


| Basic Information | |
|---|---|
| Family ID | F104254 |
| Family Type | Metagenome |
| Number of Sequences | 100 |
| Average Sequence Length | 41 residues |
| Representative Sequence | RQKSELVSSFCRLATPRLVPADLEPGADPERSEGARPNKK |
| Number of Associated Samples | 33 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.01 % |
| % of genes near scaffold ends (potentially truncated) | 99.00 % |
| % of genes from short scaffolds (< 2000 bps) | 35.00 % |
| Associated GOLD sequencing projects | 23 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (94.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge (54.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (100.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (67.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 27.50% β-sheet: 0.00% Coil/Unstructured: 72.50% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF02620 | YceD | 6.00 |
| PF07661 | MORN_2 | 5.00 |
| PF08245 | Mur_ligase_M | 5.00 |
| PF01553 | Acyltransferase | 4.00 |
| PF03793 | PASTA | 4.00 |
| PF03721 | UDPG_MGDP_dh_N | 3.00 |
| PF00929 | RNase_T | 2.00 |
| PF00496 | SBP_bac_5 | 2.00 |
| PF00041 | fn3 | 2.00 |
| PF00561 | Abhydrolase_1 | 2.00 |
| PF14903 | WG_beta_rep | 2.00 |
| PF09827 | CRISPR_Cas2 | 2.00 |
| PF13742 | tRNA_anti_2 | 2.00 |
| PF00677 | Lum_binding | 2.00 |
| PF01551 | Peptidase_M23 | 2.00 |
| PF04468 | PSP1 | 2.00 |
| PF14289 | DUF4369 | 2.00 |
| PF01476 | LysM | 2.00 |
| PF01170 | UPF0020 | 2.00 |
| PF01790 | LGT | 1.00 |
| PF00294 | PfkB | 1.00 |
| PF02926 | THUMP | 1.00 |
| PF00795 | CN_hydrolase | 1.00 |
| PF10365 | DUF2436 | 1.00 |
| PF13573 | SprB | 1.00 |
| PF00829 | Ribosomal_L21p | 1.00 |
| PF08281 | Sigma70_r4_2 | 1.00 |
| PF02545 | Maf | 1.00 |
| PF02348 | CTP_transf_3 | 1.00 |
| PF00156 | Pribosyltran | 1.00 |
| PF01656 | CbiA | 1.00 |
| PF02801 | Ketoacyl-synt_C | 1.00 |
| PF01609 | DDE_Tnp_1 | 1.00 |
| PF13585 | CHU_C | 1.00 |
| PF13292 | DXP_synthase_N | 1.00 |
| PF03485 | Arg_tRNA_synt_N | 1.00 |
| PF01048 | PNP_UDP_1 | 1.00 |
| PF12724 | Flavodoxin_5 | 1.00 |
| PF00403 | HMA | 1.00 |
| PF00528 | BPD_transp_1 | 1.00 |
| PF02272 | DHHA1 | 1.00 |
| PF11551 | Omp28 | 1.00 |
| PF13715 | CarbopepD_reg_2 | 1.00 |
| PF08126 | Propeptide_C25 | 1.00 |
| PF01712 | dNK | 1.00 |
| PF07973 | tRNA_SAD | 1.00 |
| PF01293 | PEPCK_ATP | 1.00 |
| PF01965 | DJ-1_PfpI | 1.00 |
| PF01255 | Prenyltransf | 1.00 |
| PF00590 | TP_methylase | 1.00 |
| PF03938 | OmpH | 1.00 |
| PF09603 | Fib_succ_major | 1.00 |
| PF13505 | OMP_b-brl | 1.00 |
| PF01725 | Ham1p_like | 1.00 |
| PF04545 | Sigma70_r4 | 1.00 |
| PF02577 | BFN_dom | 1.00 |
| PF04397 | LytTR | 1.00 |
| PF00085 | Thioredoxin | 1.00 |
| PF05746 | DALR_1 | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG1399 | 23S rRNA accumulation protein YceD (essential in plants, uncharacterized in bacteria) | Translation, ribosomal structure and biogenesis [J] | 6.00 |
| COG2849 | Antitoxin component YwqK of the YwqJK toxin-antitoxin module | Defense mechanisms [V] | 5.00 |
| COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 3.00 |
| COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 3.00 |
| COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 3.00 |
| COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 3.00 |
| COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 3.00 |
| COG0018 | Arginyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 2.00 |
| COG0116 | 23S rRNA G2445 N2-methylase RlmL | Translation, ribosomal structure and biogenesis [J] | 2.00 |
| COG0286 | Type I restriction-modification system, DNA methylase subunit | Defense mechanisms [V] | 2.00 |
| COG0307 | Riboflavin synthase alpha chain | Coenzyme transport and metabolism [H] | 2.00 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 2.00 |
| COG1092 | 23S rRNA G2069 N7-methylase RlmK or C1962 C5-methylase RlmI | Translation, ribosomal structure and biogenesis [J] | 2.00 |
| COG1774 | Cell fate regulator YaaT, PSP1 superfamily (controls sporulation, competence, biofilm development) | Signal transduction mechanisms [T] | 2.00 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 2.00 |
