


| Basic Information | |
|---|---|
| Family ID | F104972 |
| Family Type | Metagenome |
| Number of Sequences | 100 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MKVSECCGARLLKYDRNWDDGICSECKEHSPAHKEKELTE |
| Number of Associated Samples | 47 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 59.00 % |
| % of genes near scaffold ends (potentially truncated) | 17.00 % |
| % of genes from short scaffolds (< 2000 bps) | 91.00 % |
| Associated GOLD sequencing projects | 39 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (50.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (70.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (97.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (98.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 5.88% β-sheet: 27.94% Coil/Unstructured: 66.18% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF05866 | RusA | 8.00 |
| PF00145 | DNA_methylase | 2.00 |
| PF13455 | MUG113 | 2.00 |
| PF04026 | SpoVG | 2.00 |
| PF03118 | RNA_pol_A_CTD | 1.00 |
| PF08401 | ArdcN | 1.00 |
| PF10544 | T5orf172 | 1.00 |
| PF01381 | HTH_3 | 1.00 |
| PF01507 | PAPS_reduct | 1.00 |
| PF03237 | Terminase_6N | 1.00 |
| PF14297 | DUF4373 | 1.00 |
| PF00085 | Thioredoxin | 1.00 |
| PF02195 | ParBc | 1.00 |
| PF06147 | DUF968 | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG4570 | Holliday junction resolvase RusA (prophage-encoded endonuclease) | Replication, recombination and repair [L] | 8.00 |
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 2.00 |
| COG2088 | DNA- and RNA-binding protein SpoVG, cell septation regulator | Transcription [K] | 2.00 |
| COG0202 | DNA-directed RNA polymerase, alpha subunit/40 kD subunit | Transcription [K] | 1.00 |
| COG4227 | Antirestriction protein ArdC | Replication, recombination and repair [L] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 54.00 % |
| Unclassified | root | N/A | 46.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002514|JGI25133J35611_10108461 | Not Available | 808 | Open in IMG/M |
| 3300006736|Ga0098033_1207589 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300006738|Ga0098035_1160612 | Not Available | 761 | Open in IMG/M |
| 3300006738|Ga0098035_1195637 | All Organisms → cellular organisms → Bacteria → FCB group | 676 | Open in IMG/M |
| 3300006738|Ga0098035_1205130 | Not Available | 657 | Open in IMG/M |
| 3300006738|Ga0098035_1284037 | Not Available | 541 | Open in IMG/M |
| 3300006738|Ga0098035_1292115 | Not Available | 532 | Open in IMG/M |
| 3300006750|Ga0098058_1026536 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Flammeovirgaceae → unclassified Flammeovirgaceae → Flammeovirgaceae bacterium | 1685 | Open in IMG/M |
| 3300006750|Ga0098058_1027057 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 1668 | Open in IMG/M |
| 3300006750|Ga0098058_1055386 | Not Available | 1112 | Open in IMG/M |
| 3300006750|Ga0098058_1062355 | Not Available | 1038 | Open in IMG/M |
| 3300006750|Ga0098058_1109763 | Not Available | 742 | Open in IMG/M |
| 3300006750|Ga0098058_1132444 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group → Candidatus Woesebacteria → Candidatus Woesebacteria bacterium | 664 | Open in IMG/M |
| 3300006751|Ga0098040_1073083 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group → Candidatus Woesebacteria → Candidatus Woesebacteria bacterium | 1048 | Open in IMG/M |
| 3300006751|Ga0098040_1142368 | Not Available | 711 | Open in IMG/M |
