


| Basic Information | |
|---|---|
| Family ID | F104152 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 100 |
| Average Sequence Length | 51 residues |
| Representative Sequence | MKQFSLLEIISTAVLLAIVVVDLLESSMLLTQLHFKLPTGAHLLLMEC |
| Number of Associated Samples | 10 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 65.43 % |
| % of genes near scaffold ends (potentially truncated) | 31.00 % |
| % of genes from short scaffolds (< 2000 bps) | 63.00 % |
| Associated GOLD sequencing projects | 9 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (83.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat (98.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (98.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Surface (non-saline) (98.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.95% β-sheet: 0.00% Coil/Unstructured: 46.05% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF13359 | DDE_Tnp_4 | 3.00 |
| PF00069 | Pkinase | 1.00 |
| PF00134 | Cyclin_N | 1.00 |
| PF00156 | Pribosyltran | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 4.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 83.00 % |
| All Organisms | root | All Organisms | 17.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005830|Ga0074473_11012265 | Not Available | 695 | Open in IMG/M |
| 3300015360|Ga0163144_10059353 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta | 6637 | Open in IMG/M |
| 3300015360|Ga0163144_10059874 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Rhizosoleniophycidae → Rhizosoleniales → Rhizosoleniaceae → Proboscia → Proboscia inermis | 6597 | Open in IMG/M |
| 3300015360|Ga0163144_10103421 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae | 4502 | Open in IMG/M |
| 3300015360|Ga0163144_10112085 | Not Available | 4250 | Open in IMG/M |
| 3300015360|Ga0163144_10210551 | Not Available | 2677 | Open in IMG/M |
| 3300015360|Ga0163144_10258753 | Not Available | 2291 | Open in IMG/M |
| 3300015360|Ga0163144_10374493 | Not Available | 1726 | Open in IMG/M |
| 3300015360|Ga0163144_10376280 | All Organisms → cellular organisms → Eukaryota | 1720 | Open in IMG/M |
| 3300015360|Ga0163144_10576989 | Not Available | 1230 | Open in IMG/M |
| 3300015360|Ga0163144_10583362 | Not Available | 1219 | Open in IMG/M |
| 3300015360|Ga0163144_10771898 | Not Available | 978 | Open in IMG/M |
| 3300015360|Ga0163144_10776006 | Not Available | 974 | Open in IMG/M |
| 3300015360|Ga0163144_11200587 | Not Available | 697 | Open in IMG/M |
| 3300015360|Ga0163144_11240058 | Not Available | 680 | Open in IMG/M |
| 3300015360|Ga0163144_11257634 | Not Available | 673 | Open in IMG/M |