| COG2263 | Predicted RNA methylase | General function prediction only [R] | 2.00 |
| COG2264 | Ribosomal protein L11 methylase PrmA | Translation, ribosomal structure and biogenesis [J] | 2.00 |
| COG2265 | tRNA/tmRNA/rRNA uracil-C5-methylase, TrmA/RlmC/RlmD family | Translation, ribosomal structure and biogenesis [J] | 2.00 |
| COG2813 | 16S rRNA G1207 or 23S rRNA G1835 methylase RsmC/RlmG | Translation, ribosomal structure and biogenesis [J] | 2.00 |
| COG2890 | Methylase of polypeptide chain release factors | Translation, ribosomal structure and biogenesis [J] | 2.00 |
| COG4123 | tRNA1(Val) A37 N6-methylase TrmN6 | Translation, ribosomal structure and biogenesis [J] | 2.00 |
| COG0020 | Undecaprenyl pyrophosphate synthase | Lipid transport and metabolism [I] | 1.00 |
| COG0127 | Inosine/xanthosine triphosphate pyrophosphatase, all-alpha NTP-PPase family | Nucleotide transport and metabolism [F] | 1.00 |
| COG0261 | Ribosomal protein L21 | Translation, ribosomal structure and biogenesis [J] | 1.00 |
| COG0424 | 7-methyl-GTP pyrophosphatase and related NTP pyrophosphatases, Maf/HAM1 superfamily | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.00 |
| COG0682 | Prolipoprotein diacylglyceryltransferase | Cell wall/membrane/envelope biogenesis [M] | 1.00 |
| COG0751 | Glycyl-tRNA synthetase, beta subunit | Translation, ribosomal structure and biogenesis [J] | 1.00 |
| COG0775 | Nucleoside phosphorylase/nucleosidase, includes 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase MtnN and futalosine hydrolase MqnB | Nucleotide transport and metabolism [F] | 1.00 |
| COG0813 | Purine-nucleoside phosphorylase | Nucleotide transport and metabolism [F] | 1.00 |
| COG1083 | CMP-N-acetylneuraminic acid synthetase, NeuA/PseF family | Cell wall/membrane/envelope biogenesis [M] | 1.00 |
| COG1212 | CMP-2-keto-3-deoxyoctulosonic acid synthetase | Cell wall/membrane/envelope biogenesis [M] | 1.00 |
| COG1259 | Bifunctional DNase/RNase | General function prediction only [R] | 1.00 |
| COG1428 | Deoxyadenosine/deoxycytidine kinase | Nucleotide transport and metabolism [F] | 1.00 |
| COG1861 | Spore coat polysaccharide biosynthesis protein SpsF, cytidylyltransferase family | Cell wall/membrane/envelope biogenesis [M] | 1.00 |
| COG1866 | Phosphoenolpyruvate carboxykinase, ATP-dependent | Energy production and conversion [C] | 1.00 |
| COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 1.00 |
| COG2608 | Copper chaperone CopZ | Inorganic ion transport and metabolism [P] | 1.00 |
| COG2820 | Uridine phosphorylase | Nucleotide transport and metabolism [F] | 1.00 |
| COG2825 | Periplasmic chaperone for outer membrane proteins, Skp family | Cell wall/membrane/envelope biogenesis [M] | 1.00 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 1.00 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 1.00 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 1.00 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 1.00 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 1.00 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 94.00 % |
| Unclassified | root | N/A | 6.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002168|JGI24712J26585_10004023 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Lentimicrobiaceae → Lentimicrobium → Lentimicrobium saccharophilum | 11378 | Open in IMG/M |
| 3300002168|JGI24712J26585_10006392 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Lentimicrobiaceae → Lentimicrobium → Lentimicrobium saccharophilum | 8436 | Open in IMG/M |
| 3300002168|JGI24712J26585_10010569 | All Organisms → cellular organisms → Bacteria | 5926 | Open in IMG/M |
| 3300002168|JGI24712J26585_10011111 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 5719 | Open in IMG/M |
| 3300002168|JGI24712J26585_10013659 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 4926 | Open in IMG/M |
| 3300002168|JGI24712J26585_10018448 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 3936 | Open in IMG/M |
| 3300002168|JGI24712J26585_10027857 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2850 | Open in IMG/M |
| 3300002170|JGI24711J26586_10003061 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia | 11405 | Open in IMG/M |