| 3300006751|Ga0098040_1218542 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group → Candidatus Woesebacteria → Candidatus Woesebacteria bacterium | 555 | Open in IMG/M |
| 3300006752|Ga0098048_1127897 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group → Candidatus Woesebacteria → Candidatus Woesebacteria bacterium | 762 | Open in IMG/M |
| 3300006753|Ga0098039_1026632 | All Organisms → Viruses → Predicted Viral | 2062 | Open in IMG/M |
| 3300006753|Ga0098039_1026647 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group → Candidatus Woesebacteria → Candidatus Woesebacteria bacterium | 2062 | Open in IMG/M |
| 3300006753|Ga0098039_1143476 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group → Candidatus Woesebacteria → Candidatus Woesebacteria bacterium | 817 | Open in IMG/M |
| 3300006753|Ga0098039_1187385 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group → Candidatus Woesebacteria → Candidatus Woesebacteria bacterium | 703 | Open in IMG/M |
| 3300006753|Ga0098039_1289025 | Not Available | 548 | Open in IMG/M |
| 3300006753|Ga0098039_1321100 | Not Available | 516 | Open in IMG/M |
| 3300006754|Ga0098044_1022851 | Not Available | 2795 | Open in IMG/M |
| 3300006754|Ga0098044_1130629 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
| 3300006754|Ga0098044_1201355 | Not Available | 783 | Open in IMG/M |
| 3300006754|Ga0098044_1218683 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group → Candidatus Woesebacteria → Candidatus Woesebacteria bacterium | 745 | Open in IMG/M |
| 3300006754|Ga0098044_1228192 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group → Candidatus Woesebacteria → Candidatus Woesebacteria bacterium | 726 | Open in IMG/M |
| 3300006754|Ga0098044_1253570 | Not Available | 681 | Open in IMG/M |
| 3300006754|Ga0098044_1367150 | Not Available | 544 | Open in IMG/M |
| 3300006754|Ga0098044_1394405 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group → Candidatus Woesebacteria → Candidatus Woesebacteria bacterium | 521 | Open in IMG/M |
| 3300006789|Ga0098054_1207617 | Not Available | 713 | Open in IMG/M |
| 3300006789|Ga0098054_1236640 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group → Candidatus Woesebacteria → Candidatus Woesebacteria bacterium | 661 | Open in IMG/M |
| 3300006793|Ga0098055_1384541 | Not Available | 520 | Open in IMG/M |
| 3300006927|Ga0098034_1013564 | All Organisms → Viruses → Predicted Viral | 2553 | Open in IMG/M |
| 3300006927|Ga0098034_1020120 | All Organisms → Viruses → Predicted Viral | 2054 | Open in IMG/M |
| 3300006927|Ga0098034_1062930 | All Organisms → Viruses → Predicted Viral | 1083 | Open in IMG/M |
| 3300006927|Ga0098034_1100767 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group → Candidatus Woesebacteria → Candidatus Woesebacteria bacterium | 827 | Open in IMG/M |
| 3300007504|Ga0104999_1014850 | All Organisms → cellular organisms → Bacteria | 5084 | Open in IMG/M |
| 3300007963|Ga0110931_1262884 | Not Available | 512 | Open in IMG/M |
| 3300008050|Ga0098052_1047301 | Not Available | 1871 | Open in IMG/M |
| 3300008050|Ga0098052_1051373 | All Organisms → cellular organisms → Bacteria | 1777 | Open in IMG/M |
| 3300008050|Ga0098052_1056425 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Flammeovirgaceae → unclassified Flammeovirgaceae → Flammeovirgaceae bacterium | 1676 | Open in IMG/M |
| 3300008050|Ga0098052_1194653 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group → Candidatus Woesebacteria → Candidatus Woesebacteria bacterium | 789 | Open in IMG/M |