| 3300015360|Ga0163144_11401411 | Not Available | 622 | Open in IMG/M |
| 3300015360|Ga0163144_11695438 | Not Available | 542 | Open in IMG/M |
| 3300020057|Ga0163151_10109826 | Not Available | 1781 | Open in IMG/M |
| 3300020057|Ga0163151_10147946 | All Organisms → Viruses → Predicted Viral | 1450 | Open in IMG/M |
| 3300020057|Ga0163151_10236164 | All Organisms → Viruses → Predicted Viral | 1038 | Open in IMG/M |
| 3300020057|Ga0163151_10303597 | Not Available | 862 | Open in IMG/M |
| 3300020057|Ga0163151_10429349 | Not Available | 662 | Open in IMG/M |
| 3300020057|Ga0163151_10439828 | Not Available | 650 | Open in IMG/M |
| 3300020057|Ga0163151_10505946 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta | 582 | Open in IMG/M |
| 3300020057|Ga0163151_10526589 | Not Available | 564 | Open in IMG/M |
| 3300020057|Ga0163151_10555077 | Not Available | 541 | Open in IMG/M |
| 3300020192|Ga0163147_10164048 | All Organisms → Viruses → Predicted Viral | 1342 | Open in IMG/M |
| 3300020192|Ga0163147_10167852 | Not Available | 1320 | Open in IMG/M |
| 3300020192|Ga0163147_10208761 | Not Available | 1123 | Open in IMG/M |
| 3300020192|Ga0163147_10219240 | Not Available | 1083 | Open in IMG/M |
| 3300020192|Ga0163147_10345344 | Not Available | 768 | Open in IMG/M |
| 3300020192|Ga0163147_10430791 | Not Available | 646 | Open in IMG/M |
| 3300020192|Ga0163147_10442083 | Not Available | 634 | Open in IMG/M |
| 3300020192|Ga0163147_10475576 | Not Available | 598 | Open in IMG/M |
| 3300020192|Ga0163147_10483136 | Not Available | 590 | Open in IMG/M |
| 3300020201|Ga0163154_10141089 | Not Available | 1372 | Open in IMG/M |
| 3300020201|Ga0163154_10339974 | Not Available | 704 | Open in IMG/M |
| 3300020201|Ga0163154_10475767 | Not Available | 545 | Open in IMG/M |
| 3300020203|Ga0163148_10011441 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 7710 | Open in IMG/M |
| 3300020203|Ga0163148_10024077 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae | 4766 | Open in IMG/M |
| 3300020203|Ga0163148_10035512 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae | 3733 | Open in IMG/M |
| 3300020203|Ga0163148_10044495 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Chaetocerotophycidae → Leptocylindrales → Leptocylindraceae → Leptocylindrus → Leptocylindrus danicus | 3224 | Open in IMG/M |
| 3300020203|Ga0163148_10054063 | Not Available | 2833 | Open in IMG/M |
| 3300020203|Ga0163148_10069263 | Not Available | 2396 | Open in IMG/M |
| 3300020203|Ga0163148_10084325 | Not Available | 2096 | Open in IMG/M |
| 3300020203|Ga0163148_10089964 | Not Available | 2002 | Open in IMG/M |
| 3300020203|Ga0163148_10091503 | Not Available | 1979 | Open in IMG/M |
