


| Basic Information | |
|---|---|
| Family ID | F104932 |
| Family Type | Metagenome |
| Number of Sequences | 100 |
| Average Sequence Length | 48 residues |
| Representative Sequence | PRVVVVTGYGEPYLTRARQAGAEVVFTKPVEWSRILEWLERPDLAASA |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.00 % |
| % of genes from short scaffolds (< 2000 bps) | 92.00 % |
| Associated GOLD sequencing projects | 89 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.65 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (15.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (42.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.32% β-sheet: 10.53% Coil/Unstructured: 63.16% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.65 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF01977 | UbiD | 41.00 |
| PF03773 | ArsP_1 | 41.00 |
| PF00072 | Response_reg | 2.00 |
| PF01040 | UbiA | 2.00 |
| PF01209 | Ubie_methyltran | 2.00 |
| PF00989 | PAS | 1.00 |
| PF13560 | HTH_31 | 1.00 |
| PF00561 | Abhydrolase_1 | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG0043 | 3-polyprenyl-4-hydroxybenzoate decarboxylase | Coenzyme transport and metabolism [H] | 41.00 |
| COG0701 | Uncharacterized membrane protein YraQ, UPF0718 family | Function unknown [S] | 41.00 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 2.00 |
| COG2227 | 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase | Coenzyme transport and metabolism [H] | 2.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.00 % |
| Unclassified | root | N/A | 1.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2228664022|INPgaii200_c0953017 | All Organisms → cellular organisms → Bacteria | 1376 | Open in IMG/M |
| 2228664022|INPgaii200_c0955211 | All Organisms → cellular organisms → Bacteria | 1140 | Open in IMG/M |
| 3300002562|JGI25382J37095_10274653 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300004480|Ga0062592_100739519 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300005171|Ga0066677_10348328 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300005328|Ga0070676_11008948 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 625 | Open in IMG/M |
| 3300005332|Ga0066388_103739252 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300005340|Ga0070689_100506997 | All Organisms → cellular organisms → Bacteria | 1034 | Open in IMG/M |
| 3300005341|Ga0070691_10364420 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 806 | Open in IMG/M |
| 3300005445|Ga0070708_100227116 | All Organisms → cellular organisms → Bacteria | 1751 | Open in IMG/M |
| 3300005445|Ga0070708_101325232 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300005451|Ga0066681_10365007 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
| 3300005536|Ga0070697_100574223 | All Organisms → cellular organisms → Bacteria | 990 | Open in IMG/M |
| 3300005540|Ga0066697_10565238 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 635 | Open in IMG/M |
| 3300005545|Ga0070695_100456924 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
| 3300005555|Ga0066692_10786006 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 586 | Open in IMG/M |
| 3300005566|Ga0066693_10204067 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 768 | Open in IMG/M |
| 3300005569|Ga0066705_10672959 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 626 | Open in IMG/M |
| 3300005615|Ga0070702_101348999 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300005617|Ga0068859_102600979 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 557 | Open in IMG/M |
