


| Basic Information | |
|---|---|
| Family ID | F104637 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 100 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MILSNRFWRSVTWLVRLDMAIGIAIAVGLLLWLMWH |
| Number of Associated Samples | 83 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 64.00 % |
| % of genes near scaffold ends (potentially truncated) | 21.00 % |
| % of genes from short scaffolds (< 2000 bps) | 75.00 % |
| Associated GOLD sequencing projects | 77 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (73.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (14.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (58.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.12% β-sheet: 0.00% Coil/Unstructured: 46.88% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF13510 | Fer2_4 | 45.00 |
| PF11695 | DUF3291 | 30.00 |
| PF10589 | NADH_4Fe-4S | 10.00 |
| PF01257 | 2Fe-2S_thioredx | 4.00 |
| PF00146 | NADHdh | 2.00 |
| PF00346 | Complex1_49kDa | 2.00 |
| PF13586 | DDE_Tnp_1_2 | 1.00 |
| PF00662 | Proton_antipo_N | 1.00 |
| PF00420 | Oxidored_q2 | 1.00 |
| PF03129 | HGTP_anticodon | 1.00 |
| PF05853 | BKACE | 1.00 |
| PF13599 | Pentapeptide_4 | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG1905 | NADH:ubiquinone oxidoreductase 24 kD subunit (chain E) | Energy production and conversion [C] | 4.00 |
| COG0649 | NADH:ubiquinone oxidoreductase 49 kD subunit (chain D) | Energy production and conversion [C] | 2.00 |
| COG0650 | Formate hydrogenlyase subunit HyfC | Energy production and conversion [C] | 2.00 |
| COG1005 | NADH:ubiquinone oxidoreductase subunit 1 (chain H) | Energy production and conversion [C] | 2.00 |
| COG1009 | Membrane H+-translocase/NADH:ubiquinone oxidoreductase subunit 5 (chain L)/Multisubunit Na+/H+ antiporter, MnhA subunit | Energy production and conversion [C] | 2.00 |
| COG3261 | Ni,Fe-hydrogenase III large subunit | Energy production and conversion [C] | 2.00 |
| COG0124 | Histidyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 1.00 |
| COG0423 | Glycyl-tRNA synthetase, class II | Translation, ribosomal structure and biogenesis [J] | 1.00 |
| COG0441 | Threonyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 1.00 |
| COG0442 | Prolyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 1.00 |
| COG3246 | Uncharacterized conserved protein, DUF849 family | Function unknown [S] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 76.00 % |
| Unclassified | root | N/A | 24.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090014|GPIPI_16552640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 1605 | Open in IMG/M |
| 2088090014|GPIPI_16744911 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 6716 | Open in IMG/M |
| 2124908045|KansclcFeb2_ConsensusfromContig577180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 801 | Open in IMG/M |
| 2228664022|INPgaii200_c0993586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 819 | Open in IMG/M |
| 3300000655|AF_2010_repII_A100DRAFT_1042951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 816 | Open in IMG/M |
| 3300000837|AP72_2010_repI_A100DRAFT_1001038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4198 | Open in IMG/M |
| 3300001867|JGI12627J18819_10228356 | Not Available | 750 | Open in IMG/M |
| 3300004479|Ga0062595_100807845 | Not Available | 774 | Open in IMG/M |
| 3300005175|Ga0066673_10533071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 689 | Open in IMG/M |