| 3300002170|JGI24711J26586_10003068 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 11382 | Open in IMG/M |
| 3300002170|JGI24711J26586_10003095 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 11311 | Open in IMG/M |
| 3300002170|JGI24711J26586_10005044 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 8068 | Open in IMG/M |
| 3300002170|JGI24711J26586_10005443 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 7637 | Open in IMG/M |
| 3300002170|JGI24711J26586_10006391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 6725 | Open in IMG/M |
| 3300002170|JGI24711J26586_10012955 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 3922 | Open in IMG/M |
| 3300002173|JGI24709J26583_10005866 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 8758 | Open in IMG/M |
| 3300002173|JGI24709J26583_10009506 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 6194 | Open in IMG/M |
| 3300002173|JGI24709J26583_10015226 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 4326 | Open in IMG/M |
| 3300002173|JGI24709J26583_10015940 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 4178 | Open in IMG/M |
| 3300002173|JGI24709J26583_10022436 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 3179 | Open in IMG/M |
| 3300002173|JGI24709J26583_10025162 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2905 | Open in IMG/M |
| 3300002173|JGI24709J26583_10034151 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2282 | Open in IMG/M |
| 3300002173|JGI24709J26583_10034203 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2279 | Open in IMG/M |
| 3300002173|JGI24709J26583_10081372 | All Organisms → cellular organisms → Bacteria → FCB group | 1118 | Open in IMG/M |
| 3300002173|JGI24709J26583_10103714 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium | 911 | Open in IMG/M |
| 3300002174|JGI24710J26742_10004038 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 12238 | Open in IMG/M |
| 3300002174|JGI24710J26742_10011917 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 5734 | Open in IMG/M |
| 3300002174|JGI24710J26742_10037631 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2316 | Open in IMG/M |
| 3300002174|JGI24710J26742_10084222 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1176 | Open in IMG/M |
| 3300002174|JGI24710J26742_10192818 | Not Available | 590 | Open in IMG/M |
| 3300002174|JGI24710J26742_10217921 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium | 537 | Open in IMG/M |
| 3300002898|draft_10021256 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia | 7433 | Open in IMG/M |
| 3300002898|draft_10140420 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium | 1549 | Open in IMG/M |
| 3300009655|Ga0116190_1015292 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia | 4126 | Open in IMG/M |
| 3300009655|Ga0116190_1045029 | Not Available | 1922 | Open in IMG/M |
| 3300009658|Ga0116188_1019777 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 3713 | Open in IMG/M |
| 3300009658|Ga0116188_1027080 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 2967 | Open in IMG/M |
| 3300009658|Ga0116188_1033010 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 2569 | Open in IMG/M |
| 3300009658|Ga0116188_1043526 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2100 | Open in IMG/M |
| 3300009658|Ga0116188_1067051 | Not Available | 1539 | Open in IMG/M |
| 3300009658|Ga0116188_1092217 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium | 1224 | Open in IMG/M |
| 3300009664|Ga0116146_1026173 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 3051 | Open in IMG/M |
| 3300009664|Ga0116146_1030628 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2737 | Open in IMG/M |
| 3300009664|Ga0116146_1030881 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium | 2722 | Open in IMG/M |
| 3300009664|Ga0116146_1076324 | Not Available | 1480 | Open in IMG/M |
| 3300009666|Ga0116182_1015421 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 5379 | Open in IMG/M |
| 3300009666|Ga0116182_1047588 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 2453 | Open in IMG/M |