| 3300005713|Ga0066905_100630914 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
| 3300005843|Ga0068860_102233795 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 568 | Open in IMG/M |
| 3300006755|Ga0079222_10545813 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300006800|Ga0066660_11582032 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 519 | Open in IMG/M |
| 3300006804|Ga0079221_10823378 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 669 | Open in IMG/M |
| 3300006845|Ga0075421_100380388 | All Organisms → cellular organisms → Bacteria | 1699 | Open in IMG/M |
| 3300006845|Ga0075421_101674087 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 689 | Open in IMG/M |
| 3300006854|Ga0075425_100109886 | All Organisms → cellular organisms → Bacteria | 3142 | Open in IMG/M |
| 3300006881|Ga0068865_102056389 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 519 | Open in IMG/M |
| 3300006969|Ga0075419_10493341 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300006969|Ga0075419_10909923 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 635 | Open in IMG/M |
| 3300007004|Ga0079218_13699976 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 520 | Open in IMG/M |
| 3300007076|Ga0075435_101323475 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 631 | Open in IMG/M |
| 3300007265|Ga0099794_10234837 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
| 3300009090|Ga0099827_10004218 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8398 | Open in IMG/M |
| 3300009094|Ga0111539_10412653 | Not Available | 1573 | Open in IMG/M |
| 3300009094|Ga0111539_10669426 | All Organisms → cellular organisms → Bacteria | 1209 | Open in IMG/M |
| 3300009147|Ga0114129_12440215 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 626 | Open in IMG/M |
| 3300009691|Ga0114944_1027991 | All Organisms → cellular organisms → Bacteria | 1988 | Open in IMG/M |
| 3300009819|Ga0105087_1126107 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 501 | Open in IMG/M |
| 3300010325|Ga0134064_10262977 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 643 | Open in IMG/M |
| 3300010325|Ga0134064_10504304 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300010329|Ga0134111_10381753 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 600 | Open in IMG/M |
| 3300010366|Ga0126379_10279167 | All Organisms → cellular organisms → Bacteria | 1663 | Open in IMG/M |
| 3300011269|Ga0137392_10533615 | All Organisms → cellular organisms → Bacteria | 974 | Open in IMG/M |
| 3300011269|Ga0137392_11175417 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 625 | Open in IMG/M |
| 3300012189|Ga0137388_11693994 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 566 | Open in IMG/M |
| 3300012200|Ga0137382_10876588 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 647 | Open in IMG/M |
| 3300012285|Ga0137370_10413974 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 817 | Open in IMG/M |
| 3300012362|Ga0137361_11065801 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 729 | Open in IMG/M |
| 3300012363|Ga0137390_11093024 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 747 | Open in IMG/M |
| 3300012685|Ga0137397_10282356 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1237 | Open in IMG/M |
| 3300012927|Ga0137416_11227917 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 675 | Open in IMG/M |
