


| Basic Information | |
|---|---|
| Family ID | F104825 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 100 |
| Average Sequence Length | 47 residues |
| Representative Sequence | NIFNQVNFDIPNTAVNNQATLGRITRTDPGSGDPRILQFGLKFVF |
| Number of Associated Samples | 87 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 96.00 % |
| % of genes from short scaffolds (< 2000 bps) | 92.00 % |
| Associated GOLD sequencing projects | 83 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.17 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (17.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (59.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.17 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF13432 | TPR_16 | 16.00 |
| PF13620 | CarboxypepD_reg | 6.00 |
| PF10282 | Lactonase | 6.00 |
| PF13683 | rve_3 | 3.00 |
| PF01070 | FMN_dh | 3.00 |
| PF03551 | PadR | 2.00 |
| PF13414 | TPR_11 | 2.00 |
| PF02810 | SEC-C | 2.00 |
| PF13516 | LRR_6 | 2.00 |
| PF07586 | HXXSHH | 2.00 |
| PF00106 | adh_short | 1.00 |
| PF13561 | adh_short_C2 | 1.00 |
| PF02371 | Transposase_20 | 1.00 |
| PF13385 | Laminin_G_3 | 1.00 |
| PF08450 | SGL | 1.00 |
| PF13855 | LRR_8 | 1.00 |
| PF13424 | TPR_12 | 1.00 |
| PF12704 | MacB_PCD | 1.00 |
| PF00202 | Aminotran_3 | 1.00 |
| PF00515 | TPR_1 | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 3.00 |
| COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 3.00 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 2.00 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 2.00 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 2.00 |
| COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 1.00 |
| COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 1.00 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.00 % |
| Unclassified | root | N/A | 4.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000559|F14TC_101769961 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 694 | Open in IMG/M |
| 3300004156|Ga0062589_101960598 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300005186|Ga0066676_10782745 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 647 | Open in IMG/M |
| 3300005332|Ga0066388_105382242 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300005338|Ga0068868_100598882 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 976 | Open in IMG/M |
| 3300005343|Ga0070687_100316650 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 995 | Open in IMG/M |
| 3300005446|Ga0066686_10648612 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 717 | Open in IMG/M |
| 3300005447|Ga0066689_10575035 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 711 | Open in IMG/M |
| 3300005466|Ga0070685_10695899 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300005471|Ga0070698_100104541 | All Organisms → cellular organisms → Bacteria | 2802 | Open in IMG/M |
| 3300005471|Ga0070698_101569578 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300005536|Ga0070697_101782338 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300005539|Ga0068853_102199610 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300005545|Ga0070695_101290504 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
| 3300005546|Ga0070696_100297644 | All Organisms → cellular organisms → Bacteria | 1235 | Open in IMG/M |