| 3300009666|Ga0116182_1062377 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium | 2031 | Open in IMG/M |
| 3300009666|Ga0116182_1072941 | All Organisms → cellular organisms → Bacteria | 1821 | Open in IMG/M |
| 3300009666|Ga0116182_1093193 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1535 | Open in IMG/M |
| 3300009667|Ga0116147_1002016 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 21379 | Open in IMG/M |
| 3300009667|Ga0116147_1005172 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 11202 | Open in IMG/M |
| 3300009667|Ga0116147_1029411 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2963 | Open in IMG/M |
| 3300009670|Ga0116183_1019222 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 4961 | Open in IMG/M |
| 3300009704|Ga0116145_1184341 | Not Available | 816 | Open in IMG/M |
| 3300009714|Ga0116189_1004601 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 9605 | Open in IMG/M |
| 3300009714|Ga0116189_1016205 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 4293 | Open in IMG/M |
| 3300009714|Ga0116189_1028096 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2912 | Open in IMG/M |
| 3300009714|Ga0116189_1043542 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 2124 | Open in IMG/M |
| 3300009714|Ga0116189_1047471 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium | 1994 | Open in IMG/M |
| 3300009714|Ga0116189_1076895 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1403 | Open in IMG/M |
| 3300009715|Ga0116160_1149882 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium | 951 | Open in IMG/M |
| 3300009720|Ga0116159_1027791 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 3266 | Open in IMG/M |
| 3300009720|Ga0116159_1190147 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium | 846 | Open in IMG/M |
| 3300009767|Ga0116161_1004329 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 12039 | Open in IMG/M |
| 3300010344|Ga0116243_10002633 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 33064 | Open in IMG/M |
| 3300010344|Ga0116243_10051188 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium | 3511 | Open in IMG/M |
| 3300010344|Ga0116243_10076543 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium | 2606 | Open in IMG/M |
| 3300010347|Ga0116238_10012929 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 9538 | Open in IMG/M |
| 3300010353|Ga0116236_10720994 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium | 808 | Open in IMG/M |
| 3300010365|Ga0116251_10005778 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 17136 | Open in IMG/M |
| 3300010365|Ga0116251_10006041 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 16556 | Open in IMG/M |
| 3300010365|Ga0116251_10016867 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 7409 | Open in IMG/M |
| 3300025613|Ga0208461_1041759 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1584 | Open in IMG/M |
| 3300025629|Ga0208824_1053534 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 1439 | Open in IMG/M |
| 3300025629|Ga0208824_1129738 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium | 701 | Open in IMG/M |
| 3300025629|Ga0208824_1132093 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 690 | Open in IMG/M |
| 3300025677|Ga0209719_1128096 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium | 727 | Open in IMG/M |
| 3300025682|Ga0209718_1074404 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium | 1182 | Open in IMG/M |
| 3300025686|Ga0209506_1070368 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium | 1161 | Open in IMG/M |
| 3300025713|Ga0208195_1011154 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 5395 | Open in IMG/M |
| 3300025713|Ga0208195_1047424 | All Organisms → cellular organisms → Bacteria | 1822 | Open in IMG/M |
| 3300025713|Ga0208195_1059703 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1539 | Open in IMG/M |
| 3300025737|Ga0208694_1031103 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2752 | Open in IMG/M |
| 3300025737|Ga0208694_1041090 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia | 2206 | Open in IMG/M |
| 3300025737|Ga0208694_1079512 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium | 1316 | Open in IMG/M |