| 3300012944|Ga0137410_10298956 | All Organisms → cellular organisms → Bacteria | 1274 | Open in IMG/M |
| 3300012944|Ga0137410_10426680 | All Organisms → cellular organisms → Bacteria | 1073 | Open in IMG/M |
| 3300014320|Ga0075342_1251341 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 514 | Open in IMG/M |
| 3300015054|Ga0137420_1233757 | All Organisms → cellular organisms → Bacteria | 2602 | Open in IMG/M |
| 3300015357|Ga0134072_10113139 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300015374|Ga0132255_105025251 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 560 | Open in IMG/M |
| 3300018000|Ga0184604_10122049 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300018422|Ga0190265_12021090 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300018431|Ga0066655_10008725 | All Organisms → cellular organisms → Bacteria | 4295 | Open in IMG/M |
| 3300018433|Ga0066667_10236573 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1373 | Open in IMG/M |
| 3300019360|Ga0187894_10519221 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 514 | Open in IMG/M |
| 3300025324|Ga0209640_10718802 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300025922|Ga0207646_10057848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 3464 | Open in IMG/M |
| 3300025945|Ga0207679_11714709 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 575 | Open in IMG/M |
| 3300025961|Ga0207712_11028740 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 731 | Open in IMG/M |
| 3300026044|Ga0208287_1016057 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 679 | Open in IMG/M |
| 3300026075|Ga0207708_11050379 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 709 | Open in IMG/M |
| 3300026300|Ga0209027_1091974 | All Organisms → cellular organisms → Bacteria | 1099 | Open in IMG/M |
| 3300026309|Ga0209055_1034103 | All Organisms → cellular organisms → Bacteria | 2300 | Open in IMG/M |
| 3300026317|Ga0209154_1295267 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 535 | Open in IMG/M |
| 3300026527|Ga0209059_1181555 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300026528|Ga0209378_1231563 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 589 | Open in IMG/M |
| 3300026537|Ga0209157_1208463 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300027691|Ga0209485_1331922 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 511 | Open in IMG/M |
| 3300027846|Ga0209180_10446163 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 729 | Open in IMG/M |
| 3300027873|Ga0209814_10410080 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300027949|Ga0209860_1060751 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 501 | Open in IMG/M |
| 3300028590|Ga0247823_10550161 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
| 3300028792|Ga0307504_10355097 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 566 | Open in IMG/M |
| 3300031170|Ga0307498_10202659 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 693 | Open in IMG/M |
| 3300031229|Ga0299913_10770593 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 937 | Open in IMG/M |
| 3300031548|Ga0307408_100387439 | All Organisms → cellular organisms → Bacteria | 1196 | Open in IMG/M |
| 3300031548|Ga0307408_101319034 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 677 | Open in IMG/M |
| 3300031716|Ga0310813_10053234 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2990 | Open in IMG/M |
| 3300031720|Ga0307469_12460069 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 509 | Open in IMG/M |