| 3300005549|Ga0070704_101598570 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300005558|Ga0066698_10302845 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1107 | Open in IMG/M |
| 3300005559|Ga0066700_10869256 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
| 3300005568|Ga0066703_10275694 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1019 | Open in IMG/M |
| 3300005615|Ga0070702_101649005 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300005617|Ga0068859_100147906 | All Organisms → cellular organisms → Bacteria | 2424 | Open in IMG/M |
| 3300005719|Ga0068861_100270311 | All Organisms → cellular organisms → Bacteria | 1459 | Open in IMG/M |
| 3300005719|Ga0068861_102301176 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300006046|Ga0066652_101098795 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300006049|Ga0075417_10015214 | All Organisms → cellular organisms → Bacteria | 2966 | Open in IMG/M |
| 3300006049|Ga0075417_10636359 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 545 | Open in IMG/M |
| 3300006796|Ga0066665_11554502 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
| 3300006797|Ga0066659_11534809 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
| 3300006852|Ga0075433_10320669 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1371 | Open in IMG/M |
| 3300006854|Ga0075425_100071861 | All Organisms → cellular organisms → Bacteria | 3898 | Open in IMG/M |
| 3300006903|Ga0075426_10310973 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1153 | Open in IMG/M |
| 3300006903|Ga0075426_11568005 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300006904|Ga0075424_101205705 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 806 | Open in IMG/M |
| 3300006969|Ga0075419_10855412 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 654 | Open in IMG/M |
| 3300007076|Ga0075435_101828770 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300009088|Ga0099830_10807672 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 774 | Open in IMG/M |
| 3300009089|Ga0099828_11206762 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300009094|Ga0111539_11378808 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 818 | Open in IMG/M |
| 3300009094|Ga0111539_11893511 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 692 | Open in IMG/M |
| 3300009094|Ga0111539_13394662 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300009147|Ga0114129_11188958 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 950 | Open in IMG/M |
| 3300009148|Ga0105243_10149610 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2001 | Open in IMG/M |
| 3300009156|Ga0111538_12760771 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 615 | Open in IMG/M |
| 3300009162|Ga0075423_12040618 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
| 3300009176|Ga0105242_12469389 | Not Available | 568 | Open in IMG/M |
| 3300009177|Ga0105248_13318623 | Not Available | 512 | Open in IMG/M |
| 3300009553|Ga0105249_10715915 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1062 | Open in IMG/M |
| 3300010303|Ga0134082_10517836 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300010362|Ga0126377_12910692 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300010396|Ga0134126_13019027 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300010399|Ga0134127_11919562 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 669 | Open in IMG/M |