| 3300026311|Ga0209723_1287252 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium | 554 | Open in IMG/M |
| (restricted) 3300028564|Ga0255344_1001460 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 31704 | Open in IMG/M |
| (restricted) 3300028564|Ga0255344_1047715 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium | 2302 | Open in IMG/M |
| (restricted) 3300028564|Ga0255344_1073912 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 1651 | Open in IMG/M |
| (restricted) 3300028570|Ga0255341_1006840 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 10483 | Open in IMG/M |
| (restricted) 3300028570|Ga0255341_1136374 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1070 | Open in IMG/M |
| (restricted) 3300028576|Ga0255340_1014842 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 5520 | Open in IMG/M |
| (restricted) 3300028576|Ga0255340_1059448 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium | 2040 | Open in IMG/M |
| (restricted) 3300028576|Ga0255340_1063486 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1944 | Open in IMG/M |
| (restricted) 3300028576|Ga0255340_1088515 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium | 1522 | Open in IMG/M |
| (restricted) 3300028576|Ga0255340_1244314 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium | 711 | Open in IMG/M |
| (restricted) 3300028593|Ga0255347_1013300 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 7387 | Open in IMG/M |
| (restricted) 3300028593|Ga0255347_1163695 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium | 1090 | Open in IMG/M |
| (restricted) 3300028677|Ga0255346_1022297 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 4195 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 54.00% |
| Biogas Fermentantion | Engineered → Biotransformation → Mixed Alcohol Bioreactor → Unclassified → Unclassified → Biogas Fermentantion | 30.00% |
| Wastewater | Engineered → Built Environment → Water Treatment Plant → Unclassified → Unclassified → Wastewater | 13.00% |
| Biogas Fermenter | Engineered → Unclassified → Unclassified → Unclassified → Unclassified → Biogas Fermenter | 2.00% |
| Anaerobic Biogas Reactor | Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Biogas Reactor | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002168 | Biogas fermentation microbial communities from Germany - Plant 3 DNA2 | Engineered | Open in IMG/M |
| 3300002170 | Biogas fermentation microbial communities from Germany - Plant 3 DNA1 | Engineered | Open in IMG/M |
| 3300002173 | Biogas fermentation microbial communities from Germany - Plant 2 DNA1 | Engineered | Open in IMG/M |
| 3300002174 | Biogas fermentation microbial communities from Germany - Plant 2 DNA2 | Engineered | Open in IMG/M |
| 3300002898 | Metagenome Biopara biogasfermenter May 2013 pooled | Engineered | Open in IMG/M |
| 3300009655 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR4_MetaG | Engineered | Open in IMG/M |
| 3300009658 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR2_MetaG | Engineered | Open in IMG/M |
| 3300009664 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHG2_MetaG | Engineered | Open in IMG/M |
| 3300009666 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC077_MetaG | Engineered | Open in IMG/M |
| 3300009667 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHG3_MetaG | Engineered | Open in IMG/M |
| 3300009670 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC078_MetaG | Engineered | Open in IMG/M |
| 3300009704 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHG1_MetaG | Engineered | Open in IMG/M |
| 3300009714 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR3_MetaG | Engineered | Open in IMG/M |
| 3300009715 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNAS2_MetaG | Engineered | Open in IMG/M |
| 3300009720 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNAS1_MetaG | Engineered | Open in IMG/M |
| 3300009767 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNAS3_MetaG | Engineered | Open in IMG/M |
| 3300010344 | AD_JPASca | Engineered | Open in IMG/M |
| 3300010347 | AD_JPHGca | Engineered | Open in IMG/M |
