


| Basic Information | |
|---|---|
| Family ID | F104094 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 101 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MEDNSIQRDKPWRPGDYLRLGPSWDEADPIEDFKPQGVPDGED |
| Number of Associated Samples | 86 |
| Number of Associated Scaffolds | 101 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 87.13 % |
| % of genes near scaffold ends (potentially truncated) | 15.84 % |
| % of genes from short scaffolds (< 2000 bps) | 73.27 % |
| Associated GOLD sequencing projects | 74 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.22 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (80.198 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (24.752 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.624 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (65.347 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.22 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 101 Family Scaffolds |
|---|---|---|
| PF03951 | Gln-synt_N | 53.47 |
| PF00120 | Gln-synt_C | 31.68 |
| PF00106 | adh_short | 3.96 |
| PF06831 | H2TH | 0.99 |
| PF02308 | MgtC | 0.99 |
| PF12848 | ABC_tran_Xtn | 0.99 |
| PF00378 | ECH_1 | 0.99 |
| PF03576 | Peptidase_S58 | 0.99 |
| PF13147 | Obsolete Pfam Family | 0.99 |
| COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
|---|---|---|---|
| COG0174 | Glutamine synthetase | Amino acid transport and metabolism [E] | 53.47 |
| COG3191 | L-aminopeptidase/D-esterase | Amino acid transport and metabolism [E] | 1.98 |
| COG0266 | Formamidopyrimidine-DNA glycosylase | Replication, recombination and repair [L] | 0.99 |
| COG1285 | Magnesium uptake protein YhiD/SapB, involved in acid resistance | Inorganic ion transport and metabolism [P] | 0.99 |
| COG3174 | Membrane component of predicted Mg2+ transport system, contains DUF4010 domain | Inorganic ion transport and metabolism [P] | 0.99 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 80.20 % |
| Unclassified | root | N/A | 19.80 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001086|JGI12709J13192_1019798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 520 | Open in IMG/M |
| 3300001089|JGI12683J13190_1015533 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300001369|JGI12701J14581_1014715 | Not Available | 553 | Open in IMG/M |
| 3300001545|JGI12630J15595_10008347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2239 | Open in IMG/M |
| 3300001661|JGI12053J15887_10010855 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 4989 | Open in IMG/M |
| 3300001661|JGI12053J15887_10026361 | All Organisms → cellular organisms → Bacteria | 3259 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101609792 | Not Available | 547 | Open in IMG/M |
| 3300002557|JGI25381J37097_1036786 | Not Available | 827 | Open in IMG/M |
| 3300002558|JGI25385J37094_10000511 | All Organisms → cellular organisms → Bacteria | 10559 | Open in IMG/M |
| 3300002908|JGI25382J43887_10040837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2521 | Open in IMG/M |
| 3300002908|JGI25382J43887_10067383 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1936 | Open in IMG/M |
| 3300002909|JGI25388J43891_1026470 | Not Available | 975 | Open in IMG/M |
| 3300005167|Ga0066672_10082023 | All Organisms → cellular organisms → Bacteria | 1931 | Open in IMG/M |
| 3300005174|Ga0066680_10250895 | All Organisms → cellular organisms → Bacteria | 1124 | Open in IMG/M |