| 3300010400|Ga0134122_13123743 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300010400|Ga0134122_13328309 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300011270|Ga0137391_10630768 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 896 | Open in IMG/M |
| 3300012360|Ga0137375_10336703 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1346 | Open in IMG/M |
| 3300012360|Ga0137375_10595045 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 922 | Open in IMG/M |
| 3300012582|Ga0137358_10624426 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 722 | Open in IMG/M |
| 3300012901|Ga0157288_10354151 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 533 | Open in IMG/M |
| 3300012961|Ga0164302_11051484 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 639 | Open in IMG/M |
| 3300012975|Ga0134110_10004493 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5132 | Open in IMG/M |
| 3300015356|Ga0134073_10212882 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 648 | Open in IMG/M |
| 3300015371|Ga0132258_11551398 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1672 | Open in IMG/M |
| 3300015371|Ga0132258_11885260 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1505 | Open in IMG/M |
| 3300018031|Ga0184634_10332012 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 697 | Open in IMG/M |
| 3300018081|Ga0184625_10345941 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 773 | Open in IMG/M |
| 3300018468|Ga0066662_11876319 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 627 | Open in IMG/M |
| 3300019356|Ga0173481_10467228 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300019888|Ga0193751_1113614 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1021 | Open in IMG/M |
| 3300020004|Ga0193755_1119253 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300020170|Ga0179594_10298761 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300023072|Ga0247799_1028159 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 879 | Open in IMG/M |
| 3300025315|Ga0207697_10095262 | All Organisms → cellular organisms → Bacteria | 1265 | Open in IMG/M |
| 3300025324|Ga0209640_10153303 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1972 | Open in IMG/M |
| 3300025923|Ga0207681_10248491 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1388 | Open in IMG/M |
| 3300025923|Ga0207681_10913942 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 735 | Open in IMG/M |
| 3300025926|Ga0207659_11030831 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 708 | Open in IMG/M |
| 3300025936|Ga0207670_10161420 | All Organisms → cellular organisms → Bacteria | 1673 | Open in IMG/M |
| 3300025936|Ga0207670_10652794 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 868 | Open in IMG/M |
| 3300025937|Ga0207669_11425363 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300025941|Ga0207711_10105300 | All Organisms → cellular organisms → Bacteria | 2501 | Open in IMG/M |
| 3300025941|Ga0207711_10911336 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300025960|Ga0207651_10563825 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 992 | Open in IMG/M |
| 3300025981|Ga0207640_11764631 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300026023|Ga0207677_11145413 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 710 | Open in IMG/M |