| 3300008216|Ga0114898_1113999 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Flammeovirgaceae → unclassified Flammeovirgaceae → Flammeovirgaceae bacterium | 799 | Open in IMG/M |
| 3300008217|Ga0114899_1162929 | Not Available | 720 | Open in IMG/M |
| 3300008217|Ga0114899_1239247 | Not Available | 563 | Open in IMG/M |
| 3300008218|Ga0114904_1154017 | Not Available | 539 | Open in IMG/M |
| 3300008218|Ga0114904_1162590 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group → Candidatus Woesebacteria → Candidatus Woesebacteria bacterium | 520 | Open in IMG/M |
| 3300008219|Ga0114905_1086486 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Flammeovirgaceae → unclassified Flammeovirgaceae → Flammeovirgaceae bacterium | 1101 | Open in IMG/M |
| 3300008219|Ga0114905_1110695 | Not Available | 943 | Open in IMG/M |
| 3300008219|Ga0114905_1154281 | Not Available | 763 | Open in IMG/M |
| 3300008219|Ga0114905_1155013 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300008219|Ga0114905_1237657 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 577 | Open in IMG/M |
| 3300008220|Ga0114910_1074724 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group → Candidatus Woesebacteria → Candidatus Woesebacteria bacterium | 1042 | Open in IMG/M |
| 3300009008|Ga0115649_1063668 | Not Available | 4489 | Open in IMG/M |
| 3300009173|Ga0114996_10812902 | Not Available | 676 | Open in IMG/M |
| 3300009173|Ga0114996_11164917 | Not Available | 541 | Open in IMG/M |
| 3300009413|Ga0114902_1126616 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group → Candidatus Woesebacteria → Candidatus Woesebacteria bacterium | 664 | Open in IMG/M |
| 3300009413|Ga0114902_1143655 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group → Candidatus Woesebacteria → Candidatus Woesebacteria bacterium | 609 | Open in IMG/M |
| 3300009418|Ga0114908_1118208 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group → Candidatus Woesebacteria → Candidatus Woesebacteria bacterium | 873 | Open in IMG/M |
| 3300009418|Ga0114908_1262332 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group → Candidatus Woesebacteria → Candidatus Woesebacteria bacterium | 520 | Open in IMG/M |
| 3300009603|Ga0114911_1064525 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group → Candidatus Woesebacteria → Candidatus Woesebacteria bacterium | 1112 | Open in IMG/M |
| 3300009603|Ga0114911_1107150 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group → Candidatus Woesebacteria → Candidatus Woesebacteria bacterium | 811 | Open in IMG/M |
| 3300009603|Ga0114911_1226235 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group → Candidatus Woesebacteria → Candidatus Woesebacteria bacterium | 500 | Open in IMG/M |
| 3300009604|Ga0114901_1123450 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group → Candidatus Woesebacteria → Candidatus Woesebacteria bacterium | 796 | Open in IMG/M |
| 3300009605|Ga0114906_1080430 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group → Candidatus Woesebacteria → Candidatus Woesebacteria bacterium | 1194 | Open in IMG/M |
| 3300009605|Ga0114906_1231857 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 608 | Open in IMG/M |
| 3300010151|Ga0098061_1034642 | Not Available | 2014 | Open in IMG/M |
| 3300010151|Ga0098061_1059015 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Flammeovirgaceae → unclassified Flammeovirgaceae → Flammeovirgaceae bacterium | 1481 | Open in IMG/M |