| 3300031731|Ga0307405_11212542 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300031820|Ga0307473_10290873 | All Organisms → cellular organisms → Bacteria | 1023 | Open in IMG/M |
| 3300031824|Ga0307413_10906641 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 749 | Open in IMG/M |
| 3300031944|Ga0310884_11061241 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300031995|Ga0307409_102056370 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 601 | Open in IMG/M |
| 3300032000|Ga0310903_10157686 | All Organisms → cellular organisms → Bacteria | 1029 | Open in IMG/M |
| 3300032003|Ga0310897_10112560 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
| 3300032017|Ga0310899_10218680 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
| 3300032075|Ga0310890_11537767 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 549 | Open in IMG/M |
| 3300032126|Ga0307415_100380851 | All Organisms → cellular organisms → Bacteria | 1198 | Open in IMG/M |
| 3300033551|Ga0247830_10005005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 6514 | Open in IMG/M |
| 3300033551|Ga0247830_10114414 | All Organisms → cellular organisms → Bacteria | 1920 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 15.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 13.00% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 10.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 8.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.00% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 6.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.00% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 4.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.00% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 2.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.00% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 2.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.00% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 1.00% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.00% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 1.00% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 1.00% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009691 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP2 | Environmental | Open in IMG/M |
| 3300009819 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_40_50 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014320 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D1 | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019360 | White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaG | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026044 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailB_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300027691 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027949 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_40_50 (SPAdes) | Environmental | Open in IMG/M |
| 3300028590 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day30 | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
| 3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPgaii200_09530173 | 2228664022 | Soil | LRSRSGHTTRVLVVTGYGEPFLSRARQAGADVVFTKPVEWSRILEYLERPDLAASA |
| INPgaii200_09552111 | 2228664022 | Soil | RSGHTTRVLVVTGYGEPFLSRARQAGADVVFTKPVEWSRILEYLERPDLAASA |
| JGI25382J37095_102746531 | 3300002562 | Grasslands Soil | RSRSGRGTRVMVVTGYGEPYLTRARQAGADVVFTKPVEWSRILEYLERPDLAASA* |