| 3300020203|Ga0163148_10105158 | Not Available | 1793 | Open in IMG/M |
| 3300020203|Ga0163148_10153521 | Not Available | 1364 | Open in IMG/M |
| 3300020203|Ga0163148_10217493 | Not Available | 1054 | Open in IMG/M |
| 3300020203|Ga0163148_10219344 | Not Available | 1047 | Open in IMG/M |
| 3300020203|Ga0163148_10227701 | Not Available | 1018 | Open in IMG/M |
| 3300020203|Ga0163148_10229908 | Not Available | 1011 | Open in IMG/M |
| 3300020203|Ga0163148_10264518 | Not Available | 910 | Open in IMG/M |
| 3300020203|Ga0163148_10314985 | Not Available | 797 | Open in IMG/M |
| 3300020203|Ga0163148_10413264 | Not Available | 647 | Open in IMG/M |
| 3300020203|Ga0163148_10486019 | Not Available | 570 | Open in IMG/M |
| 3300020203|Ga0163148_10535176 | Not Available | 528 | Open in IMG/M |
| 3300020219|Ga0163146_10093742 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae | 2112 | Open in IMG/M |
| 3300020219|Ga0163146_10115485 | Not Available | 1836 | Open in IMG/M |
| 3300020219|Ga0163146_10126395 | Not Available | 1728 | Open in IMG/M |
| 3300020219|Ga0163146_10142887 | Not Available | 1591 | Open in IMG/M |
| 3300020219|Ga0163146_10194019 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Fragilariophyceae → Fragilariophycidae → Rhabdonematales → Grammatophoraceae → Grammatophora → Grammatophora oceanica | 1287 | Open in IMG/M |
| 3300020219|Ga0163146_10194554 | Not Available | 1285 | Open in IMG/M |
| 3300020219|Ga0163146_10455655 | Not Available | 687 | Open in IMG/M |
| 3300020219|Ga0163146_10667671 | Not Available | 511 | Open in IMG/M |
| 3300020596|Ga0163149_10015720 | Not Available | 6817 | Open in IMG/M |
| 3300020596|Ga0163149_10031247 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 4384 | Open in IMG/M |
| 3300020596|Ga0163149_10046374 | All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Naviculales → Naviculaceae → Fistulifera → Fistulifera solaris | 3395 | Open in IMG/M |
| 3300020596|Ga0163149_10111823 | Not Available | 1890 | Open in IMG/M |
| 3300020596|Ga0163149_10123422 | All Organisms → Viruses → Predicted Viral | 1766 | Open in IMG/M |
| 3300020596|Ga0163149_10133811 | Not Available | 1668 | Open in IMG/M |
| 3300020596|Ga0163149_10139008 | Not Available | 1624 | Open in IMG/M |
| 3300020596|Ga0163149_10251699 | Not Available | 1049 | Open in IMG/M |
| 3300020596|Ga0163149_10374652 | Not Available | 768 | Open in IMG/M |
| 3300020596|Ga0163149_10417001 | Not Available | 704 | Open in IMG/M |
| 3300020596|Ga0163149_10464407 | Not Available | 645 | Open in IMG/M |
| 3300020596|Ga0163149_10595740 | Not Available | 523 | Open in IMG/M |