| 3300010151|Ga0098061_1063936 | Not Available | 1412 | Open in IMG/M |
| 3300010151|Ga0098061_1173602 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group → Candidatus Woesebacteria → Candidatus Woesebacteria bacterium | 773 | Open in IMG/M |
| 3300010151|Ga0098061_1214385 | Not Available | 679 | Open in IMG/M |
| 3300010151|Ga0098061_1288504 | Not Available | 566 | Open in IMG/M |
| 3300010153|Ga0098059_1315147 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group → Candidatus Woesebacteria → Candidatus Woesebacteria bacterium | 597 | Open in IMG/M |
| 3300010155|Ga0098047_10234746 | Not Available | 698 | Open in IMG/M |
| 3300010155|Ga0098047_10294393 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group → Candidatus Woesebacteria → Candidatus Woesebacteria bacterium | 613 | Open in IMG/M |
| 3300010155|Ga0098047_10353835 | Not Available | 552 | Open in IMG/M |
| 3300010155|Ga0098047_10400945 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group → Candidatus Woesebacteria → Candidatus Woesebacteria bacterium | 513 | Open in IMG/M |
| 3300010883|Ga0133547_10852042 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group → Candidatus Woesebacteria → Candidatus Woesebacteria bacterium | 1782 | Open in IMG/M |
| 3300010883|Ga0133547_11559514 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group → Candidatus Woesebacteria → Candidatus Woesebacteria bacterium | 1236 | Open in IMG/M |
| 3300017702|Ga0181374_1034772 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group → Candidatus Woesebacteria → Candidatus Woesebacteria bacterium | 877 | Open in IMG/M |
| 3300017775|Ga0181432_1165161 | Not Available | 685 | Open in IMG/M |
| 3300017775|Ga0181432_1269247 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 539 | Open in IMG/M |
| (restricted) 3300024520|Ga0255047_10649969 | Not Available | 527 | Open in IMG/M |
| 3300025072|Ga0208920_1063709 | Not Available | 718 | Open in IMG/M |
| 3300025096|Ga0208011_1048589 | Not Available | 989 | Open in IMG/M |
| 3300025097|Ga0208010_1062021 | Not Available | 812 | Open in IMG/M |
| 3300025108|Ga0208793_1193618 | Not Available | 513 | Open in IMG/M |
| 3300025109|Ga0208553_1085828 | Not Available | 741 | Open in IMG/M |
| 3300025114|Ga0208433_1136721 | Not Available | 585 | Open in IMG/M |
| 3300025122|Ga0209434_1154676 | Not Available | 621 | Open in IMG/M |
| 3300025131|Ga0209128_1001871 | Not Available | 13981 | Open in IMG/M |
| 3300025133|Ga0208299_1046754 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Flammeovirgaceae → unclassified Flammeovirgaceae → Flammeovirgaceae bacterium | 1676 | Open in IMG/M |
| 3300025133|Ga0208299_1205535 | Not Available | 581 | Open in IMG/M |
| 3300025270|Ga0208813_1080450 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group → Candidatus Woesebacteria → Candidatus Woesebacteria bacterium | 672 | Open in IMG/M |
| 3300025274|Ga0208183_1057104 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group → Candidatus Woesebacteria → Candidatus Woesebacteria bacterium | 770 | Open in IMG/M |
| 3300026115|Ga0208560_1005062 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Microgenomates group → Candidatus Woesebacteria → Candidatus Woesebacteria bacterium | 1080 | Open in IMG/M |
| 3300027847|Ga0209402_10381618 | Not Available | 854 | Open in IMG/M |