| 3300010353 | AD_USCAca | Engineered | Open in IMG/M |
| 3300010365 | AD_USDIca | Engineered | Open in IMG/M |
| 3300025613 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR4_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025629 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR3_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025677 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNAS2_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025682 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNAS1_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025686 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHG2_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025713 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC077_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025737 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC078_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300026311 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2 time_0 SIP DNA (SPAdes) | Engineered | Open in IMG/M |
| 3300028564 (restricted) | Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant18 | Engineered | Open in IMG/M |
| 3300028570 (restricted) | Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant12 | Engineered | Open in IMG/M |
| 3300028576 (restricted) | Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant10 | Engineered | Open in IMG/M |
| 3300028593 (restricted) | Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant24 | Engineered | Open in IMG/M |
| 3300028677 (restricted) | Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant22 | Engineered | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI24712J26585_1000402310 | 3300002168 | Biogas Fermentantion | VSSFCRLASPRLVPADLEPGADPERSEGARPNIKTNY* |
| JGI24712J26585_1000639210 | 3300002168 | Biogas Fermentantion | PMGTRRQKSELVSSFCRLASPRLVPXDLEPGADPERSEGARPNKK* |
| JGI24712J26585_100105691 | 3300002168 | Biogas Fermentantion | LVSSFCRLATPRLVPADLEPGADPERSEGARPNNFYII* |
| JGI24712J26585_100111115 | 3300002168 | Biogas Fermentantion | QKSELVSSFCRLATPRLVPADLEPGADPERSEGTRPNKNKK* |
| JGI24712J26585_100136597 | 3300002168 | Biogas Fermentantion | QKSELVSSFCRLATPRLVPADLEPGADPERSEGTRPNKKYNYI* |
| JGI24712J26585_100184485 | 3300002168 | Biogas Fermentantion | QKSELVSSFCRLASPRLVPADLEPGADPERSEGTRPNKK* |
| JGI24712J26585_100278571 | 3300002168 | Biogas Fermentantion | QKSELVSSFCRLASPRLVPADLXPGADPERSEGARPNXK* |
| JGI24711J26586_100030611 | 3300002170 | Biogas Fermentantion | SELVSSFCRLASPRLVPADLEPGADPERSEGARPNIKTNY* |
| JGI24711J26586_100030681 | 3300002170 | Biogas Fermentantion | QKSELVSSFCRLASPRLVPADLQPGADPERSEGTRPKNHHP* |
| JGI24711J26586_1000309511 | 3300002170 | Biogas Fermentantion | SELVSSFCRLASPRLVPEDLEPGADPERSEGARPNKK* |
| JGI24711J26586_100050441 | 3300002170 | Biogas Fermentantion | QKSELVSSFCRLASPRLVPADLQPGADPERSEGARPNKK* |
| JGI24711J26586_1000544311 | 3300002170 | Biogas Fermentantion | QKSELVSSFCRFASPRLVPADLEPGADPERSEGARPKEN* |
| JGI24711J26586_100063911 | 3300002170 | Biogas Fermentantion | QKSELVSSFCRLATPRLVPADLEPGADPERSEGTRPNNK* |
| JGI24711J26586_100129551 | 3300002170 | Biogas Fermentantion | LVSSFCRLASPRLVPADLEPGADPERSEGTRPNKK* |
| JGI24709J26583_1000586613 | 3300002173 | Biogas Fermentantion | KSELVSSFCRFASPRLVPADLEPGADPERSEGAHPNKKN* |
| JGI24709J26583_100095061 | 3300002173 | Biogas Fermentantion | KPMGTRRQKSELVSSFCRLASPRLVPEDLEPGADPERSEGARPNKK* |
| JGI24709J26583_100152261 | 3300002173 | Biogas Fermentantion | KSELVSSFCRLATPRLVPADLEPGADPERSEGTRPNKKLNYFYCTKNRN* |
| JGI24709J26583_100159401 | 3300002173 | Biogas Fermentantion | GTRRQKSELVSSFCRLATPRLVPADLEPGADPERSEGARPN* |
| JGI24709J26583_100224361 | 3300002173 | Biogas Fermentantion | RQKSELVSSFCRFATPRLATEDLEPKTDPERSEGTRPNKKIKLFLS* |
| JGI24709J26583_100251621 | 3300002173 | Biogas Fermentantion | SELVSSFCRLATPRLVPADLEPGADPERSEGTRPNKNKK* |
| JGI24709J26583_100341511 | 3300002173 | Biogas Fermentantion | LVSSFCRLATPRLATADLEPGADPERSEGTRPNNKYN* |
| JGI24709J26583_100342031 | 3300002173 | Biogas Fermentantion | KSELVSSFCRFASPRLVPADLEPGADPERSEGARPKEN* |
| JGI24709J26583_100813721 | 3300002173 | Biogas Fermentantion | KSELVSSFCRFASPRLPPADLEPKTDPERSEGTRPKYKYR* |
