


| Basic Information | |
|---|---|
| Family ID | F104632 |
| Family Type | Metagenome |
| Number of Sequences | 100 |
| Average Sequence Length | 51 residues |
| Representative Sequence | MLAGAMVAFSGLCIVLVRVFGVPEYGVLLAVGIGLIALGLVRRFTHKDHD |
| Number of Associated Samples | 85 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 44.44 % |
| % of genes near scaffold ends (potentially truncated) | 27.00 % |
| % of genes from short scaffolds (< 2000 bps) | 81.00 % |
| Associated GOLD sequencing projects | 75 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand (18.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (37.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.13% β-sheet: 0.00% Coil/Unstructured: 44.87% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF01557 | FAA_hydrolase | 41.00 |
| PF02585 | PIG-L | 27.00 |
| PF01575 | MaoC_dehydratas | 9.00 |
| PF01039 | Carboxyl_trans | 2.00 |
| PF16363 | GDP_Man_Dehyd | 1.00 |
| PF02776 | TPP_enzyme_N | 1.00 |
| PF00296 | Bac_luciferase | 1.00 |
| PF14437 | MafB19-deam | 1.00 |
| PF00694 | Aconitase_C | 1.00 |
| PF00330 | Aconitase | 1.00 |
| PF09335 | SNARE_assoc | 1.00 |
| PF00211 | Guanylate_cyc | 1.00 |
| PF00383 | dCMP_cyt_deam_1 | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 27.00 |
| COG0777 | Acetyl-CoA carboxylase beta subunit | Lipid transport and metabolism [I] | 2.00 |
| COG0825 | Acetyl-CoA carboxylase alpha subunit | Lipid transport and metabolism [I] | 2.00 |
| COG4799 | Acetyl-CoA carboxylase, carboxyltransferase component | Lipid transport and metabolism [I] | 2.00 |
| COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 1.00 |
| COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 1.00 |
| COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 1.00 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 1.00 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.00 % |
| Unclassified | root | N/A | 2.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000033|ICChiseqgaiiDRAFT_c1847419 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101466129 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 844 | Open in IMG/M |
| 3300000443|F12B_10468071 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 766 | Open in IMG/M |
| 3300000956|JGI10216J12902_108457572 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300002558|JGI25385J37094_10024412 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2150 | Open in IMG/M |
| 3300002560|JGI25383J37093_10083013 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
| 3300002561|JGI25384J37096_10095854 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1045 | Open in IMG/M |
| 3300002561|JGI25384J37096_10105233 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 975 | Open in IMG/M |
| 3300002562|JGI25382J37095_10012920 | All Organisms → cellular organisms → Bacteria | 3160 | Open in IMG/M |
| 3300004281|Ga0066397_10067699 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300004633|Ga0066395_10856323 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300005166|Ga0066674_10165729 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1047 | Open in IMG/M |