| 3300005175|Ga0066673_10293255 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
| 3300005176|Ga0066679_10804298 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 600 | Open in IMG/M |
| 3300005177|Ga0066690_10084296 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2015 | Open in IMG/M |
| 3300005177|Ga0066690_10161268 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1478 | Open in IMG/M |
| 3300005179|Ga0066684_10009754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 4589 | Open in IMG/M |
| 3300005445|Ga0070708_101430634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 645 | Open in IMG/M |
| 3300005445|Ga0070708_101677555 | Not Available | 591 | Open in IMG/M |
| 3300005447|Ga0066689_10128907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1484 | Open in IMG/M |
| 3300005471|Ga0070698_100000088 | All Organisms → cellular organisms → Bacteria | 72328 | Open in IMG/M |
| 3300005553|Ga0066695_10888838 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 509 | Open in IMG/M |
| 3300005555|Ga0066692_10873103 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 552 | Open in IMG/M |
| 3300005559|Ga0066700_11140574 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 509 | Open in IMG/M |
| 3300005566|Ga0066693_10161109 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300005586|Ga0066691_10269009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1003 | Open in IMG/M |
| 3300006034|Ga0066656_11122504 | Not Available | 506 | Open in IMG/M |
| 3300006173|Ga0070716_100074403 | All Organisms → cellular organisms → Bacteria | 2007 | Open in IMG/M |
| 3300006797|Ga0066659_11279212 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 612 | Open in IMG/M |
| 3300007255|Ga0099791_10555329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 560 | Open in IMG/M |
| 3300007255|Ga0099791_10638191 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 522 | Open in IMG/M |
| 3300007265|Ga0099794_10055340 | Not Available | 1917 | Open in IMG/M |
| 3300007982|Ga0102924_1020095 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 4916 | Open in IMG/M |
| 3300009012|Ga0066710_104356973 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 529 | Open in IMG/M |
| 3300009038|Ga0099829_10337694 | All Organisms → cellular organisms → Bacteria | 1239 | Open in IMG/M |
| 3300009038|Ga0099829_10381919 | All Organisms → cellular organisms → Bacteria | 1163 | Open in IMG/M |
| 3300009088|Ga0099830_10464515 | Not Available | 1029 | Open in IMG/M |
| 3300009088|Ga0099830_10933623 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 718 | Open in IMG/M |
| 3300009089|Ga0099828_10196996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1797 | Open in IMG/M |
| 3300009090|Ga0099827_10014153 | All Organisms → cellular organisms → Bacteria | 5294 | Open in IMG/M |
| 3300009090|Ga0099827_10832137 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 799 | Open in IMG/M |
| 3300010320|Ga0134109_10268520 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 648 | Open in IMG/M |
| 3300010335|Ga0134063_10197509 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 946 | Open in IMG/M |
| 3300011269|Ga0137392_10221594 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1552 | Open in IMG/M |
| 3300012198|Ga0137364_10003174 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 8439 | Open in IMG/M |