| Ga0062592_1007395193 | 3300004480 | Soil | LTTARGRTRVIVVTGYGEPYLTRARQAGAEVVFTKPVEWTRILEWLERPGLAASA* |
| Ga0066677_103483281 | 3300005171 | Soil | RVMVVTGYGEPFLTRARQAGADVVFTKPVEWSRILEYLERSDLAASA* |
| Ga0070676_110089482 | 3300005328 | Miscanthus Rhizosphere | AGARGRPRVVVVTGYGEPYLTRARQAGAEVVFTKPVEWSRILEWLERPDLAASA* |
| Ga0066388_1037392522 | 3300005332 | Tropical Forest Soil | VVVITGYGEPYVSRARQAGADAVFTKPVEWTNILDYIRRPDLAASA* |
| Ga0070689_1005069973 | 3300005340 | Switchgrass Rhizosphere | TGYGEPFISRARAAGADVVFTKPVEWTRVLDFLHERRLPASA* |
| Ga0070691_103644203 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | LASARGRTRVVVVTGYGEPYLSRARQAGAEVVFTKPVEWSRILEWLERPDLAASA* |
| Ga0070708_1002271163 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MVVTGYGEPFLTRARQAGADVVFTKPVEWSRILEYIERSDLAASA* |
| Ga0070708_1013252322 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | SGAATRVVVITGYGEPYLTRARQAGADAVFTKPVEWTYILDYLRRPDLAASA* |
| Ga0066681_103650072 | 3300005451 | Soil | RIVVVTGYGEPYLSRARQAGAEVVFTKPVEWSRILEWLERPDLAASA* |
| Ga0070697_1005742232 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VVITGYGEPYLTRARHAGADAVFTKPVEWTRILDYIRRPDFAVSA* |
| Ga0066697_105652381 | 3300005540 | Soil | PFLARARQAGADVVFTKPVEWSRILEYLEHPDFAASA* |
| Ga0070695_1004569243 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | LIRELRSRSGLTTRVLVVTGYGEPFLSRARQAGADVVFTKPVEWSRILEYLERPDLAASA |
| Ga0066692_107860062 | 3300005555 | Soil | PFLSRARQAGADVVFTKPVEWSRILEYLERRDLAASA* |
| Ga0066693_102040673 | 3300005566 | Soil | TGYGEPYLTRARQAGAEVVFTKPVEWTRILAYLERPGLAASA* |
| Ga0066705_106729591 | 3300005569 | Soil | SGRATRVMVVTGYGEPFLTRARQAGADVVFTKPVEWSRILEYLERSDLAASA* |
| Ga0070702_1013489991 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | VPHHARIVVITGYGEPYLTRARRAGADVVLTKPVEWKRVLAALQPPGLAASA* |
| Ga0068859_1026009791 | 3300005617 | Switchgrass Rhizosphere | IRQILAGARGRTRVVVVTGYGEPYLTRARQAGAEVVFTKPVEWSRILEWLERPDLAASA* |
| Ga0066905_1006309141 | 3300005713 | Tropical Forest Soil | STHRRPRIAVITGYGEPYLTRARQAGAHAVFTKPVEWTRVVDYLCRPDLAASA* |
| Ga0068860_1022337952 | 3300005843 | Switchgrass Rhizosphere | RQILAGARGRTRVVVVTGYGEPYLTRARQAGAEVVFTKPVEWSRILEWLERPDLAASA* |
| Ga0079222_105458131 | 3300006755 | Agricultural Soil | HAGRATRVMVVTGYGEPFLSRARQAGADVVFTKPVEWSRILEYLERPDFAASA* |
| Ga0066660_115820321 | 3300006800 | Soil | RVMVVTGYGEPFLTRARQAGADVVFTKPVEWSRILEYIERSDLAASA* |
| Ga0079221_108233782 | 3300006804 | Agricultural Soil | YGEPFLSRARQAGADVVFTKPVEWSRILEYLERPDLAASA* |
| Ga0075421_1003803883 | 3300006845 | Populus Rhizosphere | KGRTRVVVVTGYGEPYLSRARQAGADVVFTKPVEWSRILDYLSRTDLAASA* |
| Ga0075421_1016740871 | 3300006845 | Populus Rhizosphere | LASARKGTRVVVITGYGEPYLTRARQAGAEVVFTKPVEWTRILDYLHRPGLAASA* |
| Ga0075425_1001098861 | 3300006854 | Populus Rhizosphere | VLIRELRSRSGHTTRVLVVTGYGEPFLSRARQAGADVVFTKPVEWSRILEYLERPDLAASA* |
| Ga0068865_1020563891 | 3300006881 | Miscanthus Rhizosphere | EPYLTRARQAGAEVVFTKPVEWSRILEWLERPDLAASA* |
| Ga0075419_104933411 | 3300006969 | Populus Rhizosphere | IVVTGYGEPYLTRARQAGAEVVFTKPVEWTRILEWLEKPGLAASA* |
| Ga0075419_109099232 | 3300006969 | Populus Rhizosphere | ELRSRSGQDTRVLVVTGYGEPFLSRARQAGANVVFTKPVEWSRILEYLERPDLAASA* |
| Ga0079218_136999761 | 3300007004 | Agricultural Soil | LAATRNRTRVIVITGYGEPYRTRARQAGAEVVFTKPVEWAGILDYLQRPGLAASA* |
| Ga0075435_1013234752 | 3300007076 | Populus Rhizosphere | YLSRARQAGADVVFTKPVEWSRILEYLSRTDLAASA* |
| Ga0099794_102348373 | 3300007265 | Vadose Zone Soil | YLTRARQAGAHAVFTKPVEWTRVVDYLCRPDLAASA* |