| 3300026035|Ga0207703_10284706 | All Organisms → cellular organisms → Bacteria | 1502 | Open in IMG/M |
| 3300026088|Ga0207641_11192162 | Not Available | 761 | Open in IMG/M |
| 3300026118|Ga0207675_102571516 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300026320|Ga0209131_1387533 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300026552|Ga0209577_10052775 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3425 | Open in IMG/M |
| 3300027723|Ga0209703_1185015 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 771 | Open in IMG/M |
| 3300027873|Ga0209814_10135464 | Not Available | 1053 | Open in IMG/M |
| 3300027873|Ga0209814_10402167 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300028145|Ga0247663_1089251 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
| 3300028782|Ga0307306_10195348 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
| 3300028784|Ga0307282_10494994 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300031366|Ga0307506_10154666 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 808 | Open in IMG/M |
| 3300031421|Ga0308194_10112244 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 799 | Open in IMG/M |
| 3300031716|Ga0310813_10822874 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 837 | Open in IMG/M |
| 3300032012|Ga0310902_10277990 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 1021 | Open in IMG/M |
| 3300034149|Ga0364929_0294834 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 553 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 17.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 6.00% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.00% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 4.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 4.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.00% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.00% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.00% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 1.00% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1 | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300023072 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S151-409C-6 | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027723 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028145 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK04 | Environmental | Open in IMG/M |
| 3300028782 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300031366 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300034149 | Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F14TC_1017699611 | 3300000559 | Soil | EFFNVFNQVNFDIPNTAVNNQATLGRITXXXXXXXDPRILQFGLKFVF* |
| Ga0062589_1019605982 | 3300004156 | Soil | TSSYVQAKVEFFNIFNMVNLDIPNTAVNNQATLGRITRTDPSSGDPRILQFGLKFVF* |
| Ga0066676_107827452 | 3300005186 | Soil | NLNVPNTAVNNQATLGRITTTDPGSGDPRILQFGLKFVF* |
| Ga0066388_1053822422 | 3300005332 | Tropical Forest Soil | RVEFFNIFNQVNFDIPNVAVNNQATLGRITRTDPANPDPRILQFGLKFVF* |
| Ga0068868_1005988822 | 3300005338 | Miscanthus Rhizosphere | ASSYVQARVEFFNIFNQVNLDNPNTAVNNQATLGRITQTLAGGLGDPRILQFGLKFVF* |
| Ga0070687_1003166501 | 3300005343 | Switchgrass Rhizosphere | FNSSSYVQARVEFFNIFNQVNLDIPNTAVNNPATLGRITRTDPGSGDPRILQFGLKLVF* |
| Ga0066686_106486122 | 3300005446 | Soil | RVEFFNFFNQVNLDIPNTAVNNQSTLGRITRTDPSSGDPRILQFGLKLVF* |