| 3300022222|Ga0226658_10418591 | Not Available | 599 | Open in IMG/M |
| 3300022373|Ga0210319_1035181 | Not Available | 500 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat | 98.00% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.00% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005830 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.178_YBM | Environmental | Open in IMG/M |
| 3300015360 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.BULKMAT1 | Environmental | Open in IMG/M |
| 3300020057 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP5.IB-2 | Environmental | Open in IMG/M |
| 3300020192 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica- Oligotrophic Lake LV.19.MP6.G1 | Environmental | Open in IMG/M |
| 3300020201 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP9.P1 | Environmental | Open in IMG/M |
| 3300020203 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica- Oligotrophic Lake LV.19.MP7.P2 | Environmental | Open in IMG/M |
| 3300020219 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP7.G1 | Environmental | Open in IMG/M |
| 3300020596 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP5.G1 | Environmental | Open in IMG/M |
| 3300022222 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.BULKMAT1 (v2) | Environmental | Open in IMG/M |
| 3300022373 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.180 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0074473_110122652 | 3300005830 | Sediment (Intertidal) | AYLMKQFSLIEIISTAVLLAILVVDLLESSMLLTQLHFNLFTGAHLLLMEY* |
| Ga0163144_100460422 | 3300015360 | Freshwater Microbial Mat | MKQFSLLEVVSTVVLHASCVVVDLLESSMLLTQLHFKPPTAAHLLLMEC* |
| Ga0163144_100593533 | 3300015360 | Freshwater Microbial Mat | VMKQFSLIEIISTCSAASYVVVDLSRESSMLLTELHFNVPTGAHLPLMEC* |
| Ga0163144_100598743 | 3300015360 | Freshwater Microbial Mat | VKQISLLEIVSTAALLAMVVVVVVDLLESSMLLTQLHFKLPTGAHMPLMEH* |
| Ga0163144_1010342110 | 3300015360 | Freshwater Microbial Mat | MKQFSLLEIISTAVLLANVVVVDLLESSMLLTQLHFNLLTGAHLLLMEC* |
| Ga0163144_101120855 | 3300015360 | Freshwater Microbial Mat | MKQFSLLEIISTVVLLAIVVVDLLESSMPLTQLHFKLPTGAHLLLMEY* |
| Ga0163144_102105513 | 3300015360 | Freshwater Microbial Mat | VMKQFSLLEIISTVVLLAIVVVDLLESSMPLTQLHFKLPTGSPLLLMEY* |
| Ga0163144_102276551 | 3300015360 | Freshwater Microbial Mat | MRDLLVVQKISLIEITSTAVLLANVVVVVVDLLEPSMSLTQLHFKLPTGAHLLLVEC* |
| Ga0163144_102587534 | 3300015360 | Freshwater Microbial Mat | MKQFSLLEIICTAVLLAIVVVDLLESSMLLTKLHFKLPTGAHLLLMEC* |
| Ga0163144_103744931 | 3300015360 | Freshwater Microbial Mat | MRDLLVMKQFSLLEIISTAVLLANVVVVVDLLESSMLLTQLHFNLLTGAHLLLMEY* |