| 3300005174|Ga0066680_10179620 | All Organisms → cellular organisms → Bacteria | 1333 | Open in IMG/M |
| 3300005186|Ga0066676_10119337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1624 | Open in IMG/M |
| 3300005294|Ga0065705_10841948 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300005295|Ga0065707_10172468 | All Organisms → cellular organisms → Bacteria | 1474 | Open in IMG/M |
| 3300005332|Ga0066388_100210109 | All Organisms → cellular organisms → Bacteria | 2571 | Open in IMG/M |
| 3300005332|Ga0066388_100351187 | All Organisms → cellular organisms → Bacteria | 2121 | Open in IMG/M |
| 3300005332|Ga0066388_100450571 | All Organisms → cellular organisms → Bacteria | 1928 | Open in IMG/M |
| 3300005518|Ga0070699_100922207 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300005552|Ga0066701_10659377 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300005553|Ga0066695_10285438 | All Organisms → cellular organisms → Bacteria | 1042 | Open in IMG/M |
| 3300005713|Ga0066905_100027313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3172 | Open in IMG/M |
| 3300005713|Ga0066905_101932859 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300005937|Ga0081455_10111187 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2177 | Open in IMG/M |
| 3300006058|Ga0075432_10280997 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300006854|Ga0075425_100305913 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1829 | Open in IMG/M |
| 3300006880|Ga0075429_100066962 | All Organisms → cellular organisms → Bacteria | 3126 | Open in IMG/M |
| 3300007265|Ga0099794_10443297 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 680 | Open in IMG/M |
| 3300009090|Ga0099827_10000450 | All Organisms → cellular organisms → Bacteria | 18475 | Open in IMG/M |
| 3300009100|Ga0075418_11012158 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 899 | Open in IMG/M |
| 3300009137|Ga0066709_101156842 | All Organisms → cellular organisms → Bacteria | 1139 | Open in IMG/M |
| 3300009803|Ga0105065_1005034 | All Organisms → cellular organisms → Bacteria | 1248 | Open in IMG/M |
| 3300009804|Ga0105063_1002072 | All Organisms → cellular organisms → Bacteria | 1816 | Open in IMG/M |
| 3300009813|Ga0105057_1081964 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300009814|Ga0105082_1071763 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300009815|Ga0105070_1008924 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1631 | Open in IMG/M |
| 3300009818|Ga0105072_1027071 | All Organisms → cellular organisms → Bacteria | 1058 | Open in IMG/M |
| 3300009821|Ga0105064_1025484 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1099 | Open in IMG/M |
| 3300009836|Ga0105068_1025952 | All Organisms → cellular organisms → Bacteria | 1011 | Open in IMG/M |
| 3300009837|Ga0105058_1018885 | All Organisms → cellular organisms → Bacteria | 1434 | Open in IMG/M |
| 3300010333|Ga0134080_10025168 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2233 | Open in IMG/M |
| 3300010336|Ga0134071_10225410 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
| 3300010360|Ga0126372_10257943 | All Organisms → cellular organisms → Bacteria | 1501 | Open in IMG/M |