| Ga0066689_105750352 | 3300005447 | Soil | IFNMVNFDLPGRAANNTASLGRITQTDLSTNGDPRIVQFGLKFVF* |
| Ga0070685_106958991 | 3300005466 | Switchgrass Rhizosphere | SYVQARVEFFNIFNQVNLDNPNTAVNNQATLGRITQTLAGGLGDPRILQFGLKFVF* |
| Ga0070698_1001045414 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | FNVFNMVNYDIPNTAVNNLATLGRITRTDPSSGDPRILQFGLKLVF* |
| Ga0070698_1015695782 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VEFFNIFNQVNLDIPNTAVNNQATLGRITRTDPSSGDPRILQFGLKFVF* |
| Ga0070697_1017823381 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | RVEFFNVFNQVNFDVPNTAVNNQATLGRITRTDPNSGDPRVLQFGLKFVF* |
| Ga0068853_1021996102 | 3300005539 | Corn Rhizosphere | EFFNVFNQVNFDVPNTAVNNQATLGRITRTDPGSGDPRILQFGLKVVF* |
| Ga0070695_1012905042 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | FNMVNLDIPNTAVNNQATLGRITRTDPSSGDPRILQFGLKFVF* |
| Ga0070696_1002976441 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | IFNQVNFDIPNTAVNNPATLGRITRTDPGSGDPRILQFGLKFVF* |
| Ga0070704_1015985703 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | VEFFNIFNQVNFDIPNVAVNNAATLGRITRTDPSSVDPRILQFGLKFVF* |
| Ga0066698_103028452 | 3300005558 | Soil | EFFNIFNMVNFGLLGMSANNTASFGRIIGVDGDLGDPRIIQFGLKFVF* |
| Ga0066700_108692561 | 3300005559 | Soil | DLPARAANNTASLGRITQTDLSTNGDPRIVQFGLKFVF* |
| Ga0066703_102756942 | 3300005568 | Soil | MINLDIPNTAVNNQSTLGRITRTDPISGDPRILQFGLKFVF* |
| Ga0070702_1016490052 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | HLNTSSYVQAKVEFFNIFNMINLDIPNTAVNNQATLGRITRTDPSSGDPRILQFGLKFVF |
| Ga0068859_1001479062 | 3300005617 | Switchgrass Rhizosphere | IFNQVNLDNPNTAVNNQATLGRITQTLAGGLGDPRILQFGLKFVF* |
| Ga0068861_1002703113 | 3300005719 | Switchgrass Rhizosphere | FNSSSYVQMRVEFFNIFNQVNLDIPNTAVNNQATLGRITRTDPGSGDPRILQFGLKFVF* |
| Ga0068861_1023011761 | 3300005719 | Switchgrass Rhizosphere | VNFDVPNNAVNNQATLGRITRTDPSSGDPRILQFGLKFVF* |
| Ga0066652_1010987951 | 3300006046 | Soil | RVEFFNIFNQVNLNVPNTATNNAATLGRITSTDPGSGDPRILQFGLKFVF* |
| Ga0075417_100152143 | 3300006049 | Populus Rhizosphere | DIPNTAVNNQATLGRITRTDTSSGDPRILQFGLKFVF* |
| Ga0075417_106363592 | 3300006049 | Populus Rhizosphere | VEFFNIFNQVNFDIPNTAVNNQATLGRITRTDPSSGDPRILQFGLKFVF* |
| Ga0066665_115545022 | 3300006796 | Soil | NFDLPGRAANNTASLGRITQTDPSLGDPRILQFGLKFVF* |
| Ga0066659_115348091 | 3300006797 | Soil | TSVSNAATLGRITTTDGTSNGNQGDPRIIQFGLKFVF* |
| Ga0075433_103206693 | 3300006852 | Populus Rhizosphere | EFFNIFNQVNFDIPNTAVSNQSTLGRITRTDPSSGDPRILQFGLKFVF* |
| Ga0075425_1000718614 | 3300006854 | Populus Rhizosphere | VFNHVNLDIPNTAVNNQATLGRITRTDPSSGDPRILQFGLKFLF* |
| Ga0075426_103109732 | 3300006903 | Populus Rhizosphere | DVPNTAVNNQATLGRITRTDPNSGDPRILQFGLKVVF* |
| Ga0075426_115680051 | 3300006903 | Populus Rhizosphere | DIPNTAVNNQATLGRITRTDPGSGDPRILQFGLKVVF* |
| Ga0075424_1012057052 | 3300006904 | Populus Rhizosphere | EFFNVFNQVNFDVPNTAVNNQATLGRITRTDPSSGDPRVLQFGLKFVF* |
| Ga0075419_108554122 | 3300006969 | Populus Rhizosphere | FNIFNQVNLDVPNTAVNNQATLGRITRTDPGSGDPRILQFGLKFVF* |
| Ga0075435_1018287702 | 3300007076 | Populus Rhizosphere | VEFFNIFNMVNLDVPNTAVNNQATLGRITRTDPSSGDPRILQFGLKVVF* |
| Ga0099830_108076722 | 3300009088 | Vadose Zone Soil | EFFNVFNQVNFDVPNTAVNNQSTLGRITRTDPSSGDPRILQFGLKFVF* |
| Ga0099828_112067622 | 3300009089 | Vadose Zone Soil | GSSYVQARVEFFNIFNQVNFDIPNTAVNNQATLGRITRTDPGSGDPRIPQFGLKFVF* |