| 3300012203|Ga0137399_10019376 | All Organisms → cellular organisms → Bacteria | 4411 | Open in IMG/M |
| 3300012203|Ga0137399_10431142 | All Organisms → cellular organisms → Bacteria | 1101 | Open in IMG/M |
| 3300012918|Ga0137396_10413263 | Not Available | 1000 | Open in IMG/M |
| 3300012927|Ga0137416_10433485 | All Organisms → cellular organisms → Bacteria | 1120 | Open in IMG/M |
| 3300012944|Ga0137410_10705356 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 841 | Open in IMG/M |
| 3300012977|Ga0134087_10662825 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 548 | Open in IMG/M |
| 3300015193|Ga0167668_1018372 | All Organisms → cellular organisms → Bacteria | 1572 | Open in IMG/M |
| 3300015245|Ga0137409_10296087 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1424 | Open in IMG/M |
| 3300018433|Ga0066667_10596089 | Not Available | 921 | Open in IMG/M |
| 3300018482|Ga0066669_10233800 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1438 | Open in IMG/M |
| 3300021046|Ga0215015_11096318 | All Organisms → cellular organisms → Bacteria | 1254 | Open in IMG/M |
| 3300021307|Ga0179585_1104498 | Not Available | 780 | Open in IMG/M |
| 3300022557|Ga0212123_10109832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2224 | Open in IMG/M |
| 3300022691|Ga0248483_165902 | All Organisms → cellular organisms → Bacteria | 1135 | Open in IMG/M |
| 3300022724|Ga0242665_10083288 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
| 3300025939|Ga0207665_10078171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2272 | Open in IMG/M |
| 3300026277|Ga0209350_1134732 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 555 | Open in IMG/M |
| 3300026296|Ga0209235_1036085 | All Organisms → cellular organisms → Bacteria | 2504 | Open in IMG/M |
| 3300026310|Ga0209239_1155981 | Not Available | 898 | Open in IMG/M |
| 3300026314|Ga0209268_1015166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2955 | Open in IMG/M |
| 3300026317|Ga0209154_1055704 | All Organisms → cellular organisms → Bacteria | 1750 | Open in IMG/M |
| 3300026325|Ga0209152_10118693 | Not Available | 1005 | Open in IMG/M |
| 3300026326|Ga0209801_1005191 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 7214 | Open in IMG/M |
| 3300026327|Ga0209266_1044677 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2227 | Open in IMG/M |
| 3300026371|Ga0257179_1002021 | All Organisms → cellular organisms → Bacteria | 1579 | Open in IMG/M |
| 3300026548|Ga0209161_10235207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 973 | Open in IMG/M |
| 3300026550|Ga0209474_10377620 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300026551|Ga0209648_10037657 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4196 | Open in IMG/M |
| 3300026551|Ga0209648_10421318 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300027181|Ga0208997_1007247 | All Organisms → cellular organisms → Bacteria | 1428 | Open in IMG/M |
| 3300027388|Ga0208995_1011565 | Not Available | 1502 | Open in IMG/M |
| 3300027521|Ga0209524_1063476 | Not Available | 776 | Open in IMG/M |
| 3300027535|Ga0209734_1003242 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2843 | Open in IMG/M |
| 3300027565|Ga0209219_1109409 | Not Available | 678 | Open in IMG/M |
| 3300027587|Ga0209220_1001541 | All Organisms → cellular organisms → Bacteria | 6395 | Open in IMG/M |
| 3300027587|Ga0209220_1007746 | All Organisms → cellular organisms → Bacteria | 2865 | Open in IMG/M |