| 3300005332|Ga0066388_101739484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1105 | Open in IMG/M |
| 3300005332|Ga0066388_102914887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 874 | Open in IMG/M |
| 3300005332|Ga0066388_103091987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 850 | Open in IMG/M |
| 3300005332|Ga0066388_105658377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 632 | Open in IMG/M |
| 3300005332|Ga0066388_107119450 | Not Available | 562 | Open in IMG/M |
| 3300005347|Ga0070668_101336797 | Not Available | 652 | Open in IMG/M |
| 3300005356|Ga0070674_101523835 | Not Available | 601 | Open in IMG/M |
| 3300005363|Ga0008090_10089725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5041 | Open in IMG/M |
| 3300005434|Ga0070709_10304710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1164 | Open in IMG/M |
| 3300005437|Ga0070710_10057962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2196 | Open in IMG/M |
| 3300005439|Ga0070711_101629771 | Not Available | 564 | Open in IMG/M |
| 3300005541|Ga0070733_10039738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodovulum → unclassified Rhodovulum → Rhodovulum sp. | 2937 | Open in IMG/M |
| 3300005545|Ga0070695_100478970 | Not Available | 959 | Open in IMG/M |
| 3300005561|Ga0066699_11206437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 519 | Open in IMG/M |
| 3300005587|Ga0066654_10719004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 561 | Open in IMG/M |
| 3300005713|Ga0066905_100665488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 889 | Open in IMG/M |
| 3300005713|Ga0066905_100707345 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 865 | Open in IMG/M |
| 3300005713|Ga0066905_100941477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 758 | Open in IMG/M |
| 3300005764|Ga0066903_100128938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3549 | Open in IMG/M |
| 3300005764|Ga0066903_106212707 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 624 | Open in IMG/M |
| 3300005764|Ga0066903_106838262 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 592 | Open in IMG/M |
| 3300005764|Ga0066903_107702552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 554 | Open in IMG/M |
| 3300005921|Ga0070766_10776446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 652 | Open in IMG/M |
| 3300005937|Ga0081455_10063967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3084 | Open in IMG/M |
| 3300005981|Ga0081538_10026628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4038 | Open in IMG/M |
| 3300005983|Ga0081540_1007665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 7656 | Open in IMG/M |
| 3300006163|Ga0070715_10001746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 6467 | Open in IMG/M |
| 3300006852|Ga0075433_10080458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2872 | Open in IMG/M |
| 3300006854|Ga0075425_101062663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 923 | Open in IMG/M |
| 3300006871|Ga0075434_100095610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | 2976 | Open in IMG/M |
| 3300006953|Ga0074063_10138706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1816 | Open in IMG/M |
| 3300006954|Ga0079219_10110940 | Not Available | 1373 | Open in IMG/M |
| 3300009147|Ga0114129_10259710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2329 | Open in IMG/M |