| Ga0111539_113788082 | 3300009094 | Populus Rhizosphere | FNASSYVQARIEFFNIFNQVNFDIPNTAVNNQATLGRITRTDPSSGDPRILQFGLKFVF* |
| Ga0111539_118935112 | 3300009094 | Populus Rhizosphere | FNIFNQVNFDIPQTNRTSSTFGQITRTDPSFGDPRIIQFGLKFVF* |
| Ga0111539_133946621 | 3300009094 | Populus Rhizosphere | NMVNLDIPNTAVNNQATLGRITRTDPSSGDPRILQFGLKFVF* |
| Ga0114129_111889581 | 3300009147 | Populus Rhizosphere | EFFNVFNQVNLDIPKTAVNNQATLGRITNTDPSSGDPRILQFGLKFLF* |
| Ga0105243_101496101 | 3300009148 | Miscanthus Rhizosphere | NIFNQVNFDIPNTAVNNQATLGRITRTDPGSGDPRILQFGLKFVF* |
| Ga0111538_127607712 | 3300009156 | Populus Rhizosphere | SSYVQARVEFFNIFNQVNLDVPNTATNNQATLGRITRTDPGSGDPRILQFGLKFVF* |
| Ga0075423_120406182 | 3300009162 | Populus Rhizosphere | VQAKVEFFNIFNMVNLDVPNTAVNNQATLGRITRTDPGSGDPRILQFGLKFVF* |
| Ga0105242_124693891 | 3300009176 | Miscanthus Rhizosphere | NPNTAVNNQATLGRITQTLAGGLGDPRILQFGLKFVF* |
| Ga0105248_133186231 | 3300009177 | Switchgrass Rhizosphere | FFNIFNQVNLDVPNTAVNNQATLGRITRTDPGSGDPRILQFGLKLVF* |
| Ga0105249_107159151 | 3300009553 | Switchgrass Rhizosphere | KVEFFNIFNMVNLDIPNTAVNNQATLGRITRTDPGSGDPRILQFGLKFVF* |
| Ga0134082_105178361 | 3300010303 | Grasslands Soil | QVNLDIPNTAVNNQATLGRITRTDPSSGDPRILQFGLKFLF* |
| Ga0126377_129106921 | 3300010362 | Tropical Forest Soil | NFDVPNTAVNNQATLGRITSTDPGSGGPRILQFGLKFVF* |
| Ga0134126_130190271 | 3300010396 | Terrestrial Soil | NQVNFDVPNTAVNNQATLGRITRTDPGSGDPRILQFGLKVVF* |
| Ga0134127_119195622 | 3300010399 | Terrestrial Soil | VNFDVPNTAVNNQATLGRVTRTDPSSGDPRILQFGLKFTF* |
| Ga0134122_131237431 | 3300010400 | Terrestrial Soil | ASYVQARVEFFNIFNQVNLDVPNTATNNQATLGRITRTDPGSGDPRILQFGLKFVF* |
| Ga0134122_133283092 | 3300010400 | Terrestrial Soil | VEFFNVFNQVNFDIPNTAVNNQATLGRITRTDPNSGDPRILQFGLKYVF* |
| Ga0137391_106307682 | 3300011270 | Vadose Zone Soil | NTAVNNPATLGRITRTDPGSGDPRILQFGLKFVF* |
| Ga0137375_103367031 | 3300012360 | Vadose Zone Soil | NTAVNNQATLGRITRTDPGSGDPRILQFGLKFVF* |
| Ga0137375_105950452 | 3300012360 | Vadose Zone Soil | PNTAVNNQSTLGRITRTDPSSGDPRILQFGLKYVF* |
| Ga0137358_106244261 | 3300012582 | Vadose Zone Soil | NFDVPNTAVNNQATLGRITRTDPSSGDPRILQFGLKLVF* |
| Ga0157288_103541511 | 3300012901 | Soil | FFNIFNMVNLDIPNTAVNNQATLGRITRTDPSSGDPRILQFGLKFVF* |
| Ga0164302_110514842 | 3300012961 | Soil | RVEFFNIFNQVNLDVPNNATNNQATLGRITRTDPGSGDPRILQFGLKFVF* |
| Ga0134110_100044932 | 3300012975 | Grasslands Soil | MVNFDIPNTAVNNPSTLGRITRTDPSSGDPRILQFGLKFVF* |
| Ga0134073_102128822 | 3300015356 | Grasslands Soil | EFFNIFNMVNFDIPNTAVNNPSTLGRITRTDPSSGDPRILQFGLKFVF* |
| Ga0132258_115513984 | 3300015371 | Arabidopsis Rhizosphere | NQVNLDVPNNATNNQATLGRITRTDPGSGDPRILQFGLKFVF* |
| Ga0132258_118852601 | 3300015371 | Arabidopsis Rhizosphere | RVEFFNVFNLVNLDVPNTAVNNQATLGRITRTDPSSGDPRILQFGLKLVF* |
| Ga0184634_103320122 | 3300018031 | Groundwater Sediment | ARIEFFNIFNQVNFDIPNTAVNNQATLGRITRTDPSSGDPRILQFGLKFVF |
| Ga0184625_103459412 | 3300018081 | Groundwater Sediment | MGLSKNFRFNSSSYVQARVEFFNIFNQVNLDVPNTAVNNQATLGRITRTDPGSGDPRILQFGLKFVF |
| Ga0066662_118763192 | 3300018468 | Grasslands Soil | IFNMVNFDLPGRAANNTASLGRITQTDPSLGDPRILQFGLKFVF |
| Ga0173481_104672281 | 3300019356 | Soil | KNFRFNSSSYVQMRVEFFNIFNQVNLDIPNTAVNNQATLGRITRTDPGSGDPRILQFGLKFVF |
| Ga0193751_11136141 | 3300019888 | Soil | IFNQVNFDFPKVAVNNASTLGKIVATDPNSGDPRIIQFGLKFVF |