| 3300032011|Ga0315316_11311448 | Not Available | 577 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 70.00% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 23.00% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 2.00% |
| Marine Oceanic | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Oceanic | 1.00% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.00% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.00% |
| Water Column | Environmental → Aquatic → Marine → Coastal → Unclassified → Water Column | 1.00% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002514 | Marine viral communities from the Pacific Ocean - ETNP_6_85 | Environmental | Open in IMG/M |
| 3300006736 | Marine viral communities from the Subarctic Pacific Ocean - 1_ETSP_OMZ_AT15124 metaG | Environmental | Open in IMG/M |
| 3300006738 | Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG | Environmental | Open in IMG/M |
| 3300006750 | Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG | Environmental | Open in IMG/M |
| 3300006751 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006753 | Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG | Environmental | Open in IMG/M |
| 3300006754 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006927 | Marine viral communities from the Subarctic Pacific Ocean - 2_ETSP_OMZ_AT15125 metaG | Environmental | Open in IMG/M |
| 3300007504 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 267m, 2.7-0.2um, replicate a | Environmental | Open in IMG/M |
| 3300007963 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2) | Environmental | Open in IMG/M |
| 3300008050 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG | Environmental | Open in IMG/M |
| 3300008216 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_Geostar | Environmental | Open in IMG/M |
| 3300008217 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_215 | Environmental | Open in IMG/M |
| 3300008218 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s6 | Environmental | Open in IMG/M |
| 3300008219 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_b05 | Environmental | Open in IMG/M |
| 3300008220 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908 | Environmental | Open in IMG/M |
| 3300009008 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 267m, 250-2.7um | Environmental | Open in IMG/M |
| 3300009173 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 | Environmental | Open in IMG/M |
| 3300009413 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s12 | Environmental | Open in IMG/M |
| 3300009418 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s17 | Environmental | Open in IMG/M |
| 3300009603 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_904 | Environmental | Open in IMG/M |
| 3300009604 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s16 | Environmental | Open in IMG/M |
| 3300009605 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9 | Environmental | Open in IMG/M |
| 3300010151 | Marine viral communities from the Subarctic Pacific Ocean - 22_ETSP_OMZ_AT15343 metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300010155 | Marine viral communities from the Subarctic Pacific Ocean - 12_ETSP_OMZ_AT15267 metaG | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300017702 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_10 viral metaG | Environmental | Open in IMG/M |
| 3300017775 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 55 SPOT_SRF_2014-07-17 | Environmental | Open in IMG/M |