| Ga0099827_100042183 | 3300009090 | Vadose Zone Soil | VITGYGEPYLTRARQAGADAVFTKPVEWSRVLDYLRRPDLAASA* |
| Ga0111539_104126531 | 3300009094 | Populus Rhizosphere | PRVVVVTGYGEPYLTRARQAGAEVVFTKPVEWSRILEWLERPDLAASA* |
| Ga0111539_106694263 | 3300009094 | Populus Rhizosphere | YLTRARQAGAEVVFTKPVEWTRILDYLHRPGLAASA* |
| Ga0114129_124402152 | 3300009147 | Populus Rhizosphere | RSRSGHTTRVLVVTGYGEPFLSRARQAGADVVFTKPVEWSRILEYLERPDLAASA* |
| Ga0114944_10279911 | 3300009691 | Thermal Springs | RIIVVTGYGEPYLTRARQAGADVVFTKPVEWMRILDYLQRSGLAASA* |
| Ga0105087_11261071 | 3300009819 | Groundwater Sand | TRVLVVTGYGEPYLTRARQAGAHVVFTKPVEWSRILEALQRPDLAASA* |
| Ga0134064_102629772 | 3300010325 | Grasslands Soil | RELRARSARATRVVVVTGYGEPFLARARQAGADVVFTKPVEWSRILEYLEHPDFAASA* |
| Ga0134064_105043042 | 3300010325 | Grasslands Soil | ELRARSGRATRVMVVTGYGEPFLTRARQAGADVVFTKPVEWSRILEYLERSDLAASA* |
| Ga0134111_103817532 | 3300010329 | Grasslands Soil | IVITGYGEPYLSRARQAGAEVVFTKPVEWTRILDYLHRPGLAASA* |
| Ga0126379_102791673 | 3300010366 | Tropical Forest Soil | EPFTSRARQAGADVVFTKPVEWTRVLDFLHQRRLPASA* |
| Ga0137392_105336153 | 3300011269 | Vadose Zone Soil | YGEPYLTRARQAGADAVFTKPVEWSRVLDYLRRPDLAASA* |
| Ga0137392_111754172 | 3300011269 | Vadose Zone Soil | RRRTRVVVVTGCGEPYLTRARQAGAEAVFTKPVEWTRILDWLQRPGLAASA* |
| Ga0137388_116939941 | 3300012189 | Vadose Zone Soil | RVVVITGYGEPYLTRARHSWADAVFTKPVEWTRILDYIRHPDLAVSA* |
| Ga0137382_108765882 | 3300012200 | Vadose Zone Soil | VTGYGEPFLTRARQAGADVVFTKPVEWSRILEYLERSDLAASA* |
| Ga0137370_104139743 | 3300012285 | Vadose Zone Soil | PTTRVMVVTGYGEPFLSRARQAGADVVFTKPVEWSRILEYLERPDLAASA* |
| Ga0137361_110658012 | 3300012362 | Vadose Zone Soil | VVTGYGEPFLTRARQAGADVVFTKPVEWSRILEYLERSDLAASA* |
| Ga0137390_110930242 | 3300012363 | Vadose Zone Soil | VLVRQLRAGSANGTRVVVITGYGEPYLTRARHAGADAVFTKPVEWTRILDYIRHPDLAVSA* |
| Ga0137397_102823564 | 3300012685 | Vadose Zone Soil | AARGRTRVAVVTGCGEPYLTRARQAGAEAVFTKPVEWTSILDWLQRPGLAASA* |
| Ga0137416_112279172 | 3300012927 | Vadose Zone Soil | MVVTGYGEPFLSRARQAGADVVFTKPVEWSRILEYLERPDFAASA* |
| Ga0137410_102989563 | 3300012944 | Vadose Zone Soil | VLIRELRARSGRGTRVMVVTGYGEPFLSRARQAGADVVFTKPVEWSRILEYLGRPDFAASA* |
| Ga0137410_104266801 | 3300012944 | Vadose Zone Soil | TGYGEPFLTRARQAGADVVFTKPVEWSRILEYIERSDLAASA* |
| Ga0075342_12513411 | 3300014320 | Natural And Restored Wetlands | VTGYGEPYLSRARQAGAEVVFTKPVEWTRILEWLERPGLAA |
| Ga0137420_12337571 | 3300015054 | Vadose Zone Soil | ELRARSGRATRVMVVTGYGEPFLTRARQAGADVVFTKPVEWSRILEYIERSDLAASA* |
| Ga0134072_101131393 | 3300015357 | Grasslands Soil | ELRARSGRSTRVMVVTGYGEPFLSRARQAGADVVFTKPVEWSRILDYLERRDLAASA* |
| Ga0132255_1050252512 | 3300015374 | Arabidopsis Rhizosphere | RRRARVIVVTGYGEPYLTRARQAGADVVFTKPVEWSQVLEAIDKPDLAASA* |
| Ga0184604_101220491 | 3300018000 | Groundwater Sediment | AHRRTRVIVVTGYGEPYLTRARQAGAEIVFTKPVEWTRVLEWLEKPGLAASA |
| Ga0190265_120210901 | 3300018422 | Soil | TYLTRARQAGAEVVFTKPVEWTRILDYLHRPGLAASA |
| Ga0066655_100087257 | 3300018431 | Grasslands Soil | RATRVVVVTGYGEPFLARARQAGADVVFTKPVEWSRILEYLEHPDLAASA |
| Ga0066667_102365733 | 3300018433 | Grasslands Soil | LIRQILAGARRRTRVVVVTGYGEPYLSRARQAGAEVVFTKPVEWARILEWLQHPDLAASA |
| Ga0187894_105192211 | 3300019360 | Microbial Mat On Rocks | GGNTTRVIVVTGYGAPYLTRARQAGADAVFTKPVEWTRILDYLRRPDLAASA |
| Ga0209640_107188021 | 3300025324 | Soil | YLSRARQAGAEVVFTKPVEWTRILEWLERPGLAASA |
| Ga0207646_100578481 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | IAGDTLVRQIRAASANGTRVVVITGYGEPYLTRARHAGADAVFTKPVEWTRILDYIRRPDFAVSA |