| 3300009683|Ga0116224_10322734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 734 | Open in IMG/M |
| 3300009792|Ga0126374_10014277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3262 | Open in IMG/M |
| 3300009792|Ga0126374_10758613 | Not Available | 736 | Open in IMG/M |
| 3300010046|Ga0126384_11366244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 659 | Open in IMG/M |
| 3300010046|Ga0126384_11403593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 651 | Open in IMG/M |
| 3300010303|Ga0134082_10547399 | Not Available | 509 | Open in IMG/M |
| 3300010359|Ga0126376_13221122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 505 | Open in IMG/M |
| 3300010362|Ga0126377_12485231 | Not Available | 594 | Open in IMG/M |
| 3300010366|Ga0126379_11474014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 786 | Open in IMG/M |
| 3300010376|Ga0126381_100162418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | 2947 | Open in IMG/M |
| 3300010376|Ga0126381_100242251 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Diptera → Nematocera → Culicomorpha → Culicoidea → Culicidae → Anophelinae → Anopheles → Anopheles → Angusticorn → Anopheles → maculipennis group → maculipennis species complex → Anopheles atroparvus | 2438 | Open in IMG/M |
| 3300010398|Ga0126383_13061789 | Not Available | 546 | Open in IMG/M |
| 3300010880|Ga0126350_10904363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 628 | Open in IMG/M |
| 3300012201|Ga0137365_10055324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2999 | Open in IMG/M |
| 3300012202|Ga0137363_11211143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 642 | Open in IMG/M |
| 3300012204|Ga0137374_10047049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 4489 | Open in IMG/M |
| 3300012212|Ga0150985_118175079 | Not Available | 575 | Open in IMG/M |
| 3300012350|Ga0137372_10160992 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Diptera → Nematocera → Culicomorpha → Culicoidea → Culicidae → Anophelinae → Anopheles → Anopheles → Angusticorn → Anopheles → maculipennis group → maculipennis species complex → Anopheles atroparvus | 1825 | Open in IMG/M |
| 3300012361|Ga0137360_10150745 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1842 | Open in IMG/M |
| 3300012957|Ga0164303_10098381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1442 | Open in IMG/M |
| 3300012971|Ga0126369_10802056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1024 | Open in IMG/M |
| 3300012971|Ga0126369_11044135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 906 | Open in IMG/M |
| 3300013306|Ga0163162_13260155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 520 | Open in IMG/M |
| 3300015371|Ga0132258_10656160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2638 | Open in IMG/M |
| 3300018433|Ga0066667_10674190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 866 | Open in IMG/M |
| 3300021168|Ga0210406_11046267 | Not Available | 604 | Open in IMG/M |
| 3300021432|Ga0210384_10437508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1178 | Open in IMG/M |
| 3300021478|Ga0210402_10008640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 8870 | Open in IMG/M |
| 3300021560|Ga0126371_10137848 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2487 | Open in IMG/M |
| 3300021560|Ga0126371_11176132 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 904 | Open in IMG/M |