| 3300027587|Ga0209220_1009303 | All Organisms → cellular organisms → Bacteria | 2625 | Open in IMG/M |
| 3300027591|Ga0209733_1024411 | All Organisms → cellular organisms → Bacteria | 1630 | Open in IMG/M |
| 3300027610|Ga0209528_1026561 | All Organisms → cellular organisms → Bacteria | 1279 | Open in IMG/M |
| 3300027645|Ga0209117_1199048 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 506 | Open in IMG/M |
| 3300027651|Ga0209217_1002738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 5810 | Open in IMG/M |
| 3300027669|Ga0208981_1140654 | Not Available | 614 | Open in IMG/M |
| 3300027681|Ga0208991_1003248 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4808 | Open in IMG/M |
| 3300027684|Ga0209626_1015813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1765 | Open in IMG/M |
| 3300027727|Ga0209328_10023999 | All Organisms → cellular organisms → Bacteria | 1872 | Open in IMG/M |
| 3300027748|Ga0209689_1149145 | All Organisms → cellular organisms → Bacteria | 1126 | Open in IMG/M |
| 3300027846|Ga0209180_10131844 | All Organisms → cellular organisms → Bacteria | 1435 | Open in IMG/M |
| 3300027846|Ga0209180_10488353 | Not Available | 691 | Open in IMG/M |
| 3300027862|Ga0209701_10334467 | Not Available | 861 | Open in IMG/M |
| 3300027882|Ga0209590_10008777 | All Organisms → cellular organisms → Bacteria | 4617 | Open in IMG/M |
| 3300028536|Ga0137415_10519501 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 999 | Open in IMG/M |
| 3300028536|Ga0137415_11491941 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 501 | Open in IMG/M |
| 3300030975|Ga0099845_1004357 | Not Available | 602 | Open in IMG/M |
| 3300030975|Ga0099845_1599421 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1274 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 24.75% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 22.77% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 21.78% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 12.87% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.95% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.97% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.98% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.99% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.99% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001086 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 | Environmental | Open in IMG/M |
| 3300001089 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 | Environmental | Open in IMG/M |
| 3300001369 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 | Environmental | Open in IMG/M |
| 3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002909 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015193 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021307 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_06_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022691 | Soil microbial communities from Calhoun CZO, South Carolina, United States - 60cm depth | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026371 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-B | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027181 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027388 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027535 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027669 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300030975 | Forest soil eukaryotic communities from Alaska, USA, for a soil warming experiment in a boreal forest - Alaskan Soil AK pilot (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12709J13192_10197981 | 3300001086 | Forest Soil | MEDKSVQRDKPWRPGDYLRLGPSWDELEPVEDSKPKGVPDGED* |