| 3300010868|Ga0124844_1183349 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300012199|Ga0137383_10641750 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300012203|Ga0137399_10096692 | All Organisms → cellular organisms → Bacteria | 2275 | Open in IMG/M |
| 3300012203|Ga0137399_10285396 | All Organisms → cellular organisms → Bacteria | 1361 | Open in IMG/M |
| 3300012206|Ga0137380_10831340 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 796 | Open in IMG/M |
| 3300012349|Ga0137387_10221645 | All Organisms → cellular organisms → Bacteria | 1360 | Open in IMG/M |
| 3300012351|Ga0137386_11236788 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 521 | Open in IMG/M |
| 3300012918|Ga0137396_10343948 | All Organisms → cellular organisms → Bacteria | 1104 | Open in IMG/M |
| 3300012922|Ga0137394_10490458 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
| 3300012925|Ga0137419_10674907 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 836 | Open in IMG/M |
| 3300012944|Ga0137410_10180673 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1624 | Open in IMG/M |
| 3300012944|Ga0137410_10765174 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300012948|Ga0126375_10783034 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 753 | Open in IMG/M |
| 3300015358|Ga0134089_10421024 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 573 | Open in IMG/M |
| 3300015359|Ga0134085_10048517 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1694 | Open in IMG/M |
| 3300015371|Ga0132258_10062399 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8599 | Open in IMG/M |
| 3300015373|Ga0132257_101483712 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300015374|Ga0132255_101751923 | All Organisms → cellular organisms → Bacteria | 943 | Open in IMG/M |
| 3300017656|Ga0134112_10216561 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300017656|Ga0134112_10256702 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300017656|Ga0134112_10517275 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300017997|Ga0184610_1003317 | All Organisms → cellular organisms → Bacteria | 3706 | Open in IMG/M |
| 3300018028|Ga0184608_10203456 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
| 3300018031|Ga0184634_10000282 | All Organisms → cellular organisms → Bacteria | 12452 | Open in IMG/M |
| 3300018077|Ga0184633_10001837 | All Organisms → cellular organisms → Bacteria | 9069 | Open in IMG/M |
| 3300018433|Ga0066667_11615579 | Not Available | 578 | Open in IMG/M |
| 3300019789|Ga0137408_1186771 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 3474 | Open in IMG/M |
| 3300019789|Ga0137408_1282964 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4762 | Open in IMG/M |
| 3300019789|Ga0137408_1301847 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1300 | Open in IMG/M |
| 3300026298|Ga0209236_1234078 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 621 | Open in IMG/M |
| 3300026313|Ga0209761_1081333 | All Organisms → cellular organisms → Bacteria | 1678 | Open in IMG/M |
| 3300027013|Ga0209884_1007073 | All Organisms → cellular organisms → Bacteria | 1023 | Open in IMG/M |