| Ga0163144_103762801 | 3300015360 | Freshwater Microbial Mat | MKQFSLLEIISTVVLLAVVVVDLLESSMLLTQLHFKLLTGAHLLLME |
| Ga0163144_105769892 | 3300015360 | Freshwater Microbial Mat | MRQFSLIENISTVVLLAIVVVDLLESSMLLTQLHFKLPTGAHLLLMEC* |
| Ga0163144_105833621 | 3300015360 | Freshwater Microbial Mat | MEQFSLLEIISTVVLLANVVVVVVDLLESSMLLTQLHFKLPTGAHMPLMEY* |
| Ga0163144_107718981 | 3300015360 | Freshwater Microbial Mat | MKQFSLIEIVSTAVLLAILVVDLPESSMLLTQLHFTGAHLLLMEHWL |
| Ga0163144_107760061 | 3300015360 | Freshwater Microbial Mat | YLMKQFNLIEIISTVVLLLAMVVDLLESSMLLTQLHFHLFIGAHLPLMEH* |
| Ga0163144_110556151 | 3300015360 | Freshwater Microbial Mat | MLDEETCLMKQFSLLEITSAVVLLAVLLLLLQIFLESSMSLTQLHFKLPTGAHMPL |
| Ga0163144_111703822 | 3300015360 | Freshwater Microbial Mat | VVQKISLLEIISTVVLLAMVVESSMLLAKLHFKLPTGAHLLL |
| Ga0163144_112005871 | 3300015360 | Freshwater Microbial Mat | MIRDLLVVQKISLLEIISTAVLLANVVVVVVDLLESSMLLTQLHFKLPTGAHMPLMEH |
| Ga0163144_112400582 | 3300015360 | Freshwater Microbial Mat | QFSLLEIASTAVLPANVVVVVVDLLESSMLLTQLHFNLPTGAHMPLMEH* |
| Ga0163144_112576341 | 3300015360 | Freshwater Microbial Mat | LLVMKQFSLLEIISTVVLLAIVVVDLLESSMLLTQLHFKLPTGAHMPLMEY* |
| Ga0163144_114014111 | 3300015360 | Freshwater Microbial Mat | MLCDNCWRRDLLVVQKISYVEIISTTVLLATVVVDLSRVFQLLTQLHFNLLTGAHLLLMEH* |
| Ga0163144_116954381 | 3300015360 | Freshwater Microbial Mat | EIISTTVLLATVVVDLSRVFQLLTQLHFNLLTGAHLLLMEC* |
| Ga0163144_117962281 | 3300015360 | Freshwater Microbial Mat | MIKRPACLLKQFSSLEIVSTAALLANVVVVVADLLESSMLLTQLHFKLPTGAHMPL |
| Ga0163151_101098261 | 3300020057 | Freshwater Microbial Mat | MKQFSLLEIISTAVLLANVVVVVVDLLESSTLLTQLHFNVLTGAHLLLMEYQLHQLHFQQ |
| Ga0163151_101479463 | 3300020057 | Freshwater Microbial Mat | VMKQFSLIEIISTCSAASYVVVDLSRESSMLLTELHFNVPTGAHLPLMEC |
| Ga0163151_102361642 | 3300020057 | Freshwater Microbial Mat | FSLIEIISTAVLLANVVVDLLESSMLLTQLHFKLLTGAHMPFMEC |
| Ga0163151_103035971 | 3300020057 | Freshwater Microbial Mat | VMKQFSLLEIIGTVVLLANVVVVVVDLLESSMLLTQLHFKLPTGAHMPLIEY |
| Ga0163151_104293492 | 3300020057 | Freshwater Microbial Mat | MIKRSICLLKQISYVDDISTVVLLATVVVDLLESSMLLTQLHFNLFTGAHLPLVEC |
| Ga0163151_104398282 | 3300020057 | Freshwater Microbial Mat | MKQSSLLEIVSTAVLLANVVVVVVDLPESSMLLTQLHFKLPTGAHMPLMEC |
| Ga0163151_105059462 | 3300020057 | Freshwater Microbial Mat | MRDLLVMKQFSLLEIISTAVLLANVVVVDLLESSMLLTQLHFNLLTGAHLLLMEY |
| Ga0163151_105104201 | 3300020057 | Freshwater Microbial Mat | VVQKINLLEIISTVVLLTMVVESSMLLAKLHFKLPTGAHLLLMEC |
| Ga0163151_105265891 | 3300020057 | Freshwater Microbial Mat | MKQFSLIEIISTAVLLANVVVDLLESSMLLTQLHFKLLTGAHMPFMEC |
| Ga0163151_105550772 | 3300020057 | Freshwater Microbial Mat | MKQFSLLEIVSAVVLLANVVVVVVDLPESSMPLTQLHFKLPTGAHMPLMEC |