| JGI12683J13190_10155332 | 3300001089 | Forest Soil | MEDNSVHRDKPWRPGDYPPPGPSWDEADPSEEFKPQGVPNGED* |
| JGI12701J14581_10147152 | 3300001369 | Forest Soil | MEDNSVHRDKPWRPGDYPPPGPSWDEADPIEEFKPQGVPNGED* |
| JGI12630J15595_100083473 | 3300001545 | Forest Soil | MEYPVRDKPWRPGDYPPPGPSWDEDDRTQTSEPSGVPDGED* |
| JGI12053J15887_100108554 | 3300001661 | Forest Soil | MEDNSIQRDKPWRPGDYLRLGPSWDEADPIEDFKPQGVPDGED* |
| JGI12053J15887_100263615 | 3300001661 | Forest Soil | MEDNSIQRDKPWRPGDYPPLGPSWDELEAVEDSKLRGVPDGED* |
| JGIcombinedJ26739_1016097922 | 3300002245 | Forest Soil | MEDNSVHRDKPWRPGDYPPPGPSWDEADPXEEFKPQGVPNGED* |
| JGI25381J37097_10367862 | 3300002557 | Grasslands Soil | MEDNSIQRDKPWRPGDYLRLGPSWDEAEPIEDFKPLGVPDG |
| JGI25385J37094_1000051113 | 3300002558 | Grasslands Soil | MEDNSVQRDKPWRPGDYLRLGPSWEEPEPIEDVRPIGVPDGED* |
| JGI25382J43887_100408372 | 3300002908 | Grasslands Soil | MEDNSVQRDKPWRPGDYLRLGPSWEEPVPIEDVRPIGVPDGED* |
| JGI25382J43887_100673834 | 3300002908 | Grasslands Soil | TQKRSTVMEDNSVQRDKPWRPGDYLRLGPSWEEAEPIEDFKPIGVPDGED* |
| JGI25388J43891_10264702 | 3300002909 | Grasslands Soil | MDDNSIQRDKPWRPGDYLRLGPSWEEPQPIDDVIPLGVPDGED* |
| Ga0066672_100820232 | 3300005167 | Soil | MEDNSIQRDKPWRPGDYLRLGPSWDEAEPIEDFKPLGVPDGED* |
| Ga0066680_102508952 | 3300005174 | Soil | MEDNSVQRDKPWRPGDYPRPGPSWDETGPIEDVRPQGVPNGED* |
| Ga0066673_102932552 | 3300005175 | Soil | MDDNSIQRDKPWRPGDYLRLGPSWQEPPPIEDFKPLGVPDGED* |
| Ga0066679_108042981 | 3300005176 | Soil | EDKSIRRDKPWRPGDYPPLGPSWDELEPVEDSKPRGVPDGED* |
| Ga0066690_100842961 | 3300005177 | Soil | MEDNSVQRDKPWRPGDYPRPGPSWDETDPVDDLRPQGVPNGED* |
| Ga0066690_101612681 | 3300005177 | Soil | KRSTVMEDNSIQRDKPWRPGDYLRLGPSWDEAEPIEDFKPLGVPDGED* |
| Ga0066684_100097543 | 3300005179 | Soil | MDDNSIQRDKPWRPGDYLRLGPSWEEPQPIEDFKPLGVPDGED* |
| Ga0070708_1014306341 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MEDNSIQRDKPWRPGDYPRLGPSWDETDPIEDLRPQGVPDGED* |
| Ga0070708_1016775551 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MEDKSVPRDKPWRPGDYLRLGPSWDETDPIDDVKPLGVPDGED* |
| Ga0066689_101289072 | 3300005447 | Soil | MEDNSVQRDKPWRPGDYPRPGPSWDETGPIEDLRPQGVPNGED* |
| Ga0070698_10000008855 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MEDNSIQRDKPWRPGDYPPLGPSWDEMDPIEDSKPQGVPDGED* |
| Ga0066695_108888381 | 3300005553 | Soil | QRDKPWRPGDYLRLGPSWQEPPPIEDFKPLGVPDGED* |
| Ga0066692_108731032 | 3300005555 | Soil | DNSIQRDKPWRPGDYLRLGPSWEEPQPIDDVIPLGVPDGED* |
| Ga0066700_111405741 | 3300005559 | Soil | MEDKSIRRDKPWRPGDYPPLGPSWDELEPVEDSKPRGVPDGED* |
| Ga0066693_101611092 | 3300005566 | Soil | MDDNSIQRDKPWRPGDYLRLGPSWEEPQPIEDFKSLGVPDGED* |
| Ga0066691_102690091 | 3300005586 | Soil | RSNFMEDKSIRRDKPWRPGDYPPLGPSWDELEPVEDSKPRGVPDGED* |
| Ga0066656_111225041 | 3300006034 | Soil | MDDNSIQRDKPWRPGDYLRLGPSWEEPQPIDDVIPL |
| Ga0070716_1000744032 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MEDKSVPRDKPWRPGDYLRLGPSWDETDPIEDVKPLGVPDGED* |
| Ga0066659_112792121 | 3300006797 | Soil | TVMEDNSIQRDKPWRPGDYLRLGPSWEEPQPIDDVIPLGVPDGED* |
| Ga0099791_105553292 | 3300007255 | Vadose Zone Soil | MEDNSIARDKPWRPGDYPRLGPSWDEADPIEDLKPQGVPDGED* |