| 3300024520 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_1 | Environmental | Open in IMG/M |
| 3300025072 | Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025096 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025097 | Marine viral communities from the Subarctic Pacific Ocean - 2_ETSP_OMZ_AT15125 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025109 | Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025114 | Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025122 | Marine viral communities from the Pacific Ocean - ETNP_2_300 (SPAdes) | Environmental | Open in IMG/M |
| 3300025131 | Marine viral communities from the Pacific Ocean - ETNP_6_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025133 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025270 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_904 (SPAdes) | Environmental | Open in IMG/M |
| 3300025274 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_51 (SPAdes) | Environmental | Open in IMG/M |
| 3300026115 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3827_250 (SPAdes) | Environmental | Open in IMG/M |
| 3300027847 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300032011 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25133J35611_101084611 | 3300002514 | Marine | MKISECCGAKLTNYDKNWDDGICIECKEHSPAINEEVKELRMEIQK* |
| Ga0098033_12075891 | 3300006736 | Marine | IMVKVSECCGARLLKYDKNWDDGICSKCKEHSPAQKEKELINE* |
| Ga0098035_11606121 | 3300006738 | Marine | MKVSECCGERLMKYDKNWDDGVCSKCNEHSPAQTEEEPVDA* |
| Ga0098035_11956373 | 3300006738 | Marine | MESECCGARLLKYDRNWDDGICSECKEHSPAHKEKELTE* |
| Ga0098035_12051303 | 3300006738 | Marine | MKVSECCNARLLKYDRNWDDGICSECKEHTPAQKEEKGELINEG* |
| Ga0098035_12840372 | 3300006738 | Marine | KVSECCGAKLTNYDKNWDDGICIECKEHSPAQTEEKV* |
| Ga0098035_12921153 | 3300006738 | Marine | MKTSECCNARLMKYDRNWDDGICSECNEHSPAHKEKELIDEG* |
| Ga0098058_10265362 | 3300006750 | Marine | MVKVSECCGAKLMKYDKNWDDGICSECKEHSPAHKEKELTE* |
| Ga0098058_10270573 | 3300006750 | Marine | MKVSECCNARLLKYDSNWDDGICFECKEHSPAQKEEGELINE* |
| Ga0098058_10553864 | 3300006750 | Marine | MKLSECCNARLLRYDRTWDDGICSECKEHTPAQKEEGELINEGK* |
| Ga0098058_10623552 | 3300006750 | Marine | MKVSECCNARLLKYDRTWDDGICSKCKEHTPAQKEEKGELIE* |
| Ga0098058_11097633 | 3300006750 | Marine | MKVSECCGAKLTNYDKNWDDGICIECKEHSPAQTEEKV* |
| Ga0098058_11324441 | 3300006750 | Marine | MVKVSECCGARLLRYDKNWDDGICSECKEHSPAHKEKE |
| Ga0098040_10730834 | 3300006751 | Marine | MKVSECCGARLMKYDRNWDDGVCSECNEHSPAHKEEELTE* |
| Ga0098040_11423681 | 3300006751 | Marine | MKVSECCGERLMKYDKNWDDGVCSKCNEHSPAQTEEEPVDV* |
| Ga0098040_12185422 | 3300006751 | Marine | MVKVSECCGARLMKYDKNWDDGVCSECKEHSPAQKEKELTE* |
| Ga0098048_11278972 | 3300006752 | Marine | MVKVSECCGARLLKYDRNWDDGICSECKEHSPAHKEKELTE* |
| Ga0098039_10266324 | 3300006753 | Marine | MKVSECCGAKLTNYDKNWDDGICIECKEHSPAQIEEEV* |
| Ga0098039_10266473 | 3300006753 | Marine | MVKVSECCNARLLKYDRTWDDGICSECKEHTPSQKEEKGELTE* |
| Ga0098039_11434764 | 3300006753 | Marine | MKTSECCGARLLKYDKNWDDGICSECKEHSPAQKEEGELVE* |
| Ga0098039_11873854 | 3300006753 | Marine | MKLSDCCGARLLRYDRNWDDGICSECKEHSPAQEEE |
| Ga0098039_12890252 | 3300006753 | Marine | MKLSECCGERLTRYDKNWDDGVCSKCNEHSPAQKEGEPVDA* |
| Ga0098039_13211002 | 3300006753 | Marine | MKVSECCGARLWKYDRNWDDGICSKCNEHSPAHKEKELINERQ* |
| Ga0098044_10228516 | 3300006754 | Marine | MKVSECCNARLLRYDRTWDDGICSECKEHTPAQKEEGELINEGK* |
| Ga0098044_11306291 | 3300006754 | Marine | LKIRSNMKVSECCGAKLTNYDKNWDDGICIECKEHSPAQTEEEVC* |