| Ga0163147_101640484 | 3300020192 | Freshwater Microbial Mat | MKQFSLIEIISTCSAASYVVVDLSRESSMLLTELHFNVPTGAHLPLMEC |
| Ga0163147_101678521 | 3300020192 | Freshwater Microbial Mat | MEQFSLLEIISTVVLLANVVVVVVDLLESSMLLTQLHFKLPTGAHMPLMEY |
| Ga0163147_102087612 | 3300020192 | Freshwater Microbial Mat | VVQKISLLEIISTAVLLANVVVVDLLESSMLLTQLHFKLPTGAHMPLMEH |
| Ga0163147_102192401 | 3300020192 | Freshwater Microbial Mat | MKQFSLLEIISTVVLLAIVVVDLLESSMLLTQLHFKLLTGAHLLLMQY |
| Ga0163147_102435361 | 3300020192 | Freshwater Microbial Mat | VVQKISLIEIISTVVLLAMVVESSMLLAKLHFKLPTGAHLLLMEY |
| Ga0163147_103453442 | 3300020192 | Freshwater Microbial Mat | LVMKQFSLLEIISTVVLLAIVVVDLLESSMPLTQLHFKLPTGAHLLLMEY |
| Ga0163147_104307911 | 3300020192 | Freshwater Microbial Mat | MLERSICLLKQISLIEIISTVVLLAMVVESSMLLAKLHFKLPTGAHLLLMEY |
| Ga0163147_104420831 | 3300020192 | Freshwater Microbial Mat | MIKRSICLLKQISYVDDISTAVLLATVVVDLLESSMLLTQLHFNLFTGAHLPLMEC |
| Ga0163147_104755761 | 3300020192 | Freshwater Microbial Mat | MLCDNCWRRDLLVVQKISYVEIISTTVLLATVVVDLSRVFQLLTQLHFNLLTGAHLLLME |
| Ga0163147_104831362 | 3300020192 | Freshwater Microbial Mat | IISTTVLLANVVVVVVVDLLESSMLLTQLHFNLLTGAHLLLMEC |
| Ga0163154_101410891 | 3300020201 | Freshwater Microbial Mat | VMKQFSLIEIISTAVLLANVVVDLLESSMLLTQLHFKLLTGAHMPFMEC |
| Ga0163154_103399742 | 3300020201 | Freshwater Microbial Mat | GLRDLLVVQKISLLEIMSTAVLLANVVVVVVDLLESSMLLTQLHFKLPTGAHMPLMEH |
| Ga0163154_104757671 | 3300020201 | Freshwater Microbial Mat | MIRDLLVVQKISLLEIISTTVLLANVVVVVVDLLESSMLLTQLHFNLLTGAHLLLMEC |
| Ga0163148_100114418 | 3300020203 | Freshwater Microbial Mat | MKQFSLLEIISTAVLLAIVVVDLLESSMLLTQLHFKLPTGAHLLLMEC |
| Ga0163148_100240771 | 3300020203 | Freshwater Microbial Mat | LEIVSTVVLLANVVVVVVDLPESSMLLTQLHFKLPTGAHLLLMEH |
| Ga0163148_100355121 | 3300020203 | Freshwater Microbial Mat | MKQFSLLEIISTAVLLANVVVVDLLESSMLLTQLHFNLLTGAHLLLMEC |
| Ga0163148_100373665 | 3300020203 | Freshwater Microbial Mat | VVKQISSLEIISTAALLANVVVVVALQIFLESSMSLTQLHFKLPTGAHMPLVEC |
| Ga0163148_100444954 | 3300020203 | Freshwater Microbial Mat | MKQFSLLEIISTVVLLAIVVVDLLESSMPLTQLHFKLPTGSPLLLMEY |
| Ga0163148_100540632 | 3300020203 | Freshwater Microbial Mat | MKQFSLLEIICTAVLLAIVVVDLLESSMLLTKLHFKLPTGAHLLLMEC |
| Ga0163148_100648614 | 3300020203 | Freshwater Microbial Mat | MLDEETCLMKQFSLLEITSAVVLLAVLLLLLQIFLESSMSLTQLHFKLPTGAHMPLLEC |
| Ga0163148_100692633 | 3300020203 | Freshwater Microbial Mat | VMKQFSLLEIISTAVLLANVVVVVDLLESSMLLTQLHFNLLTGAHLLLMEY |
| Ga0163148_100843252 | 3300020203 | Freshwater Microbial Mat | VMKQFSLIEIISTAVLLANVVVDLLESSMLLTQLHFKLLTGAHMPFMEY |