| Ga0099791_106381911 | 3300007255 | Vadose Zone Soil | NSVHRDKPWRPGDYPRPGPSWDEADTIEDVKPLGVPDGED* |
| Ga0099794_100553401 | 3300007265 | Vadose Zone Soil | MEDNSIARDKPWRPGDYPRLGPSWDEAEPIEDSRPQGVPDGED* |
| Ga0102924_10200954 | 3300007982 | Iron-Sulfur Acid Spring | MEDSSIQRDKPWRPGDYPRPGPSWDEAAPIESFKPQGVPDGED* |
| Ga0066710_1043569732 | 3300009012 | Grasslands Soil | MEDNSVQRDKPWRPGDYPRPGPSWDETGPIEDLRPQGVPNGED |
| Ga0099829_103376942 | 3300009038 | Vadose Zone Soil | MEDNSIQRDKPWRPGDYPRLGPSWDEADPIEDLKPKGVPDGED* |
| Ga0099829_103819192 | 3300009038 | Vadose Zone Soil | MEDNSVQRDKPWRPGDYLRLGPSWDELEPVEDSKPKGVPDGED* |
| Ga0099830_104645152 | 3300009088 | Vadose Zone Soil | MEDNSVQRDKPWRPGDYPRLGPSWDEGDPIEDSKPQGVPDGED* |
| Ga0099830_109336232 | 3300009088 | Vadose Zone Soil | MEDNSIQRDKPWRPGDYPRLGPSWDEADPIEDLRPQGVPDGED* |
| Ga0099828_101969963 | 3300009089 | Vadose Zone Soil | MEDNSIQRDKPWRPGDYPPLGPSWDELEPVEDSKLAGVPDGED* |
| Ga0099827_100141533 | 3300009090 | Vadose Zone Soil | MEDNSIQRDKPWRPGDYPRLGPSWDEMDPTEDLKPQGVPDGED* |
| Ga0099827_108321372 | 3300009090 | Vadose Zone Soil | MEYPVERDKPWRPGDYPRPGPSWDQADTKDSEHQGVPDGED* |
| Ga0134109_102685202 | 3300010320 | Grasslands Soil | LATQKRRTVMEDNSIQRDKPWRPGDYLRLGPSWQEPPPIEDFKPLGVPDGED* |
| Ga0134063_101975092 | 3300010335 | Grasslands Soil | MEDNSIQRDKPWRPGDYLRLGPSWEEPQPIDDVIPLGVPDGED* |
| Ga0137392_102215942 | 3300011269 | Vadose Zone Soil | MEDNSIQRDKPWRPGDYPRLGPSWDEAEPIEDSRPQGVPDGED* |
| Ga0137364_100031745 | 3300012198 | Vadose Zone Soil | MEDNSIQRDKPWRPGDYLRLGPSWDEAQPIEDFKPLGVPDGED* |
| Ga0137399_100193762 | 3300012203 | Vadose Zone Soil | MEDNSVHRDKPWRPGDYPRPGPSWDEADTIEDVKPLGVPDGED* |
| Ga0137399_104311422 | 3300012203 | Vadose Zone Soil | MTAEDPKERDKPWRPGDYPRLGPSWDEADPIEDSKPKGVPDGED* |
| Ga0137396_104132632 | 3300012918 | Vadose Zone Soil | MEEHPKERDKPWRPGDYPRLGPSWDEAEPIENAEHQGVPDAED* |
| Ga0137416_104334852 | 3300012927 | Vadose Zone Soil | MEDTSVHRDKPRRPGDYPRPGPSWDEADTIEDVKPLGVPDGED* |
| Ga0137410_107053561 | 3300012944 | Vadose Zone Soil | NVMEDNSVHRDKPWRPGDYPRPGPSWDEADTIEDVKPLGVPDGED* |
| Ga0134087_106628251 | 3300012977 | Grasslands Soil | KPWRPGDYLRLGPSWEEPQPIEDFKPLGVPDGED* |
| Ga0167668_10183722 | 3300015193 | Glacier Forefield Soil | MEDNSIQRDKPWRPGDYPRLGPSWDELEPVEDSKPKGVPDGED* |
| Ga0137409_102960871 | 3300015245 | Vadose Zone Soil | GRGVNVMEDNSVHRDKPWRPGDYPRPGPSWDEADTIEDVKPLGVPDGED* |
| Ga0066667_105960892 | 3300018433 | Grasslands Soil | MDDNSIQRDKPWRPGDYLRLGPSWDEAEPIEDFKPLGVPDGED |
| Ga0066669_102338002 | 3300018482 | Grasslands Soil | MEDNSIQRDKPWRPGDYLRLGPSWDEAQPIEDFKPLGVPDGED |
| Ga0215015_110963182 | 3300021046 | Soil | MEDNSIQRDKPWRPGDYPQLGPSWDEAEPIEDSRPQGVPDGED |
| Ga0179585_11044982 | 3300021307 | Vadose Zone Soil | MEDNSVQRDKPWRPGDYLRLGPSWEEAEPIEDFKPIGVPDGED |
| Ga0212123_101098322 | 3300022557 | Iron-Sulfur Acid Spring | MEDSSIQRDKPWRPGDYPRPGPSWDEAAPIESFKPQGVPDGED |
| Ga0248483_1659022 | 3300022691 | Soil | MADNSKRRDKPWRPGDYPPLGPSWDQADPTENAEPQGVPDAED |
| Ga0242665_100832882 | 3300022724 | Soil | MEDNSVPRDKPWRPGDYPRLGPSWDDELEPIEGSKPQGVPDGED |
| Ga0207665_100781713 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MEDKSVPRDKPWRPGDYLRLGPSWDETDPIEDVKPLGVPDGED |
| Ga0209350_11347322 | 3300026277 | Grasslands Soil | MEDNSIQRDKPWRPGDYLRLGPSWDEAEPIEDFKPLGVPDGED |
| Ga0209235_10360852 | 3300026296 | Grasslands Soil | MEDNSVQRDKPWRPGDYLRLGPSWEEPEPIEDVRPIGVPDGED |