| 3300027324|Ga0209845_1068531 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300027332|Ga0209861_1060790 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300027379|Ga0209842_1035497 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
| 3300027490|Ga0209899_1005290 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2964 | Open in IMG/M |
| 3300027511|Ga0209843_1024410 | All Organisms → cellular organisms → Bacteria | 1149 | Open in IMG/M |
| 3300027561|Ga0209887_1036077 | All Organisms → cellular organisms → Bacteria | 1111 | Open in IMG/M |
| 3300027907|Ga0207428_10407244 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 995 | Open in IMG/M |
| 3300027948|Ga0209858_1008484 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300027954|Ga0209859_1012217 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1627 | Open in IMG/M |
| 3300028792|Ga0307504_10124718 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300031199|Ga0307495_10170076 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300031720|Ga0307469_10085539 | All Organisms → cellular organisms → Bacteria | 2154 | Open in IMG/M |
| 3300031720|Ga0307469_10408838 | All Organisms → cellular organisms → Bacteria | 1161 | Open in IMG/M |
| 3300031720|Ga0307469_10597078 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
| 3300031720|Ga0307469_10696789 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300031720|Ga0307469_11654103 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300031740|Ga0307468_100674145 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
| 3300031820|Ga0307473_10056214 | All Organisms → cellular organisms → Bacteria | 1895 | Open in IMG/M |
| 3300031820|Ga0307473_10534545 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 798 | Open in IMG/M |
| 3300032180|Ga0307471_101644366 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 797 | Open in IMG/M |
| 3300032205|Ga0307472_100351376 | All Organisms → cellular organisms → Bacteria | 1210 | Open in IMG/M |
| 3300034176|Ga0364931_0333778 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300034354|Ga0364943_0209096 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 18.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 16.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 10.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 9.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 8.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 8.00% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.00% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.00% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.00% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.00% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.00% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000443 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemly | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004281 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009803 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_40_50 | Environmental | Open in IMG/M |
| 3300009804 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_30_40 | Environmental | Open in IMG/M |
