNKKKTGYNRVKANGAK |
| Ga0255283_10074251 | 3300024557 | Freshwater | MGKHHDKIAASLEIRRRNHKGPGGKAPGSMNKKKT |
| Ga0255276_11832461 | 3300024570 | Freshwater | MGKHHDKIAASLEIRRRNHKGPGGKAPGSMNKKKTG |
| Ga0255166_100088326 | 3300026473 | Freshwater | KIAASLEIRRRNHKGPGGKAPGSMNKKKTGYNRVKAKRS |
| Ga0256334_10084356 | 3300026566 | Freshwater | MGKHHEKIAASLEIRKRNHKGPGGKVPGSMNKKKTGYNRVKANGAR |
| Ga0209599_100237838 | 3300027710 | Deep Subsurface | AKALEIRKANHKGPGGKVPGSMNKKKTGYRGVKSNTAK |
| Ga0209972_102374143 | 3300027793 | Freshwater Lake | MGKHHDKIAKSLEIRRSNHKGPGGKVPGSMNKKKTGYNRVKANGSK |
| Ga0209990_100214915 | 3300027816 | Freshwater Lake | MGKHHDKIAASLEIRRRNHKGPGGKVPGSMNKKKTGYNRVKAKKS |
| Ga0209990_100597204 | 3300027816 | Freshwater Lake | MGKHHDKIAASLEIRKRNHKGPGGKVPGSMNKKKTGYNRVKANGAK |
| Ga0256331_10573653 | 3300028286 | Freshwater | MGKHHEKIAKSLAIRQANHKGPGGKVPGSMNKKKTGYNRVKAKRS |
| Ga0256331_11018262 | 3300028286 | Freshwater | MGKHHEKIAASLEIRKRNHKGPGGKVPGSMNKKKTGYNRVKANGAK |
| Ga0256331_11522183 | 3300028286 | Freshwater | MGKHHEKIAASLEIRRRNNKRPGRKVPGSMNRKKTGYNRVKANNAR |
| Ga0119944_100038222 | 3300029930 | Aquatic | MGKHHDKIAKSLEIRQRNWKNPAGKAPGSMNRKKTGYNRVKANGAK |
| Ga0315907_100105028 | 3300031758 | Freshwater | MAKHHDKIAKSLEIRRANWKNPAGKAPGSMNKKKTGYNRQKANGAK |
| Ga0315907_102729623 | 3300031758 | Freshwater | MGKHHDKIAASLEIRKRNHKGPGGKVPGSMNKKKTGYNRVKANNAK |
| Ga0315909_106594331 | 3300031857 | Freshwater | MAKHHDKIAKALEIRRSNWKNPAGKAPGSMNKKKTGYNRVRANGSK |
| Ga0315904_101504322 | 3300031951 | Freshwater | MGKHHDKIAKSLEIRQRNHKGPGGKVPGSMNKKKTGYNRVKANNAK |
| Ga0310130_0001709_6967_7104 | 3300034073 | Fracking Water | MGKHHEKIAASLEIRRRNHKGPGGKVPGSMNKKKTGYNRVKARKS |
| ⦗Top⦘ |