| Ga0163148_100899644 | 3300020203 | Freshwater Microbial Mat | VVQKISLLEIVSTAVLLANVVVVVVDLLESSMLLTQLHFKLPIGAHMPLAEC |
| Ga0163148_100915031 | 3300020203 | Freshwater Microbial Mat | LLVVQKISLLEIISTVVLLANVVVVVADLLESSMLLTQLHFKLPAGAHMPLMEY |
| Ga0163148_101051583 | 3300020203 | Freshwater Microbial Mat | MMRDLLVMKQFSLIEIISTATVLLAMVVESSRVFHAAVLTQLHFKLLTGAHLLLMEC |
| Ga0163148_101535212 | 3300020203 | Freshwater Microbial Mat | VVQKISLIEIVSTAVLLANVVVVVVDLPESSMSLTQLHFKLPTGAHMPLMEC |
| Ga0163148_101647721 | 3300020203 | Freshwater Microbial Mat | ITSTAVLLANVVVVVVDLLEPSMSLTQLHFKLPTGAHLLLVEC |
| Ga0163148_102174932 | 3300020203 | Freshwater Microbial Mat | MLDEETCLLMKQFSLLEIASTAVLPANVVVVVVDLLESSMLLTQLHFNLPTGAHMPLMEH |
| Ga0163148_102193441 | 3300020203 | Freshwater Microbial Mat | VMKQFSLLEIISTVVLLAIVVVDLLESSMPLTQLHFKLPTGSPLLLM |
| Ga0163148_102227981 | 3300020203 | Freshwater Microbial Mat | MVVIPGTISVKCWMRDLLVVQKISLTEITSTAVLLANVVVVVVDLTEPSMSLTQLHFKPPTGAHLLLVEH |
| Ga0163148_102277013 | 3300020203 | Freshwater Microbial Mat | MKQFSLLEIISTVVLLANVVVVVVDLLESSMLLTQLHFKLPTGAH |
| Ga0163148_102299081 | 3300020203 | Freshwater Microbial Mat | IISTAVLLANVVVVVVDLLESSMLLTQLHFKLPTGAHMPLMEY |
| Ga0163148_102645181 | 3300020203 | Freshwater Microbial Mat | MKQFSLIEIISTAVLLANVVVDLLESSMLLTQLHFKLLTGAHMPLMEY |
| Ga0163148_103149852 | 3300020203 | Freshwater Microbial Mat | MKQFSLLEIISTVVLLAIVVVDLLESSMLLTQLHFKLPTGAHMPLMEY |
| Ga0163148_104132641 | 3300020203 | Freshwater Microbial Mat | MVNIKRPAYLMKQFNLIEIISTVVLLLAMVVDLLESSMLLTQLHFHLFIGAHLPLMEH |
| Ga0163148_104860191 | 3300020203 | Freshwater Microbial Mat | LLEIISTVVLLANVVVAVVDLLESSMLLTQLHFKLPTGAHMPLMEC |
| Ga0163148_105351761 | 3300020203 | Freshwater Microbial Mat | IISTAVLLANVVVVVVDLLESSMLLTQLHFKLPTGAHMPLMEC |
| Ga0163146_100937422 | 3300020219 | Freshwater Microbial Mat | VMKQFSLLEIISTAVLLANVVVVDLLESSMLLTQLHFNLLTGAHLLLMEY |
| Ga0163146_101154852 | 3300020219 | Freshwater Microbial Mat | MIRDLLVVQKISLLEIISTAVLLANVVVVVVDLLESSMLLTQLHFKLPTGAHMPLMEC |
| Ga0163146_101263952 | 3300020219 | Freshwater Microbial Mat | VVQKISLTEIISAVVLLANVVVVVVDLLESSMLLTQLCFNLLTGAHLLLMEH |
| Ga0163146_101428871 | 3300020219 | Freshwater Microbial Mat | MRDLLVMKQFSLLEIISTAVLLANVVVVVDLLESSMLLTQLHFNLLTGAHLLLMEY |
| Ga0163146_101940192 | 3300020219 | Freshwater Microbial Mat | VVQKISLLEIVSTAVLLANVVVVVVDLLESSMLLTQLHFKLPTGAHMPLMEC |
| Ga0163146_101945542 | 3300020219 | Freshwater Microbial Mat | MKQFSSMEITSTVVLLAVVVVDLPESSMLLTQLHFKSLTGAHLLLVEC |
| Ga0163146_104249551 | 3300020219 | Freshwater Microbial Mat | VKQISSLEIVSTVVLLANVVVVVADLLESSMLLTQLHFKLPTGAHLLLVEH |
| Ga0163146_104312081 | 3300020219 | Freshwater Microbial Mat | MLDERDLLVVQKISLLEIISTVVLLAMVVESSMLLAKLHFKLPTGAHLLLMEC |