| 3300025898|Ga0207692_10080668 | Not Available | 1739 | Open in IMG/M |
| 3300025906|Ga0207699_10045740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2556 | Open in IMG/M |
| 3300025929|Ga0207664_10165348 | Not Available | 1890 | Open in IMG/M |
| 3300025939|Ga0207665_10116027 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1887 | Open in IMG/M |
| 3300025972|Ga0207668_11164828 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 692 | Open in IMG/M |
| 3300026118|Ga0207675_102192427 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 568 | Open in IMG/M |
| 3300027605|Ga0209329_1154638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 504 | Open in IMG/M |
| 3300027646|Ga0209466_1047477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 869 | Open in IMG/M |
| 3300027696|Ga0208696_1047371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1513 | Open in IMG/M |
| 3300027867|Ga0209167_10807580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 511 | Open in IMG/M |
| 3300028793|Ga0307299_10249956 | Not Available | 666 | Open in IMG/M |
| 3300028881|Ga0307277_10000073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 29909 | Open in IMG/M |
| 3300031543|Ga0318516_10140853 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1382 | Open in IMG/M |
| 3300031543|Ga0318516_10171538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1248 | Open in IMG/M |
| 3300031544|Ga0318534_10100724 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 1653 | Open in IMG/M |
| 3300031561|Ga0318528_10452389 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 689 | Open in IMG/M |
| 3300031723|Ga0318493_10292396 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 877 | Open in IMG/M |
| 3300031763|Ga0318537_10170130 | Not Available | 811 | Open in IMG/M |
| 3300031770|Ga0318521_10827914 | Not Available | 564 | Open in IMG/M |
| 3300031795|Ga0318557_10313181 | Not Available | 720 | Open in IMG/M |
| 3300031820|Ga0307473_10495818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae | 823 | Open in IMG/M |
| 3300031821|Ga0318567_10180374 | Not Available | 1175 | Open in IMG/M |
| 3300031823|Ga0307478_10362494 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1196 | Open in IMG/M |
| 3300031897|Ga0318520_10277562 | Not Available | 1005 | Open in IMG/M |
| 3300031912|Ga0306921_10152066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2709 | Open in IMG/M |
| 3300031912|Ga0306921_12085275 | Not Available | 601 | Open in IMG/M |
| 3300032042|Ga0318545_10337169 | Not Available | 542 | Open in IMG/M |
| 3300032828|Ga0335080_10232458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2019 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 14.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 13.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.00% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.00% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.00% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.00% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 2.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.00% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.00% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.00% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.00% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.00% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