| JGI24709J26583_101037142 | 3300002173 | Biogas Fermentantion | ELVSSFCRLASPRLVPADLQPKTDPERSEGARPKKNYSY* |
| JGI24710J26742_1000403816 | 3300002174 | Biogas Fermentantion | VSSFCRLASPRLATADLEPKTDPERSEGARPNKN* |
| JGI24710J26742_100119171 | 3300002174 | Biogas Fermentantion | GTRRQKSELVSSFCRFATPRLVPADLEPGADPERSEGTRPNKN* |
| JGI24710J26742_100376311 | 3300002174 | Biogas Fermentantion | QKSELVSSFCRFASPRLVPADLEPGADPERSEGTRPNNNYN* |
| JGI24710J26742_100842221 | 3300002174 | Biogas Fermentantion | KSELVSSFCRLASPRLVPADLEPGADPEHSEGARPN* |
| JGI24710J26742_101928182 | 3300002174 | Biogas Fermentantion | LGTRRQKSELVSSFCRLASPRLVPADLEPETDPERSEGARPNKN* |
| JGI24710J26742_102179211 | 3300002174 | Biogas Fermentantion | QKSELVSSFCRLATPRLVPADLEPGADPERSEGARPN* |
| draft_100212569 | 3300002898 | Biogas Fermenter | RRQKSELVSSFCRLASPRLATADLEPDADPERSEGTRPKKKYLYD* |
| draft_101404203 | 3300002898 | Biogas Fermenter | RRQKSELVSSFCRLATPRLVPADLEPETDPERSEGARPNKK* |
| Ga0116190_10152925 | 3300009655 | Anaerobic Digestor Sludge | RQKSELVSSFCRLASPRLATADLEPGADPERSEGARPKKYYLYN* |
| Ga0116190_10450292 | 3300009655 | Anaerobic Digestor Sludge | LGTRRQKSELVSSFCRLASPRLVPADLEPGADPERSEGARPNKK* |
| Ga0116188_10197776 | 3300009658 | Anaerobic Digestor Sludge | RQKSELVSSFCRLASPRLVPADLEPGADPERSEGARPNKKYNYI* |
| Ga0116188_10270803 | 3300009658 | Anaerobic Digestor Sludge | RQKSELVSSFCRLATPRLVPADLEPGADPERSEGTRPNNK* |
| Ga0116188_10330103 | 3300009658 | Anaerobic Digestor Sludge | RRQKSELVSSFCRLASPRLVPADLEPGADPERSEGARPNKNNKK* |
| Ga0116188_10435263 | 3300009658 | Anaerobic Digestor Sludge | RQKSELVSSFCRLATPRLVPADLEPGADPERSEGARPKEK* |
| Ga0116188_10670512 | 3300009658 | Anaerobic Digestor Sludge | RQKSELVSSFCRLASPRLVPADLEPGADPERSEGARPNKK* |
| Ga0116188_10922172 | 3300009658 | Anaerobic Digestor Sludge | RQKSELVSSFCRLATPRLVPADLEPGADPERSEGARPKEN* |
| Ga0116146_10261733 | 3300009664 | Anaerobic Digestor Sludge | TRRQKSELVSSFCRLATPRLVPADLEPGADPERSEGTRPNNK* |
| Ga0116146_10306281 | 3300009664 | Anaerobic Digestor Sludge | GTQRQKSELVSSFCRFASPRLVPADLEPGADPERSEGARPDKN* |
| Ga0116146_10308811 | 3300009664 | Anaerobic Digestor Sludge | TRRQKSELVSSFCRLATPRLVPADLEPGADPERSEGTRPNKK* |
| Ga0116146_10763241 | 3300009664 | Anaerobic Digestor Sludge | QRQKSELVSSFCRFASPRLVPADLEPGADPERSEGARPNKKYN* |
| Ga0116182_10154215 | 3300009666 | Anaerobic Digestor Sludge | ELVSSFCRLATPRLVPADLEPGADPERSEGARPDKK* |
| Ga0116182_10475881 | 3300009666 | Anaerobic Digestor Sludge | SELVSSFCRFATPRLAAADLQAKTDPERSEGARPNKK* |
| Ga0116182_10623774 | 3300009666 | Anaerobic Digestor Sludge | GTRRQKSELVSSFCRLASPRLVPADLEPGADPERSEGTRPKKK* |
| Ga0116182_10729413 | 3300009666 | Anaerobic Digestor Sludge | GTRRQKSELVSSFCRLATPRLVPADLEPGADPERSEGARPNNK* |
| Ga0116182_10931931 | 3300009666 | Anaerobic Digestor Sludge | QKSELVSSFCRLASPRLVPADLEPGADPERSEGARPNKN* |
| Ga0116147_10020161 | 3300009667 | Anaerobic Digestor Sludge | GTRRQKSELVSSFCRLATPRLVPADLEPGADPERSEGTRPNNK* |
| Ga0116147_10051721 | 3300009667 | Anaerobic Digestor Sludge | RQKSELVSSFCRLATPRLVPADLEPGADPERSEGARPNKN* |
| Ga0116147_10074612 | 3300009667 | Anaerobic Digestor Sludge | KPLGTRRQKSELVSSFRRFATPRLVPADLEPGADPERSEGARPN* |
| Ga0116147_10294115 | 3300009667 | Anaerobic Digestor Sludge | RQKSELVSSFCRLATPRLVPADLEPGADPERSEGARPNKK* |
| Ga0116183_10192221 | 3300009670 | Anaerobic Digestor Sludge | SELVSSFCRLATPRLVPADLEPGADPERSEGARPDKK* |
| Ga0116145_11843413 | 3300009704 | Anaerobic Digestor Sludge | LGTQRQKSELVSSFCRFASPRLVPADLEPGADPERSEGARPNKKYN* |
| Ga0116189_10046011 | 3300009714 | Anaerobic Digestor Sludge | LGTRRQKSELVSSFCRLATPRLVPADLEPGADPERSEGARPKEK* |
| Ga0116189_10162053 | 3300009714 | Anaerobic Digestor Sludge | RRQKSELVSSFCRLATPRLVPADLEPGADPERSEGTRPNNFYII* |
| Ga0116189_10280961 | 3300009714 | Anaerobic Digestor Sludge | SELVSSFCRLASPRLVPADLEPGADPERSEGARPKKNKNR* |
| Ga0116189_10435423 | 3300009714 | Anaerobic Digestor Sludge | RQKSELVSSFCRLASPRLATADLEPGADPERSEGTRPNNKYN* |
| Ga0116189_10474711 | 3300009714 | Anaerobic Digestor Sludge | KSELVSSFCRLATPRLVPADLEPGADPERSEGARPKEN* |
| Ga0116189_10768951 | 3300009714 | Anaerobic Digestor Sludge | KSELVSSFCRLATPRLVPADLEPGADPERSEGARPNKN* |