| 3300009813 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20 | Environmental | Open in IMG/M |
| 3300009814 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 | Environmental | Open in IMG/M |
| 3300009815 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 | Environmental | Open in IMG/M |
| 3300009818 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 | Environmental | Open in IMG/M |
| 3300009821 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 | Environmental | Open in IMG/M |
| 3300009836 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 | Environmental | Open in IMG/M |
| 3300009837 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027013 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027324 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300027332 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027379 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 (SPAdes) | Environmental | Open in IMG/M |
| 3300027490 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027511 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027561 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027948 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_50_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300027954 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300034176 | Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17 | Environmental | Open in IMG/M |
| 3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICChiseqgaiiDRAFT_18474191 | 3300000033 | Soil | MLAGAIVTFSGLCIVLVRVFDVPDWGVLLATGVGLIVLGLVR |
| INPhiseqgaiiFebDRAFT_1014661292 | 3300000364 | Soil | MLAGXIVTFSGLCIVLVRVFXVPDWGVLLXXGVGLIXLGLXRRFTGDPDRR* |
| F12B_104680711 | 3300000443 | Soil | GTIVAFSGLCIVLVRVFGVPDWGVLLVVGFGLIVLGLIRRYTSEGR* |
| JGI10216J12902_1084575721 | 3300000956 | Soil | MLAGSIVTFSGLCIVLVRVFDVPDWGVLLVAGVGLIMLGLIRRFTSGS |
| JGI25385J37094_100244124 | 3300002558 | Grasslands Soil | MVAFSGLCIVLVKVFGVPEYGVLLAVGIGLIALGLVRRFTHKDQNGQ* |
| JGI25383J37093_100830131 | 3300002560 | Grasslands Soil | MLAGAMVAFSGLCIVLVKVFGVPEYGVLLAVGIGLIALGLVRRFTHKDHDGQ* |
| JGI25384J37096_100958541 | 3300002561 | Grasslands Soil | GLMLAGAMVAFSGLCIVLVKVFGVPEYGVLLAVGIGLIALGLVRRFTHKDQNGQ* |
| JGI25384J37096_101052331 | 3300002561 | Grasslands Soil | IAASSSTVARPGTGLILAGAIVAFSGLCIVLVKVFDVPDYGVLLAVGIGLIALGLVRRFTSKDP* |
| JGI25382J37095_100129203 | 3300002562 | Grasslands Soil | MVAFSGLCIVLVKVFGVPEYGVLLAVGIGLIALGLVRRFTHKDHDGQ* |
| Ga0066397_100676992 | 3300004281 | Tropical Forest Soil | MLAGAIVTFSGLCIVLVRVFDVPDWGVLLAAGVGLIVLGLIRRFTSDSGRR* |
| Ga0066395_108563231 | 3300004633 | Tropical Forest Soil | MLAGAIVTFSGLCIVLVRVFDVPDWGVLLATGVGLIVLGLIRRFTGDPSRR* |
| Ga0066674_101657291 | 3300005166 | Soil | GAMIAFAGFCIVLVKVFNVPDYGVLVVVGIGMFGLGLIRRFTSKDQRGDR* |
| Ga0066680_101796202 | 3300005174 | Soil | MVAFSGLCIVLVKVLGVPEYGVLLAVGVGLIALGLVRRFTHKDHDGQ* |
| Ga0066676_101193371 | 3300005186 | Soil | MLAGSIVTFSGLCIVLVRIFGVPDWGVLLVAGVGLIVLGLIRRFTNGPDSR* |
| Ga0065705_108419481 | 3300005294 | Switchgrass Rhizosphere | MLAGAIVTFSGLCIVLVRVFDVPDWGVLLATGVGLIVLGLVRRFTS |