| 3300000837 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100 | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027605 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027696 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPIPI_03516820 | 2088090014 | Soil | MSDGLKTMILSNRFWRSVTWLVRLDMAVGIAIAVALLLWLMWX |
| GPIPI_01022660 | 2088090014 | Soil | MSDGLKTMILSNRFWRSVTWLVRLDMAVGIAIAVALLLWLMW |
| KansclcFeb2_01266830 | 2124908045 | Soil | MTLSDRFWRSVTLLVRLDMAAGIAITVGLMFWLMWH |
| INPgaii200_09935861 | 2228664022 | Soil | MSRSDRFWRGVTLLVRLDMAAGIAIAAGLLLVLVLVWH |
| AF_2010_repII_A100DRAFT_10429512 | 3300000655 | Forest Soil | MSXSDRFWRSVTLLVRLDMAACIAIAAGLLLVLVWH* |
| AP72_2010_repI_A100DRAFT_10010387 | 3300000837 | Forest Soil | MTLSDRFWRSVTLLVRLDMAAGIAITAGLVFWLMWH* |
| JGI12627J18819_102283561 | 3300001867 | Forest Soil | KTMILSNRFWRSVTWLVRLDMAVGIAIAVALLLWLMWH* |
| Ga0062595_1008078451 | 3300004479 | Soil | VESSALRMSDGLKTMILSNRFWRSVTWLVRLDMAVGIAIAVALLLWLMWH* |
| Ga0066673_105330712 | 3300005175 | Soil | MSEGPRTMILSNRFWRSVTWWVRLDMAICIAIAVGLLLWLMWH* |
| Ga0066388_1017394841 | 3300005332 | Tropical Forest Soil | MSEGQRTMILSNRFWRSVTWLVRLDMAIGIAIAVGLLLWLMWH* |
| Ga0066388_1029148872 | 3300005332 | Tropical Forest Soil | MSHGQMTMILSNRFWRSITWLVRLDIAASIVIAVGLLLWLMWH* |
| Ga0066388_1030919872 | 3300005332 | Tropical Forest Soil | LEGEERGMTRQEQERATMLSHRFWRTLTCLVRLDMAAGIILAVGLLLWLKWH* |
| Ga0066388_1056583772 | 3300005332 | Tropical Forest Soil | MSHGLMTMVLSNRFWRSMTWLVRLDIAASIVIAVGLLLWLMWH* |
| Ga0066388_1071194502 | 3300005332 | Tropical Forest Soil | MSAGLRTMILSNRLWRSVTWLVRLDMAMCIAVAVGLLLWLMWH* |
| Ga0070668_1013367972 | 3300005347 | Switchgrass Rhizosphere | MSDGLKTMILSNRFWRSVTWLVRLDMAVGIAIAVALLLWLMWP* |
| Ga0070674_1015238352 | 3300005356 | Miscanthus Rhizosphere | MSDGPKTMILSNRFWRSVTWLVRLDMAVGIVIAAALLLWLMWH* |
| Ga0008090_100897255 | 3300005363 | Tropical Rainforest Soil | MSEGLMTMIPSNRFWRSVTWLVRLDMAICIAIAVGLPLWLMWH* |
| Ga0070709_103047102 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDGLKTMILSNRFWRSVTWLVRLDMAVGIAIAVALLLWLMWH* |
| Ga0070710_100579622 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDGPKTMILSNRFWRSVTWLVRLDMAVGIAIAVALLLWLMWH* |
| Ga0070711_1016297711 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VESSALRMSDGPKTMILSNRFWRSVTWLVRLDMAVGIVIAAALLLWLMWH* |
| Ga0070733_100397382 | 3300005541 | Surface Soil | VATIISRRFWRTITLSVRLDIAAGIATTAGLLLWLTWH* |
| Ga0070695_1004789702 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MRVGEAITMTRMAGFWRALGLLVRLDMAAGIAITAALLLWLTWH* |
| Ga0066699_112064372 | 3300005561 | Soil | MILSNRFWRSVTWWVRLDMAICIAIAVGLLLWLMWH* |
| Ga0066654_107190042 | 3300005587 | Soil | MILSNRFWRSVTWLVRLDIAVCIAIAVGLPLWLVWH* |
| Ga0066905_1006654882 | 3300005713 | Tropical Forest Soil | MILSDRFWRSVTVMVRLDMAAGIAVAAGLLLWLMWH* |
| Ga0066905_1007073452 | 3300005713 | Tropical Forest Soil | MTPSDRFWRSVTLLVRLDMAAGIAITAGLVFWLMWH* |
| Ga0066905_1009414772 | 3300005713 | Tropical Forest Soil | MMTVSDRFWRSVTLLVRLDMAAGIAITAGLMFWLMWH* |
| Ga0066903_1001289382 | 3300005764 | Tropical Forest Soil | MTPSNRFWRGITWLVRLDIAVCIAIAAGLLLWLKWH* |
| Ga0066903_1062127072 | 3300005764 | Tropical Forest Soil | MESGALRMSAGPRTMILSNRFWRSVTWLVRLDMAIGIAIAVGLLLWLMWH* |
| Ga0066903_1068382622 | 3300005764 | Tropical Forest Soil | MSEGLRTMILSNPFWRSVTWLVRLDMANGHVHRLAVGLLLWLMWH* |
| Ga0066903_1077025522 | 3300005764 | Tropical Forest Soil | MTLSDRFWRSVILLVRLDMAAGIAITAGPVFWLMWH* |