| Ga0193755_11192531 | 3300020004 | Soil | FNQVNFDVPNNAVNNLSTLGRITRTDPSSGDPRILQFGLKFVF |
| Ga0179594_102987612 | 3300020170 | Vadose Zone Soil | VPNNAVNNLSTLGRITRTDPSSGDPRILQFGLKLVF |
| Ga0247799_10281591 | 3300023072 | Soil | NMVNLDIPNTAVNNQATLGRITRTDPSSGDPRILQFGLKFVF |
| Ga0207697_100952621 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | VSKNFRFNSSSYVQARVEFFNIFNQVNLDIPNTAVNNPATLGRITRTDPGSGDPRILQFGLKLVF |
| Ga0209640_101533033 | 3300025324 | Soil | VEFFNVFNQVNFDHPRNSGENAAVSGANFGRITRTDPSFGDPRIIQFGLKFVF |
| Ga0207681_102484911 | 3300025923 | Switchgrass Rhizosphere | FDVPNTAVNNQATLGRITRTDPGSGDPRILQFGLKVVF |
| Ga0207681_109139423 | 3300025923 | Switchgrass Rhizosphere | KVEFFNIFNMVNLDIPNTAVNNQATLGRITRTDPSSGDPRILKFGLKFVF |
| Ga0207659_110308311 | 3300025926 | Miscanthus Rhizosphere | IPNTAVNNQATLGRITRTDPSSGDPRILQFGLKLVF |
| Ga0207670_101614202 | 3300025936 | Switchgrass Rhizosphere | SKNFRFNSSSYVQARVEFFNIFNQVNLDIPNTAVNNPATLGRITRTDPGSGDPRILQFGLKLVF |
| Ga0207670_106527943 | 3300025936 | Switchgrass Rhizosphere | QARVEFFNIFNQVNLDNPNTAVNNQATLGRITQTLAGGLGDPRILQFGLKFVF |
| Ga0207669_114253631 | 3300025937 | Miscanthus Rhizosphere | RFNASSYVQARVEFFNIFNQVNLDNPNTAVNNQATLGRITQTLAGGLGDPRILQFGLKFV |
| Ga0207711_101053001 | 3300025941 | Switchgrass Rhizosphere | FNIFNQVNLDNPNTAVNNQATLGRITQTLAGGLGDPRILQFGLKFVF |
| Ga0207711_109113362 | 3300025941 | Switchgrass Rhizosphere | FRFNSSSYVHARVEFFNIFNQVNLDIPNNAVNNPATLGRITRTDPGSGDPRILQFGLKFV |
| Ga0207651_105638252 | 3300025960 | Switchgrass Rhizosphere | NFRFNSSSYVQARVEFFNIFNQVNLDIPNTAVNNPATLGRITRTDPGSGDPRILQFGLKLVF |
| Ga0207640_117646312 | 3300025981 | Corn Rhizosphere | VFNQVNFDVPNSAVNNQSTLGRITRTDPGSGDPRILQFGLKFVF |
| Ga0207677_111454131 | 3300026023 | Miscanthus Rhizosphere | QVNLDNPNTAVNNQATLGRITQTLAGGLGDPRILQFGLKFVF |
| Ga0207703_102847061 | 3300026035 | Switchgrass Rhizosphere | FRFNASSYVQARVEFFNIFNQVNLDNPNTAVNNQATLGRITQTLAGGLGDPRILQFGLKFVF |
| Ga0207641_111921621 | 3300026088 | Switchgrass Rhizosphere | RVEFFNIFNQVSLDNPNTAVNNQATLGRITQTLAGGLGDPRILQFGLKFVF |
| Ga0207675_1025715161 | 3300026118 | Switchgrass Rhizosphere | VPNNAVNNQATLGRITRTDPSSGDPRILQFGLKFVF |
| Ga0209131_13875331 | 3300026320 | Grasslands Soil | NVQFRAEIFNIFNQVNFDIPARGANNTSTLGKISQTDPNSGEPRIIQFGLKFVF |
| Ga0209577_100527755 | 3300026552 | Soil | FDIPNTAVNNQSTLGRITRTDPSSGDPRILQFGLKFVF |
| Ga0209703_11850152 | 3300027723 | Freshwater Sediment | FNQVNFDLPNTNVSGGNFGRITRTDPSFGDPRILQFGLKFVF |
| Ga0209814_101354641 | 3300027873 | Populus Rhizosphere | PNTAVNNQATLGRITRTDTSSGDPRILQFGLKFVF |
| Ga0209814_104021672 | 3300027873 | Populus Rhizosphere | RVEFFNIFNQVNFDIPNTAVSNQSTLGRITRTDPSSGDPRILQFGLKFVF |
| Ga0247663_10892511 | 3300028145 | Soil | VEFINVFNLVNFDIPNTAVNNQSTLGRITRTDPGSGDPRILQFGLKVVF |
| Ga0307306_101953481 | 3300028782 | Soil | FNIFNQVNFDVPGTSVSNATTLGKFTATDPNSGDPRIIQFGLKFVF |
| Ga0307282_104949942 | 3300028784 | Soil | PNTAVNNLATLGRITSTDSGSGDPRILQFGLKFVF |
| Ga0307506_101546662 | 3300031366 | Soil | IPNRAVNNQATLGRITATNPDAGDPRIVQFGLKFVF |
| Ga0308194_101122441 | 3300031421 | Soil | NFNVPNTAVNNQATLGRITSTDPGSGDPRILQFGLKFVF |
| Ga0310813_108228741 | 3300031716 | Soil | NIFNMVNLDIPNTAVNNQATLGRITRTDPSSGDPRILQFGLKFVF |
| Ga0310902_102779902 | 3300032012 | Soil | NIFNQVNLDVPNTATNNLATLGRITRTDPGSGDPRILQFGLKFVF |
| Ga0364929_0294834_1_186 | 3300034149 | Sediment | FHFNGSSYVQARVEFFNIFNQVNFDIPNVAVNNAATLGRITRTDPGSGDPRILQFGLKFV |
| ⦗Top⦘ |