| Ga0065707_101724682 | 3300005295 | Switchgrass Rhizosphere | MLAGAIVTFSGLCIVLVRVFDVPDWGVLLATGVGLIVLGLVRRFTSDSARR* |
| Ga0066388_1002101093 | 3300005332 | Tropical Forest Soil | MLAGSIVTFSGLCIVLVRVFGVPDWGVLLVAGVGLIMLGLIRRFTSGSEGR* |
| Ga0066388_1003511873 | 3300005332 | Tropical Forest Soil | MLAGSIVTFSGVCIVLVRVFGVPDWGVLLVAGLGLIMLGLIRRFTSRSEGR* |
| Ga0066388_1004505712 | 3300005332 | Tropical Forest Soil | MLAGAIVTFSGLCIVLVRIFGVPDWGVLLVAGVGLIVLGLIRRFTGDPSRR* |
| Ga0070699_1009222072 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | VASQPGTGLMLAGAMVAFSGLCIVLVKVLGVPEYGVLLAVGVGLIALGLVRRFTHKDHEGQ* |
| Ga0066701_106593771 | 3300005552 | Soil | MVAGAMVAFSGLCIVLVKVFGVPEYGVLLAVGIGLIALGLVRRFTHKDHD |
| Ga0066695_102854382 | 3300005553 | Soil | MLAGSIVTFSGLCIVLVRVFGVPDWGVLLVAGVGLVVLGLIRRFTNGPDSR* |
| Ga0066905_1000273132 | 3300005713 | Tropical Forest Soil | MLAGSIVTFSGVCIVLVRVFDVPDWGVLLAAGIGLIVLGLVRRFTSGPDRS* |
| Ga0066905_1019328592 | 3300005713 | Tropical Forest Soil | MLAGAIVTFSGLCIVLVRVFDVPDWGVLLAAGVGLIVLGLIRRFTSKPDRS* |
| Ga0081455_101111874 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MLAGAIVTFSGLCIVLVRVFGVPDWGVLLVAGVGLIVLGLIRRFTGDPSRR* |
| Ga0075432_102809972 | 3300006058 | Populus Rhizosphere | MLAGAIVTFSGLCIVLVRVFDVPDWGVLLATGVGLIVLGLVRRFTGDSARR* |
| Ga0075425_1003059132 | 3300006854 | Populus Rhizosphere | MLAGSIVTFSGLCIVLVRVFDVPDWGVLLVAGVGLIMLGLIRRFTSGSEGR* |
| Ga0075429_1000669621 | 3300006880 | Populus Rhizosphere | MLAGAIVTFSGLCLVLVRVFDVPDWGVLLATGVGLIVLGLVR |
| Ga0099794_104432972 | 3300007265 | Vadose Zone Soil | MMAGATVAFSGLCIVLVEVLKVPPYAVLLVVGVGMFALG |
| Ga0099827_1000045021 | 3300009090 | Vadose Zone Soil | MLAGAMVAFSGLCIVLVKVFGVPEYGVLLAVGIGLIALGLVRRFTHKDQNGQ* |
| Ga0075418_110121582 | 3300009100 | Populus Rhizosphere | MLAGAIVTFSGLCLVLVRVFDVPDWGVLLATGVGLIVLGLVRRFTSDSARR* |
| Ga0066709_1011568422 | 3300009137 | Grasslands Soil | MVAGAMVAFSGLCIVLVKVFGVPEYGVLLAVGIGLIALGLVRRFTHKDHDGQ* |
| Ga0105065_10050343 | 3300009803 | Groundwater Sand | MLVGAMVAFSGVCIVLVKVFEVPEYGVLLAVGIGLIALGLVRRFTHKDHDGQ* |
| Ga0105063_10020722 | 3300009804 | Groundwater Sand | MLAGAMVAFSGLCIVLVKVFGVPEYGVLLAVGIGLIALGLVRRFTHKDYDGQ* |
| Ga0105057_10819641 | 3300009813 | Groundwater Sand | MLAGVIVAFSGLCIVLVRVFGVPDWGVLLVVGLGLLGLGLIRRFTSGDRTGP* |
| Ga0105082_10717632 | 3300009814 | Groundwater Sand | MVAGAMVAFSGLCIVLVKVFGVPEYGVLLAVGIGLIALGLVRRFTHKNYDGQ* |
| Ga0105070_10089241 | 3300009815 | Groundwater Sand | IVASQPGTGLMLAGAMVAFSGLCIVLVKVFGVPEYGVLLAVGIGLIALGLVRRFTHTDHDGQ* |
| Ga0105072_10270711 | 3300009818 | Groundwater Sand | MLAGAMVAFSGLCIVLVKVLGVPEYGVLLAVGIGLIALGLVRRFTHTDHDGQ* |
| Ga0105064_10254842 | 3300009821 | Groundwater Sand | VAFSGLCIVLVKVFQVPDYGVLLVVGLGLFALGLIRRFTSKDQGGRQ* |
| Ga0105068_10259522 | 3300009836 | Groundwater Sand | MVAGAMVAFSGLCIVLVKVFGVPEYGVLLAVGIGLIALGLVRRFTHKDHDGP* |
| Ga0105058_10188851 | 3300009837 | Groundwater Sand | MVAGAMVAFSGLCIVLVKVFGVPEYGVLLAVGIGLIALGLVRRFTHTDHDGQ* |
| Ga0134080_100251685 | 3300010333 | Grasslands Soil | MMAGAIVAFSGLCIVLVEVLRVPPYAVLLVVGVGMFVLGLIRRFSREDRDRI* |
| Ga0134071_102254102 | 3300010336 | Grasslands Soil | MLAGAMVAFSGLCIVLVKVLGVPEYGVLLAVGVGLIALGLVRRFTHKDHEGQ* |