| Ga0207679_117147091 | 3300025945 | Corn Rhizosphere | LSTCRTRACVIVITGYGEPFISRARAAGADIVFTKPVEWTRVLDFLHERRLPASA |
| Ga0207712_110287401 | 3300025961 | Switchgrass Rhizosphere | VVTGYGEPYLTRARQAGAEVVFTKPVEWTRILEWLERPGLAASA |
| Ga0208287_10160572 | 3300026044 | Natural And Restored Wetlands | YGEPYLTRARQAGAHVVFTKPVEWSRILDALQRPDLAASA |
| Ga0207708_110503791 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | LTTARGRTRIIVVTGYGEPYLTRARQAGAEVVFTKPVEWTRILEWLERPGLAASA |
| Ga0209027_10919743 | 3300026300 | Grasslands Soil | LTRARQAGADVVFTKPVEWSRILEYIERSDLAASA |
| Ga0209055_10341031 | 3300026309 | Soil | GRATRVMVVTGYGEPFLTRARQAGADVVFTKPVEWSRILEYIERSDLAASA |
| Ga0209154_12952672 | 3300026317 | Soil | YGEPFLTRARQAGADVVFTKPVEWSRILEYLERSDLAASA |
| Ga0209059_11815552 | 3300026527 | Soil | MDGPRVMVVTGYGEPFLSRARQAGADVVFTKPVEWTRILDWLQRPDLAASA |
| Ga0209378_12315631 | 3300026528 | Soil | GYGEPFLSRARQAGADVVFTKPVEWSRILDYLERRDLAASA |
| Ga0209157_12084633 | 3300026537 | Soil | YGEPYLTRARQAGAHAVFTKPVEWTRVVDYLCRPDLAASA |
| Ga0209485_13319222 | 3300027691 | Agricultural Soil | GYGEPYLTRAKQAGAQVVFTKPVEWSRILEALQRPDLAASA |
| Ga0209180_104461631 | 3300027846 | Vadose Zone Soil | VRQMSNGARARLRILVITGYGEPYLTRARQAGADAVFTKPVEWSRVLDYLRRPDLAASA |
| Ga0209814_104100801 | 3300027873 | Populus Rhizosphere | VLIRQILSTARGRPRVIVVTGYGEPYLSRARQAGAEVVFTKPVEWTRILEALERPGLAAS |
| Ga0209860_10607511 | 3300027949 | Groundwater Sand | QSRGRTRVLVVTGYGEPYLTRARQAGAHVVFTKPVEWSRILEALQRPDLAASA |
| Ga0247823_105501611 | 3300028590 | Soil | VTGYGEPYLTRARQAGADVVFTKQVEWAQVLESLDKPDLAASA |
| Ga0307504_103550972 | 3300028792 | Soil | RAGSARGTRVVVITGYGEPYLTRARHAGADAVFTKPVEWTRILDYIRRPDLAVSA |
| Ga0307498_102026591 | 3300031170 | Soil | EPYLTRARQAGADVVFTKPVEWARILEWLDKPDLAASA |
| Ga0299913_107705931 | 3300031229 | Soil | RVIAVTGYGEPYLSRARQAGAEVVFTKPVEWSRILEWLETPELAASA |
| Ga0307408_1003874393 | 3300031548 | Rhizosphere | RVLVVTGYGEPYLTRAKQAGAQVVFTKPVEWSRILEALQRPDLAASA |
| Ga0307408_1013190343 | 3300031548 | Rhizosphere | RIIVVTGYGEPYLTRARQAGAEVVFTKPVEWTRILEWLERPGLAASA |
| Ga0310813_100532341 | 3300031716 | Soil | HHARIVVITGYGEPYLTRARRAGADVVLTKPVEWKRVLAALQPPGLAASA |
| Ga0307469_124600691 | 3300031720 | Hardwood Forest Soil | GEPYLSRARQAGADAVFTKPVEWTQILDCIRRPDLAASA |
| Ga0307405_112125421 | 3300031731 | Rhizosphere | RHILATARGRTRVIVVTGYGEPYLTRARQAGAEVVFTKPVEWTRILEWLERPDLAASA |
| Ga0307473_102908731 | 3300031820 | Hardwood Forest Soil | EPFLTRARQAGADVVFTKPVEWSRILEYIERSDLAASA |
| Ga0307413_109066411 | 3300031824 | Rhizosphere | PYLTRAKQAGAQVVFTKPVEWSRILEALQRPDLAASA |
| Ga0310884_110612412 | 3300031944 | Soil | LSSTRRRARVIVVTGYGEPYLTRARQAGADVVFTKPVEWAQVLESLDKPDLAASA |
| Ga0307409_1020563701 | 3300031995 | Rhizosphere | VTGYGEPYLTRARQAGAEVVFTKPVEWTRILEWLERPGLAASA |
| Ga0310903_101576861 | 3300032000 | Soil | TARGRTRVIVVTGYGEPYLTRARQAGAEVVFTKPVEWTRILEWLERPGLAASA |
| Ga0310897_101125601 | 3300032003 | Soil | RVIVVTGYGEPYLTRARQAGAEVVFTKPVEWTRILEWLERPGLAASA |
| Ga0310899_102186802 | 3300032017 | Soil | TGYGEPYLTRARQAGADVVFTKPVEWAQVLEAIDKPDLAASA |
| Ga0310890_115377671 | 3300032075 | Soil | GYGEPYLTRARQAGAEVVFTKPVEWTRILEWLERPGLAASA |
| Ga0307415_1003808513 | 3300032126 | Rhizosphere | RVLVVTGYGEPYLSRAKQAGAQVVFTKPVEWSRILEALQRPDLAASA |
| Ga0247830_100050056 | 3300033551 | Soil | QILSTARGRTRVIVVTGYGEPYLSRARQAGAEVVFTKPVEWTRILEWLDHPGLAASA |
| Ga0247830_101144141 | 3300033551 | Soil | TRVIVVTGYGEPYLTRARQAGAEVVFTKPVEWTRILEWLEKPGLAASA |
| ⦗Top⦘ |