| Ga0116160_11498823 | 3300009715 | Anaerobic Digestor Sludge | QKSELVSSFCRLASPRLVPADLEPGADPERSEGARPNKKYNYI* |
| Ga0116159_10277911 | 3300009720 | Anaerobic Digestor Sludge | QKSELVSSFCRLATPRLVPADLEPGADPERSEGARPNKN* |
| Ga0116159_11901471 | 3300009720 | Anaerobic Digestor Sludge | SELVSSFCRLATPRLVPADLEPGADPERSEGTRPDKY* |
| Ga0116161_100432915 | 3300009767 | Anaerobic Digestor Sludge | GTRRQKSELVSSFCRLATPRLVPADLEPGADPERSEGTRPNKK* |
| Ga0116243_1000263332 | 3300010344 | Anaerobic Digestor Sludge | GTRRQKSELVSSFCRLASPRLVPADLEPGADPERSEGARPNKKYNYI* |
| Ga0116243_100511883 | 3300010344 | Anaerobic Digestor Sludge | RRQKSELVSSFCRFATPRLVPADLEPGADPERSEGTRPKENYDYYF* |
| Ga0116243_100765432 | 3300010344 | Anaerobic Digestor Sludge | RQKSELVSSFRRFATPRLVPADLEPGADPERSEGARPN* |
| Ga0116238_100129297 | 3300010347 | Anaerobic Digestor Sludge | KSELVSSFCRLATPRLVPADLEPGADPERSEGARPKEK* |
| Ga0116236_107209941 | 3300010353 | Anaerobic Digestor Sludge | SELVSSFCRLATPRLVPADLEPGADPERSEGTRPNKKYNYI* |
| Ga0116251_100057781 | 3300010365 | Anaerobic Digestor Sludge | KSELVSSFCRLATPRLVPADLEPGADPERSEGARPDKK* |
| Ga0116251_1000604114 | 3300010365 | Anaerobic Digestor Sludge | RQKSELVSSFCRLASPRLVPADLEPGADPERSEGARPNKN* |
| Ga0116251_100168676 | 3300010365 | Anaerobic Digestor Sludge | PMGTRRQKSELVSSFCRLASPRLVPADLEPGADPERSEGARPNKN* |
| Ga0208461_10417591 | 3300025613 | Anaerobic Digestor Sludge | RQKSELVSSFCRLATPRLVPADLEPGADPERSEGARPNKN |
| Ga0208824_10535344 | 3300025629 | Anaerobic Digestor Sludge | SELVSSFCRLASPRLVPADLEPGADPERSEGARPNKKYNYI |
| Ga0208824_11297381 | 3300025629 | Anaerobic Digestor Sludge | KSELVSSFCRLATPRLVPADLEPGADPERSEGARPKEN |
| Ga0208824_11320932 | 3300025629 | Anaerobic Digestor Sludge | KSELVSSFCRLATPRLVPADLEPGADPERSEGARPNKN |
| Ga0209719_11280961 | 3300025677 | Anaerobic Digestor Sludge | QKSELVSSFCRLASPRLVPADLEPGADPERSEGARPNKKYNYI |
| Ga0209718_10744042 | 3300025682 | Anaerobic Digestor Sludge | ELVSSFCRLATPRLVPADLEPGADPERSEGARPKEK |
| Ga0209506_10703683 | 3300025686 | Anaerobic Digestor Sludge | TRRQKSELVSSFCRLATPRLVPADLEPGADPERSEGTRPNKK |
| Ga0208195_10111541 | 3300025713 | Anaerobic Digestor Sludge | RRQKSELVSSFCRLATPRLVPADLEPGADPERSEGARPDKK |
| Ga0208195_10474241 | 3300025713 | Anaerobic Digestor Sludge | GTRRQKSELVSSFCRLATPRLVPADLEPGADPERSEGARPNNK |
| Ga0208195_10597031 | 3300025713 | Anaerobic Digestor Sludge | RQKSELVSSFCRLASPRLVPADLEPGADPERSEGARPNKN |
| Ga0208694_10311033 | 3300025737 | Anaerobic Digestor Sludge | KSELVSSFCRLASPRLVPADLEPGADPERSEGTRPNLKTNYY |
| Ga0208694_10410903 | 3300025737 | Anaerobic Digestor Sludge | ELVSSFCRLATPRLVPADLEPGADPERSEGARPDKK |
| Ga0208694_10795121 | 3300025737 | Anaerobic Digestor Sludge | LVSSFCRLATPRLVPADLEPGADPERSEGARPNNK |
| Ga0209723_12872521 | 3300026311 | Anaerobic Biogas Reactor | MGTQRQKSELVSSFCRFASPRLVPADLEPGADPERSEGAH |
| (restricted) Ga0255344_10014601 | 3300028564 | Wastewater | TRRQKSELVSSFCRLASPRLVPADLEPGADPERSEGARPNKK |
| (restricted) Ga0255344_10477151 | 3300028564 | Wastewater | PLGTRRQKSELVSSFCRLATPRLVPADLEPGADPERSEGARPKEK |
| (restricted) Ga0255344_10739123 | 3300028564 | Wastewater | QKSELVSSFCRLASPRLVPADLEPGADPERSEGARPNIKTNY |
| (restricted) Ga0255341_100684015 | 3300028570 | Wastewater | KSELVSSFCRLATPRLVPADLEPGADPERSEGARPNNK |
| (restricted) Ga0255341_11363743 | 3300028570 | Wastewater | SRRQKSELVSSFCRLATPRLVPADLEPGADPERSEGARPNKK |
| (restricted) Ga0255340_10148421 | 3300028576 | Wastewater | RRQKSELVSSFCRLATPRLVPADLEPGADPERSEGTRPNKKYNYI |
| (restricted) Ga0255340_10594481 | 3300028576 | Wastewater | SELVSSFCRHATPRLVPADLEPGADPERSEGARPNKN |
| (restricted) Ga0255340_10634863 | 3300028576 | Wastewater | RRQKSELVSSFCRLASPRLVPADLEPGADPERSEGARPNKK |
| (restricted) Ga0255340_10885151 | 3300028576 | Wastewater | KPQGSRRQKSELVSSFCRLATPRLVPADLEPGADPERSEGARPNKK |
| (restricted) Ga0255340_12443141 | 3300028576 | Wastewater | QKSELVSSFCRLATPRLVPADLEPGADPERSEGARPDKK |
| (restricted) Ga0255347_10133005 | 3300028593 | Wastewater | GTRRQKSELVSSFCRLASPRLVPADLEPGADPERSEGARPNKN |
| (restricted) Ga0255347_11636951 | 3300028593 | Wastewater | ELVSSFCRLATPRLVPADLEPGADPERSEGARPNNK |
| (restricted) Ga0255346_10222977 | 3300028677 | Wastewater | FCRLATPRLVPADLEPGADPERSEGTRPNKKYNYI |
| ⦗Top⦘ |