| Ga0126372_102579433 | 3300010360 | Tropical Forest Soil | MLAGSIVTFSGVCIVLVRVFGVPDWGVLLVAGVGLIMLGLIRRFTSGSEGR* |
| Ga0124844_11833492 | 3300010868 | Tropical Forest Soil | MLAGAIVTFSGLCIVLVRIFGVPDWGVLLVAGVGLIVLGLIRRFTGDPS |
| Ga0137383_106417503 | 3300012199 | Vadose Zone Soil | MMAGATVAFSGLCIVLVEVLKVPPYAVLLVVGVGMFALGLIRRF |
| Ga0137399_100966922 | 3300012203 | Vadose Zone Soil | VARPGTGLILAGAIVAFSGLCIVLVKVFDVPDYGVLLAVGTGLIGLGLVRRFTSKDP* |
| Ga0137399_102853962 | 3300012203 | Vadose Zone Soil | MLAGSIVTFSGLCIVLVRVFGVPDWGVLLVAGVGLTVLGLIRRFTSSPDSR* |
| Ga0137380_108313402 | 3300012206 | Vadose Zone Soil | MLAGSIVTFSGLCIVLVRVFGVPDWGVLLVAGVGLIVLGLIRRFTNGPDSR* |
| Ga0137387_102216452 | 3300012349 | Vadose Zone Soil | MVAFSGLCIVLGKVFGVPEYGVLLAVGIGLIALGLVRRFTHKDHDGQ* |
| Ga0137386_112367881 | 3300012351 | Vadose Zone Soil | FSGLCIVLVRVFGVPDWGVLLVAGVGLIVLGLIRRFTNGPDSR* |
| Ga0137396_103439482 | 3300012918 | Vadose Zone Soil | VARPGTGLILAGAIVAFSGLCIVLVKVFDVPDYGVLLAVGIGLIGLGLVRRFTSKDP* |
| Ga0137394_104904583 | 3300012922 | Vadose Zone Soil | MMAGAIVAFSGLCFVLVEVLRVPPYAVLLVVGVGMFVLGLIRRFSR* |
| Ga0137419_106749071 | 3300012925 | Vadose Zone Soil | MMAGAIVAFSGLCIVLVEVLKVPPYAVLLVVGVGMFALGLIRRFSREDRESR* |
| Ga0137410_101806733 | 3300012944 | Vadose Zone Soil | MLAGSIVAFSGLCIVLVRVFGVPDWGVLLVAGVGLIALGLIRRFTSSPESR* |
| Ga0137410_107651741 | 3300012944 | Vadose Zone Soil | VARPGTGLILAGAIVAFSGLCIVLVKVFDVPDYGVLLAVGTGLIALGLVRRFTSKDP* |
| Ga0126375_107830341 | 3300012948 | Tropical Forest Soil | AIVAFSGLCIVLVRIFGVPDWGVLLVAGVGLIVLGLIRRFTGDPSRR* |
| Ga0134077_100943112 | 3300012972 | Grasslands Soil | TAASSSIVASQPGTGLMLAGAMVAFSGLCIVLVKVLGVPEYGVLLAVGVGLIALGLVRRFTHKDHDGQ* |
| Ga0134089_104210243 | 3300015358 | Grasslands Soil | TIVAFSGLCIVMVEVLRVPPYAVLLVVGIGMFVLGLVRRFTREDRENR* |
| Ga0134085_100485175 | 3300015359 | Grasslands Soil | MMAGAIVAFSGLCIVLVEVLRVPPYAVLLVVGVGMFVLGLIRRFSREHRDRI* |
| Ga0132258_100623995 | 3300015371 | Arabidopsis Rhizosphere | MLAGAIVTFSGLCIVLVRVFDVPDWGVLLATGVGLIVLGLVRRFTGDPSRR* |
| Ga0132257_1014837122 | 3300015373 | Arabidopsis Rhizosphere | MLAGAIVTFSGLCIVLVRVFDVPDWGVLLATGVGLIVLGLVRLFTSDSARR* |
| Ga0132255_1017519232 | 3300015374 | Arabidopsis Rhizosphere | MLAGAIVTFSGLCLVLVRVFDVPDWGVLLATGVGLIVLGLVRRFTGDPGRR* |
| Ga0134112_102165612 | 3300017656 | Grasslands Soil | MLAGSIVTFSGLCIVLVRVFGVPDWGVLLVAGVGLIVLGLIRRFTNGPDSR |
| Ga0134112_102567021 | 3300017656 | Grasslands Soil | MVAGAMVAFSGLCIVLVKVFGVPEYGVLLAVGIGLIALGLVRRFTHKDHDGQ |
| Ga0134112_105172751 | 3300017656 | Grasslands Soil | MVAFSGLCIVLVKVLGVPEYGVLLAVGVGLIALGLVRRFTHKDHEGQ |
| Ga0184610_10033174 | 3300017997 | Groundwater Sediment | MVAFSGLCIVLVKVFGVPEYGVLLAVGIGLIALGLVRRFTHKDHDGQ |
| Ga0184608_102034562 | 3300018028 | Groundwater Sediment | MLAGAMVAFSGLCIVLVKVFGVPEYGVLLAVGIGLIALGLVRRFTHKDHDGQ |
| Ga0184634_1000028214 | 3300018031 | Groundwater Sediment | MVAFSGLCIVLVKVFGVPEYGVLLAVGIGLIALGLVRRFT |
| Ga0184633_1000183710 | 3300018077 | Groundwater Sediment | MVAFSGLCIVLVKVFGVPEYGVLLAVGISLIALGLVRRFTHKDHDGQ |
| Ga0066667_116155791 | 3300018433 | Grasslands Soil | MMAGAIVAFSGLCIVLVEVLRVPPYAVLLVVGVGMFVLGLIRRFSREDRDRI |
| Ga0137408_11867715 | 3300019789 | Vadose Zone Soil | MLAGSIVTFSGLCIVLVRIFGVPDWGVLLVAGVGLIVLGLIRRFTNGPDSR |