| Ga0098044_12013554 | 3300006754 | Marine | CCNARLMKYDRNWDDGICSECNEHSPAQKEKELTE* |
| Ga0098044_12186831 | 3300006754 | Marine | MVKVSECCGARLMKYDRNWDDGICSECNEHSPAHKEKELINEG* |
| Ga0098044_12281923 | 3300006754 | Marine | MVKVSECCGARLLKYDRNWDDGVCSECNEHSPAHKEEELTE* |
| Ga0098044_12535702 | 3300006754 | Marine | MKVSECCNARLLKYDSNWDDGICFECKEHSPAQKEEGELVE* |
| Ga0098044_13671502 | 3300006754 | Marine | MKLSECCGERLTCYDKNWDDGVCSKCNEHSPAQTEEEPVDV* |
| Ga0098044_13944051 | 3300006754 | Marine | MKLSDCCGARLLRYDRNWDDGICSECKEHSPAHKEKELTE* |
| Ga0098054_12076173 | 3300006789 | Marine | AVKLRITMKLSECCGERLTRYDKNWDDGVCSKCNEHSPAQTEEEPVDV* |
| Ga0098054_12366403 | 3300006789 | Marine | MVKVSECCGARLMKYDRNWDDGICSECNEHSPARKEKELINEG* |
| Ga0098055_13845411 | 3300006793 | Marine | MKVSECCGERLMKYDKNWDDGVCSKCNEHTPAQKEEEPVDA* |
| Ga0098034_10135642 | 3300006927 | Marine | MVKVSECCNARLLKYDRTWDDGICSECKEHTPAQKEEKGELTE* |
| Ga0098034_10201206 | 3300006927 | Marine | MESECCGARLLKYDRNWDDGICSECKEHSPAHKEKELINEG* |
| Ga0098034_10629303 | 3300006927 | Marine | MKESECCGARLLKYDRNWDDGICSECKEHSPAQKEEGELINE* |
| Ga0098034_11007674 | 3300006927 | Marine | MVKVSECCGAKLMKYDKSWDDGICSECKEHSPAHKEKELTE |
| Ga0104999_10148505 | 3300007504 | Water Column | MNISECCGERLTYYNKEWDDGICSKCNEHSPASREEEEVE* |
| Ga0110931_12628841 | 3300007963 | Marine | MVKVSECCGARLMKYDKNWDDGICSECNEHSPAHKEKELTE* |
| Ga0098052_10473011 | 3300008050 | Marine | RITMKLSECCGERLTRYDKNWDDGVCSKCNEHSPAQTEEEPVDV* |
| Ga0098052_10513736 | 3300008050 | Marine | MKVSECCGERLTRYDKNWDDGVCSKCNEHTPAQKEEEPVDA* |
| Ga0098052_10564255 | 3300008050 | Marine | MVKVSECCGARLMKYDRNWDDGVCSECNEHSPAQKEKELINEGY* |
| Ga0098052_11946533 | 3300008050 | Marine | MKVSECCGARLLKYDRNWDDGICSECKEHSPAHKEKELTE* |
| Ga0114898_11139993 | 3300008216 | Deep Ocean | MKVSECCGARLLRYDKNWDAGVCSECNEHSPAHKEKELTE* |
| Ga0114899_11629293 | 3300008217 | Deep Ocean | MKVSECCGAKLMKYDKNWDDGICSECNEHSPAHKEKELTE* |
| Ga0114899_12392472 | 3300008217 | Deep Ocean | MKVSECCGERLLKFDKAWQDGICSKCKEHSPAQKEEGELIE* |
| Ga0114904_11540171 | 3300008218 | Deep Ocean | MKISECCGARLTHYDKNWDDGICSECNEHSPAQKEKGELVNEE* |
| Ga0114904_11625903 | 3300008218 | Deep Ocean | MKVSECCGARLLRYDRNWDDGVCSECNEHTPAHKEKELTE* |
| Ga0114905_10864862 | 3300008219 | Deep Ocean | MVKVSECCGARLMKYDKNWDDGICSECNEHSPAHKEKELINEG* |
| Ga0114905_11106951 | 3300008219 | Deep Ocean | RYTARQMKVSECCGARLLRYDRNWDDGVCSECNEHTPAHKEKELTE* |
| Ga0114905_11542812 | 3300008219 | Deep Ocean | MKVSECCNARLLKYDRTWDDGICSECKEHTPAQKEEKGELIE* |
| Ga0114905_11550131 | 3300008219 | Deep Ocean | MVKVSECCNARLLKYNRTWDDGICSECKEHTPSKKEEKGELTE* |
| Ga0114905_12376573 | 3300008219 | Deep Ocean | SECCGARLLKYDTSWDDGICSECKEHSPAHKEEELTE* |
| Ga0114910_10747243 | 3300008220 | Deep Ocean | MKVSECCGAKLMKYDKNWDDGICSECNEHSPAHKEKELINEG* |
| Ga0115649_10636682 | 3300009008 | Marine | MNISECCGERLTYYNKEWDDGICSKCNEHSPALREEEEVE* |
| Ga0114996_108129022 | 3300009173 | Marine | MKVSECCNARLLKYDRNWDDGICSECKEHSPAQEEEGELIE* |
| Ga0114996_111649173 | 3300009173 | Marine | MNENISECCKARLTRYDKNWDDGVCAECNEHSPALREKELDTV* |
| Ga0114902_11266162 | 3300009413 | Deep Ocean | MKVSECCNARLLKYDRTWDDGICSECKEHTPAQKEEKGELIE |
| Ga0114902_11436553 | 3300009413 | Deep Ocean | MKVSECCGARLLRYDKNWDDGICSECNEHSPAHKEKELINEG* |
| Ga0114908_11182081 | 3300009418 | Deep Ocean | MKVSECCNARLLKYDRTWDDGICSECKEHTPAQKQKKGELTE* |
| Ga0114908_12623321 | 3300009418 | Deep Ocean | MKLSECCGARLLKYDKNWDDGICSECKEHSPAHKEKELTE* |