| Ga0070766_107764462 | 3300005921 | Soil | VATTISRRFWRTITLSVRLDIAAGIATTAGLLLWLTWH* |
| Ga0081455_100639672 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MTRQNVNELMMLSHRFWHRLTWLVRLDMAAGIALAVGLLLWLKWH* |
| Ga0081538_100266282 | 3300005981 | Tabebuia Heterophylla Rhizosphere | MTRQNVNELMMLSHRFWHRLAWLVRLDMAVGIALAVGLLLWLKWH* |
| Ga0081540_10076651 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MESGALRVSDGLRTMILSNPFWRSATWLVRLDIAASIVIAAGL |
| Ga0070715_100017463 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MILSNRFWRSVTWLVRLDMAVGIAIAVALLLWLMWH* |
| Ga0075433_100804584 | 3300006852 | Populus Rhizosphere | MSRSDRFWRGVTLLVLLDMAAGIAIAAGLLLVLVWH* |
| Ga0075425_1010626632 | 3300006854 | Populus Rhizosphere | MSEGLRAMILSNRFWRNVTWLVRLDMAICIAIAAGLLLWLTWH* |
| Ga0075434_1000956102 | 3300006871 | Populus Rhizosphere | MSEGLRAMILSNRFWRNVTWLVRLDMAICIVIPAGLLLWLMWH* |
| Ga0074063_101387062 | 3300006953 | Soil | MIRSDRFWRGVTLLVRLDMAAGIAIAAGLLLVLVWH* |
| Ga0079219_101109402 | 3300006954 | Agricultural Soil | MNQGLRAMILSNRFWRNVTWLVRLDMAICIVIPAGLLLWLMWH* |
| Ga0114129_102597102 | 3300009147 | Populus Rhizosphere | MILSNRFWRSVTWLVRLDMAVGIVIAAALLLWLMWH* |
| Ga0116224_103227342 | 3300009683 | Peatlands Soil | MIVSGRFWRGLTLLARADMAASIAIAAGLLLWLTWHS* |
| Ga0126374_100142773 | 3300009792 | Tropical Forest Soil | MSRSDRFWRGVTLLVRLDMAAGIAIAAGLLLVLVWH* |
| Ga0126374_107586132 | 3300009792 | Tropical Forest Soil | MEKGALRMSHGLMTMVLSNRFWRSMTWLVRLDIAASIVIAVGLLLWLMWH* |
| Ga0126384_113662442 | 3300010046 | Tropical Forest Soil | MVVSKRFWRSITLVVRLDIAACIAIAAGLLLWLTWD* |
| Ga0126384_114035932 | 3300010046 | Tropical Forest Soil | MTISPRFWRVATLLVRLDIATGILLATGLWLWLTWH* |
| Ga0134082_105473991 | 3300010303 | Grasslands Soil | MESGALRMNDGPRTTILSNRFWRSVTWWVRLDMAICIAIAVGLLLWLMWH* |
| Ga0126376_132211222 | 3300010359 | Tropical Forest Soil | MTVSSRFWRAVTLLVRLDMAAGITIAAALFLFLTWR* |
| Ga0126377_124852312 | 3300010362 | Tropical Forest Soil | MTISPRFWRAVTLLVRLDVAAGIAIAAALFLFVTWH* |
| Ga0126379_114740142 | 3300010366 | Tropical Forest Soil | MTLSDRFWRSVTVLVRLDMAAGIAIAAGLLLWLMWH* |
| Ga0126381_1001624184 | 3300010376 | Tropical Forest Soil | MESGALRMSEGLMTMIPSNRFWRSVTWLVRLDMAICIAIAVGLPLWLMWH* |
| Ga0126381_1002422511 | 3300010376 | Tropical Forest Soil | MAISPRFWRAATLLVRLDMAAGITLAAALLLFLTWH* |
| Ga0126383_130617891 | 3300010398 | Tropical Forest Soil | MSGSDRFWRSVTLLVRLDMAACIAIAAGLLLVLVWH* |
| Ga0126350_109043632 | 3300010880 | Boreal Forest Soil | MRVTPRFWRSVTLLVRLDMAACITLAAALFLFSTWH* |
| Ga0137365_100553242 | 3300012201 | Vadose Zone Soil | MTLSDRLWRSVTVLVRLDMAAGIAIAAGLVLWLMWH* |
| Ga0137363_112111432 | 3300012202 | Vadose Zone Soil | MTLSDRFWRSVTVVVRLDMAAGIAIAAGLLLWLMWH* |
| Ga0137374_100470492 | 3300012204 | Vadose Zone Soil | MTLSDWLWRSVTVLVRLDMAAGIAIAAGLVLWLMWH* |
| Ga0150985_1181750791 | 3300012212 | Avena Fatua Rhizosphere | ASWTPRLWRGLTLLVRLDIAASVTMTAALLLWLTWH* |
| Ga0137372_101609922 | 3300012350 | Vadose Zone Soil | VRTMTLSDRLWRSVTVLVRLDMAAGIAIAAGLVLWLMWH* |
| Ga0137360_101507453 | 3300012361 | Vadose Zone Soil | MTLSDRLWRSVTVFVRLDMAAGIAIAAGLVLWLMWH* |
| Ga0164303_100983813 | 3300012957 | Soil | MSDGPKTMILSNRFWRSVTWLVRLDMAVGIAIAVALLLWLMW |
| Ga0126369_108020562 | 3300012971 | Tropical Forest Soil | MESGALRMSAGLRTMILSNRLWRSVTWLVRLDMAMCIAVAVGLLLWLMWH* |
| Ga0126369_110441352 | 3300012971 | Tropical Forest Soil | MVVSKRFWRSITLLVRLDIAACIAIAAGLLLWLTWD* |