| Ga0163146_104556552 | 3300020219 | Freshwater Microbial Mat | MVQKISLIEIISTAVLLANVVVVVVDLLESSMLLTQLHFNLLTGAHLLLMEH |
| Ga0163146_105492351 | 3300020219 | Freshwater Microbial Mat | MIRDLLVVQKISLLEIISTVVLLANVVVVVADLLESSMLLTQLHFKLPAGAHMPLMEY |
| Ga0163146_106184851 | 3300020219 | Freshwater Microbial Mat | MKRSICLVKQISLLEIVSTAAVLLAMVVESLESSMLLAKLHFKLPTGAHLLLME |
| Ga0163146_106676711 | 3300020219 | Freshwater Microbial Mat | MKQISLLEIISTAVLLANVGVVVVDLLESSMLLTQLHFKLLTGAHLLLMEC |
| Ga0163149_100157207 | 3300020596 | Freshwater Microbial Mat | MKQFSLLEIISTVVLLAIVVVDLLESSMPLTQLHFKLPTGAHLLLMEY |
| Ga0163149_100233285 | 3300020596 | Freshwater Microbial Mat | MKQFSLLEVVSTVVLHASCVVVDLLESSMLLTQLHFKPPTAAHLLLMEC |
| Ga0163149_100312471 | 3300020596 | Freshwater Microbial Mat | MKQFSLLEIISTAVLLAIVVVDLLESSMLLTQLHFKLPTGAHLL |
| Ga0163149_100463745 | 3300020596 | Freshwater Microbial Mat | MKQFSLIEIISIAVPLAIVVVDLLESSMLLTQLHFNLPP |
| Ga0163149_100536983 | 3300020596 | Freshwater Microbial Mat | MKRSICLVKQISLLEIVSTAAVLLAMVVESLESSMLLAKLHFKLPTGAHLLLMEH |
| Ga0163149_101118232 | 3300020596 | Freshwater Microbial Mat | MKQFSLLEIASTAVLPANVVVVVVDLLESSMLLTQLHFNLPTGAHMPLMEH |
| Ga0163149_101234222 | 3300020596 | Freshwater Microbial Mat | VMRQFSLIENISTVVLLAIVVVDLLESSMLLTQLHFKLPTGAHLLLMEC |
| Ga0163149_101338112 | 3300020596 | Freshwater Microbial Mat | VMKQFSLLEIISTVVLLANVVVVVVDLLESSMLLTQLHFKLPTGAHMPLIEY |
| Ga0163149_101390081 | 3300020596 | Freshwater Microbial Mat | LKRPAYLMKQFSLLEIICTAVLLAIVVVDLLESSMLLTKLHFKLPTGAHLLLMEC |
| Ga0163149_102516992 | 3300020596 | Freshwater Microbial Mat | VVQKISLIEIISTAVLLANVVVVVVDLPESSMPLTQLHFKLPTGAHMPLVEH |
| Ga0163149_102690832 | 3300020596 | Freshwater Microbial Mat | SLLLSGDNFYMTLERDLLVVQKISHVEIVSTAVLLANVVVVVVDLLESSMLLTQLHFKLPTGAHMPLVEC |
| Ga0163149_103746523 | 3300020596 | Freshwater Microbial Mat | VVQKISYIEIISTTVLLATVVVDLSRVFQLLTQLHFNLLTGAHLLLME |
| Ga0163149_104170011 | 3300020596 | Freshwater Microbial Mat | VVQKISLLEIMSTAVLLANVVVVVVDLLESSMLLTQLHFKLPTGAHMP |
| Ga0163149_104413282 | 3300020596 | Freshwater Microbial Mat | MRDLLVVQKISLIEITSTAVLLANVVVVVVDLLEPSMSLTQLHFKLPTGAHLLLVEC |
| Ga0163149_104644071 | 3300020596 | Freshwater Microbial Mat | MIKRSICLLKQISLLEIISTVVLLANVVVVVVDLLESSMLLTQLHFNLFTGAHLPLMEH |
| Ga0163149_105957401 | 3300020596 | Freshwater Microbial Mat | ADKCWVKRPPCLMKQFSLLEIKSAAVLLAIVVADLLESSMMQTQPHFELPTAEHLLLMEC |
| Ga0226658_104185911 | 3300022222 | Freshwater Microbial Mat | MKQFSLLEIISTVVLLAIVVVDLLESSMLLTQLHFKLPTGAHL |
| Ga0210319_10351811 | 3300022373 | Estuarine | MERSIGLLQKISLIEIISTVVLLAIVVVVDLLESSMLLIQLHFNLFAGAHLPLMEY |
| ⦗Top⦘ |