| Ga0209239_11559812 | 3300026310 | Grasslands Soil | MDDNSIQRDKPWRPGDYLRLGPSWEEPQPIEDFKPLGVPDGED |
| Ga0209268_10151663 | 3300026314 | Soil | MDDNSIQRDKPWRPGDYLRLGPSWQEPPPIEDFKPLGVPDGED |
| Ga0209154_10557042 | 3300026317 | Soil | MEDNSVQRDKPWRPGDYPRPGPSWDETDPVDDLRPQGVPNGED |
| Ga0209152_101186932 | 3300026325 | Soil | MEDNSIQRDKPWRPGDYLRLGPSWDEAEPIEDFRPLGVPDGED |
| Ga0209801_10051917 | 3300026326 | Soil | MDDNSIQRDKPWRPGDYLRLGPSWEEPQPIDDVIPLGVPDGED |
| Ga0209266_10446772 | 3300026327 | Soil | MEDNSVQRDKPWRPGDYPRPGPSWDETGPIEDVRPQGVPNGED |
| Ga0257179_10020212 | 3300026371 | Soil | MEDNSIARDKPWRPGDYPRLGPSWDEVEPIEDSRPEGVPDGED |
| Ga0209161_102352072 | 3300026548 | Soil | SIQRDKPWRPGDYLRLGPSWEEPQPIDDVIPLGVPDGED |
| Ga0209474_103776202 | 3300026550 | Soil | MDDNSIQRDKPWRPGDYLRLGPSWEEPQPIEDFKSLGVPDGED |
| Ga0209648_100376577 | 3300026551 | Grasslands Soil | MEDNSIKRDKLWRPGDYPRLGPSWDEADPIEDVKPQGVPDGED |
| Ga0209648_104213182 | 3300026551 | Grasslands Soil | MEDNSIARDKPWRPGDYPRLGPSWDEADPSEDSRPQGVPDGED |
| Ga0208997_10072471 | 3300027181 | Forest Soil | MEDNSIQRDKPWRPGDYLRLGPSWDEADPIEDFKPQGVPDGED |
| Ga0208995_10115652 | 3300027388 | Forest Soil | MEDNSIQRDKPWRPGDYPPLGPSWDELEPVEDSKLRGVPDGED |
| Ga0209524_10634761 | 3300027521 | Forest Soil | MEDSSVQRDKPWRPGDYPRLGPSWDDELEPAEDSKPKGVPDGED |
| Ga0209734_10032422 | 3300027535 | Forest Soil | MEDNSVQRDKPWRPGDYPPLGPSWDEVDPIENVKPQGVPDGED |
| Ga0209219_11094092 | 3300027565 | Forest Soil | MEDNSVQRDKPWRPGDYPRLGPSWDDELEPAEDSK |
| Ga0209220_10015411 | 3300027587 | Forest Soil | MEDNSVQRDKPWRPGDYPRLGPSWDELEPVEDSKPKGVPDGED |
| Ga0209220_10077462 | 3300027587 | Forest Soil | MEDKSVQRDKPWRPGDYLRLGPSWDELEPVEDSKPKGVPDGED |
| Ga0209220_10093032 | 3300027587 | Forest Soil | MEDNSVQRDKPWRPGDYPRLGPSWDEVDPIEDVKPQGVPDGED |
| Ga0209733_10244112 | 3300027591 | Forest Soil | MEDNSVQRDKPWRPGDYPRLGPSWDDELEPAEDSKPKGVPDGED |
| Ga0209528_10265612 | 3300027610 | Forest Soil | MEDNSIQRDKPWRPGDYPPLGPSWDELDPIENVKPQGVPDGED |
| Ga0209117_11990482 | 3300027645 | Forest Soil | MEDNSVHRDKPWRPGDYPPPGPSWDEADPSEEFKPQGVPNGED |
| Ga0209217_10027385 | 3300027651 | Forest Soil | MEDNSVHRDKPWRPGDYPPPGPSWDEADPIEVFKPQGVPDGED |
| Ga0208981_11406541 | 3300027669 | Forest Soil | MEDNSIQRDKPWRPGDYLRLGPSWDEADPMEDFKPQGVPDGED |
| Ga0208991_10032487 | 3300027681 | Forest Soil | MEDNSIQRDKPWRPGDYPPLGPSWDELEAVEDSKLRGVPDGED |
| Ga0209626_10158132 | 3300027684 | Forest Soil | MEYPVRDKPWRPGDYPPPGPSWDEDDRTQTSEPSGVPDGED |
| Ga0209328_100239992 | 3300027727 | Forest Soil | MEDNSVHRDKPWRPGDYPPPGPSWDEADPIEEFKPQGVPNGED |
| Ga0209689_11491452 | 3300027748 | Soil | MEDNSIQRDKPWRPGDYLRLGPSWDEAEPIEDLKPLGVPDGED |
| Ga0209180_101318442 | 3300027846 | Vadose Zone Soil | MEDNSVQRDKPWRPGDYLRLGPSWDELEPVEDSKPKGVPDGED |
| Ga0209180_104883532 | 3300027846 | Vadose Zone Soil | MEDNSIQRDKPWRPGDYPRLGPSWDEADPIEDLRPQGVPDGED |
| Ga0209701_103344672 | 3300027862 | Vadose Zone Soil | MEDNSVQRDKPWRPGDYPRLGPSWDEGDPIEDSKPQGVPDGED |
| Ga0209590_100087774 | 3300027882 | Vadose Zone Soil | MEDNSIQRDKPWRPGDYPRLGPSWDEMDPTEDLKPQGVPDGED |
| Ga0137415_105195012 | 3300028536 | Vadose Zone Soil | MEDNSVHRDKPWRPGDYPRPGPSWDEADTIEDVKPLGVPDGED |
| Ga0137415_114919411 | 3300028536 | Vadose Zone Soil | MEEHPKERDKPWRPGDYPRLGPSWDEADPIENAEHQGVPDAED |
| Ga0099845_10043572 | 3300030975 | Boreal Forest Soil | MEDNSVQRDKPWRPGDYPRLGPSWDDELEPVEDSKPKGVPDGED |
| Ga0099845_15994212 | 3300030975 | Boreal Forest Soil | MEDNSVQRDKPWRPGDYPRLGPSWGDELEPVEDSKPKGVPDGED |
| ⦗Top⦘ |