| Ga0163162_132601552 | 3300013306 | Switchgrass Rhizosphere | MESGALRVSDGLRTLILSNRFWRNVTWLVQLDMAVCIAITVGLLLWLMWH* |
| Ga0132258_106561603 | 3300015371 | Arabidopsis Rhizosphere | MSEGLRAMILSNRFWRNVTWLVPLDMAICIVIAAGLLLWLMWH* |
| Ga0066667_106741903 | 3300018433 | Grasslands Soil | MILSNRFWRSVTWWVRLDMAICIAIAVGLLLWLMWH |
| Ga0210406_110462672 | 3300021168 | Soil | MESGALRVSDGPMTMILSNRFWRSVTWLVRLDIAASIVIAVGLLLWLMWH |
| Ga0210384_104375081 | 3300021432 | Soil | MESGALRVSDGPMTMILSNRFWRSVTWLVRLDIAASIVIAVGLLL |
| Ga0210402_100086405 | 3300021478 | Soil | MTMILSNRFWRSVTWLVRLDIAASIVIAVGLLLWLMWH |
| Ga0126371_101378484 | 3300021560 | Tropical Forest Soil | MILSNRFWRSVTWLVRLDMAIGIAIAVGLLLWLMWH |
| Ga0126371_111761323 | 3300021560 | Tropical Forest Soil | MTLSDRFWRSVTVLVRLDMAAGIAIAAGLLLWLMWH |
| Ga0207692_100806681 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | LKTMILSNRFWRSVTWLVRLDMAVGIAIAVALLLWLMWH |
| Ga0207699_100457404 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MILSNRFWRSVTWLVRLDMAVGIAIAVALLLWLMWH |
| Ga0207664_101653482 | 3300025929 | Agricultural Soil | RMSDGPKTMILSNRFWRSVTWLVRLDMAVGIAIAVALLLWLMWH |
| Ga0207665_101160273 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDALKTMILSNRFWRSVTWLVRLDMAVGIAIAVALLLWLMWH |
| Ga0207668_111648282 | 3300025972 | Switchgrass Rhizosphere | MSDGLKTMILSNRFWRSVTWLVRLDMAVGIAIAVALLLWLMWP |
| Ga0207675_1021924272 | 3300026118 | Switchgrass Rhizosphere | MSDGLKTMILSNRFWRSVTWLVRLDMAVGIVIAAALLLWLMWH |
| Ga0209329_11546382 | 3300027605 | Forest Soil | MIRSDWFWRGVTLLVRLDMAAGIAIAAGLLLVLVWH |
| Ga0209466_10474772 | 3300027646 | Tropical Forest Soil | MTLSDRFWRSVTLLVRLDMAAGIAITAGLVFWLMWH |
| Ga0208696_10473712 | 3300027696 | Peatlands Soil | MIVSGRFWRGLTLLARADMAASIAIAAGLLLWLTWHS |
| Ga0209167_108075802 | 3300027867 | Surface Soil | VATIISRGFWRTITLSVRLDIAAGIATTAGLLLWLTWH |
| Ga0307299_102499561 | 3300028793 | Soil | CKVVESSALRMSDGLKTMILSNRFWRSVTWSVRLDMAVGIAIAVALLLWLMWH |
| Ga0307277_1000007322 | 3300028881 | Soil | MSDGAKTMILSNRFWRSVTWLVRLDMAVGIAIAVALLLWLMWH |
| Ga0318516_101408532 | 3300031543 | Soil | MTLSHRFWRSITVLVRLDMAAGIAIAAGLVFWLMWH |
| Ga0318516_101715382 | 3300031543 | Soil | MSRSDRFWRSVTLLVRLDMAAGIAIAAGLLLVLVWH |
| Ga0318534_101007242 | 3300031544 | Soil | MSRSDRFWRGVTLLVRLDMAAGIAIAAGLLLVLVWH |
| Ga0318528_104523891 | 3300031561 | Soil | RNGARRMSRSDRFWRSVTLLVRLDMAAGIAIAAGLLLVLVWH |
| Ga0318493_102923963 | 3300031723 | Soil | MSRSDRFWRSVTLLVRLDMAACIAIAAGLLLVLVW |
| Ga0318537_101701302 | 3300031763 | Soil | RDGARTMTLSHRFWRSITVLVRLDMAAGIAIAAGLVFWLMWH |
| Ga0318521_108279141 | 3300031770 | Soil | TLSHRFWRSITVLVRLDMAAGIAIAAGLVFWLMWH |
| Ga0318557_103131812 | 3300031795 | Soil | ARTMTLSHRFWRSITVLVRLDMAAGIAIAAGLVFWLMWH |
| Ga0307473_104958182 | 3300031820 | Hardwood Forest Soil | MSDGLKTMILSNRFWRSVTWLVRLDMAVGIAIAVALLLWLM |
| Ga0318567_101803741 | 3300031821 | Soil | RMSRSDRFWRGVTLLVRLDMAAGIAIAAGLLLVLVWH |
| Ga0307478_103624942 | 3300031823 | Hardwood Forest Soil | MTVSRHFWRGLTFLARADMAASVAVAAAPLLWLTWHS |
| Ga0318520_102775621 | 3300031897 | Soil | SRSDRFWRGVTLLVRLDMAAGIAIAAGLLLVLVWH |
| Ga0306921_101520661 | 3300031912 | Soil | TMTLSHRFWRSITVLVRLDMAAGIAIAAGLVFWLMWH |
| Ga0306921_120852752 | 3300031912 | Soil | MTLSDRFWRSVILLVRLDMAAGIAITAGPVFWLMWH |
| Ga0318545_103371691 | 3300032042 | Soil | RTMTLSHRFWRSITVLVRLDMAAGIAIAAGLVFWLMWH |
| Ga0335080_102324582 | 3300032828 | Soil | MRVTSRFWRSVTLLVRLDIAASIALAAALFLFSTWH |
| ⦗Top⦘ |