| Ga0137408_12829645 | 3300019789 | Vadose Zone Soil | MVAFSGLCIVLVKVFGVPEYGVLLAVGIGLIALGLVRRFTHKDQNGQ |
| Ga0137408_13018471 | 3300019789 | Vadose Zone Soil | VAAKPGTGLMMAGAIVAFSGLCIITVKVFGVPDYAVLVVVGVGLFVLGLIRRFTREDRES |
| Ga0209236_12340781 | 3300026298 | Grasslands Soil | LMLAGAMVAFSGLCIVLVKVFGVPEYGVLLAVGIGLIALGLVRRFTHKDQNGQ |
| Ga0209761_10813331 | 3300026313 | Grasslands Soil | FSGLCIVLVKVFGVPEYGVLLAVGIGLIALGLVRRFTHKDHDGQ |
| Ga0209884_10070732 | 3300027013 | Groundwater Sand | MLAGAMVAFSGLCIVLVKVFGVPEYGVLLAVGIGLIALGLVRRFTHKDYDGQ |
| Ga0209845_10685312 | 3300027324 | Groundwater Sand | MVAFSGLCIVLVRVFGVPEYGVLLAVGIGLIALGLVRRFTHKDHDGQ |
| Ga0209861_10607901 | 3300027332 | Groundwater Sand | PGTGLMVAGAMVAFSGLCIVLVKVFGVPEYGVLLAVGIGLIALGLVRRFTHKDHDGQ |
| Ga0209842_10354972 | 3300027379 | Groundwater Sand | VASQPGTGLMVAGAMVAFSGLCIVLVKVFGVPEYGVLLAVGIGLIALGLVRRFTHKDHDG |
| Ga0209899_10052904 | 3300027490 | Groundwater Sand | MVAFSGLCIVLVKVFGVPEYGVLLAVGIGLIALGLVRRFTHTDHDGQ |
| Ga0209843_10244102 | 3300027511 | Groundwater Sand | MLVGAMVAFSGVCIVLVKVFEVPEYGVLLAVGIGLIALGLVRRFTHKDHDGQ |
| Ga0209887_10360773 | 3300027561 | Groundwater Sand | MLAGAMVAFSGLCIVLVKVFGVPEYGVLLAVGIGLIALGLVRRFTHKNYDGQ |
| Ga0207428_104072441 | 3300027907 | Populus Rhizosphere | MLAGAIVTFSGLCIVLVRVFDVPDWGVLLATGVGLIVLGLVRRFTSDSARR |
| Ga0209858_10084841 | 3300027948 | Groundwater Sand | MLAGAMVAFSGLCIVLVKVFGVPEYGVLLAVGIGLIALGLVRRFTHTDHDGQ |
| Ga0209859_10122173 | 3300027954 | Groundwater Sand | TGLMVAGAMVAFSGLCIVLVKVFGVPEYGVLLAVGIGLIALGLVRRFTHKDHDGQ |
| Ga0307504_101247182 | 3300028792 | Soil | MLAGSIVTFSGLCIVLVRVFGVPDWGVLLVAGVGLIALGLIRRFTGGSDSR |
| Ga0307495_101700762 | 3300031199 | Soil | MLAGSIVTFSGLCIVLVRVFGVPDWGVLVVAGVGLIGLGLIRRFTSGPDSR |
| Ga0307469_100855392 | 3300031720 | Hardwood Forest Soil | MLAGSIVTFSGLCIVLVRVFGLPDWGVLLVAGVGLVVLGLIRRFTSGPDSR |
| Ga0307469_104088382 | 3300031720 | Hardwood Forest Soil | MLAGSIVTFSGLCIVLVRVFGVPDWGVLLVAGVGLIVLGLIRRFTSGSEGR |
| Ga0307469_105970782 | 3300031720 | Hardwood Forest Soil | MVAFSGLCIVLVKVFGVPEYGVLLAVGVGLIALGLVRRFTHKDHDGQ |
| Ga0307469_106967892 | 3300031720 | Hardwood Forest Soil | MLAGSIVTFSGLCIVLVRVFGVPDWGVLLVAGVGLIALGLIRRFTGSSDSR |
| Ga0307469_116541032 | 3300031720 | Hardwood Forest Soil | VARPGAGLLLAGSIVTFSGLCIVLVRVFGVPDWGVLLAAGVGLIVLGLVRRFTSGSESR |
| Ga0307468_1006741452 | 3300031740 | Hardwood Forest Soil | MLAGSIVTFSGLCIVLVRVFGLPDWGVLLVAGVGLVVLGLIRRFTSGPDSQ |
| Ga0307473_100562142 | 3300031820 | Hardwood Forest Soil | MLAGAIVTFSGLCIVLVRVFDVPDWGVLLATGVGLIVLGLVRRFTGDSARR |
| Ga0307473_105345451 | 3300031820 | Hardwood Forest Soil | STVARPGAGLLLAGSIVTFSGVCIVLVRVFGVPDWGVLLAAGVGLIVLGLVRRFTGGSES |
| Ga0307471_1016443664 | 3300032180 | Hardwood Forest Soil | AFSGLCIVLVEVLRVPPYAVLLVVGVGMFVLGLIRRFSREDRGSR |
| Ga0307472_1003513761 | 3300032205 | Hardwood Forest Soil | MLAGAIVTFSGLCLVLVRVFDVPDWGVLLATGVGLIVLGLVRRFTSDSARR |
| Ga0364931_0333778_1_150 | 3300034176 | Sediment | MLAGAMVAFSGLCIVLVRVFGVPEYGVLLAVGIGLIALGLVRRFTHKDHD |
| Ga0364943_0209096_69_224 | 3300034354 | Sediment | MLAGSIVTFSGLCIVLVRVFGVPDWGVLLVAGGGLIVLGLIRRFTGGSDSR |
| ⦗Top⦘ |