| Ga0114911_10645254 | 3300009603 | Deep Ocean | MVKVSECCGARLMKYDKNWDDGICSECKEHSPAHKEKELINEG* |
| Ga0114911_11071503 | 3300009603 | Deep Ocean | MVSECCGARLLKYDTSWDDGICSECKEHSPAQKEKEKE* |
| Ga0114911_12262351 | 3300009603 | Deep Ocean | MKVSECCGARLLRYDKNWDDGVCSECNEHSPAHKEKELTE* |
| Ga0114901_11234502 | 3300009604 | Deep Ocean | MVKVSECCNERLLKYNRTWDDGICSKCKEHTPAQKQKKGELTE* |
| Ga0114906_10804304 | 3300009605 | Deep Ocean | MVSECCGARLLKYDTSWDDGICSECKEHSPAHKEEELTE* |
| Ga0114906_12318572 | 3300009605 | Deep Ocean | MKVSECCGERLTRYDKNWDDGVCSKCNEHSPAQKEEGELINE* |
| Ga0098061_10346423 | 3300010151 | Marine | MKLSECCGERLTRYDKNWDDGVCSKCNEHSPAQTEEEPVDV* |
| Ga0098061_10590151 | 3300010151 | Marine | MKVSECCGAKLTNYDKNWDDGICIECKEHSPAQTEEEVC* |
| Ga0098061_10639365 | 3300010151 | Marine | MKVSECCNARLLRYDRTWDDGICSECKEHTPAQKEEKGELTE* |
| Ga0098061_11736023 | 3300010151 | Marine | MVKVSECCGARLLKYDRNWDDGVCSECNEHSPAHKEKELTE* |
| Ga0098061_12143854 | 3300010151 | Marine | MKMSECCGARLMKYDRNWDDGICSECNEHTPAHKEKELIDER* |
| Ga0098061_12885042 | 3300010151 | Marine | MKVSECCGARLLKYDKNWDDGVCSKCNEHSPAQTEEEPVDA* |
| Ga0098059_13151473 | 3300010153 | Marine | MVKVSECCGARLMKYDRNWDDGVCSECNEHSPAHKEKELTE* |
| Ga0098047_102347461 | 3300010155 | Marine | MKVSECCNARLLKYDRAWDDGICSKCKEHTPAQKEEKGELIE* |
| Ga0098047_102943933 | 3300010155 | Marine | MKVSECCGARLLKYDKNWDDGICLECKEHSPAQKNPEKP |
| Ga0098047_103538351 | 3300010155 | Marine | RITMKVSECCGARLLKYDKNWDDGVCSKCNEHSPAQTEEEPVDA* |
| Ga0098047_104009451 | 3300010155 | Marine | MVSECCGARLLKYDRNWDDGVCSECNEHSPAHKEEELTE* |
| Ga0133547_108520425 | 3300010883 | Marine | MVKVSECCNAKLWKYDRTWDDGICSKCKEHSPAQKEEKGELINEE* |
| Ga0133547_115595144 | 3300010883 | Marine | MKVSECCNARLLKYDRNWDDGICSECKEHSPAQEEEGELTQ* |
| Ga0181374_10347723 | 3300017702 | Marine | MVKVSECCGARLMKYDRNWDDGVCSECNEHSPAHKEEELTE |
| Ga0181432_11651613 | 3300017775 | Seawater | MKVSECCNERLLKYNRTWDDGICSKCKEHTPAQKEEELTE |
| Ga0181432_12692472 | 3300017775 | Seawater | MKVSECCNARLIKYDRNWDDGICSECKEHSPAQKEEGELVE |
| (restricted) Ga0255047_106499692 | 3300024520 | Seawater | MKVSECCGERLTRYDKNWDDGVCSKCNEHSPAQKEEGELVE |
| Ga0208920_10637092 | 3300025072 | Marine | MKVSECCNARLLKYDRTWDDGICSKCKEHTPAQKEEKGELIE |
| Ga0208011_10485892 | 3300025096 | Marine | MESECCGARLLKYDRNWDDGICSECKEHSPAHKEKELTE |
| Ga0208010_10620213 | 3300025097 | Marine | MKVSECCGERLTRYDKNWDDGVCSKCNEHSPAQKEGEPVDA |
| Ga0208793_11936181 | 3300025108 | Marine | ELVSECCGERLMKYDKNWDDGVCSKCNEHTPAQKEEEPVDA |
| Ga0208553_10858282 | 3300025109 | Marine | MESECCGARLWKYDRNWDDGICSKCNEHSPAHKEKELINERQ |
| Ga0208433_11367212 | 3300025114 | Marine | MKVSECCGERLMKYDKNWDDGVCSKCNEHSPAQTEEEPVDA |
| Ga0209434_11546761 | 3300025122 | Marine | MTEEKLSECCNAQLLKYDKNWDDGICSECKEHSPAQKEEGELINE |
| Ga0209128_10018712 | 3300025131 | Marine | MKISECCGAKLTNYDKNWDDGICIECKEHSPAINEEVKELRMEIQK |
| Ga0208299_10467545 | 3300025133 | Marine | MVKVSECCGARLMKYDRNWDDGVCSECNEHSPAQKEKELINEGY |
| Ga0208299_12055351 | 3300025133 | Marine | MKLSECCGERLTRYDKNWDDGVCSKCNEHSPAQTEEEPVDV |
| Ga0208813_10804502 | 3300025270 | Deep Ocean | MVKVSECCGARLMKYDKNWDDGICSECKEHSPAQEEEEQAVVD |
| Ga0208183_10571042 | 3300025274 | Deep Ocean | MKVSECCGAKLMKYDKNWDDGICSECKEHSPAQKEKELTE |
| Ga0208560_10050623 | 3300026115 | Marine Oceanic | MVKVSECCGARLMKYDRNWDDGVCSECNEHSPAHKEKELTE |
| Ga0209402_103816181 | 3300027847 | Marine | MKVSECCNARLLKYDRNWDDGICSECKEHSPAQEE |
| Ga0315316_113114484 | 3300032011 | Seawater | MKESECCGARLLKYDKNWDDGICSECKEHSPAQKEEGELVE |
| ⦗Top⦘ |