


| Basic Information | |
|---|---|
| Family ID | F103945 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 101 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MAGSFTLGFDVEVVNNDAVDLLIGFIWTLATPVASAAIAHW |
| Number of Associated Samples | 84 |
| Number of Associated Scaffolds | 101 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 48.51 % |
| % of genes near scaffold ends (potentially truncated) | 64.36 % |
| % of genes from short scaffolds (< 2000 bps) | 87.13 % |
| Associated GOLD sequencing projects | 79 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (70.297 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (26.733 % of family members) |
| Environment Ontology (ENVO) | Unclassified (43.564 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (46.535 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.48% β-sheet: 0.00% Coil/Unstructured: 56.52% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 101 Family Scaffolds |
|---|---|---|
| PF13668 | Ferritin_2 | 22.77 |
| PF03459 | TOBE | 9.90 |
| PF12697 | Abhydrolase_6 | 2.97 |
| PF10518 | TAT_signal | 1.98 |
| PF01471 | PG_binding_1 | 1.98 |
| PF03625 | DUF302 | 1.98 |
| PF07731 | Cu-oxidase_2 | 0.99 |
| PF12700 | HlyD_2 | 0.99 |
| PF14141 | YqzM | 0.99 |
| PF13884 | Peptidase_S74 | 0.99 |
| PF03713 | DUF305 | 0.99 |
| PF02525 | Flavodoxin_2 | 0.99 |
| PF12146 | Hydrolase_4 | 0.99 |
| PF13358 | DDE_3 | 0.99 |
| PF00561 | Abhydrolase_1 | 0.99 |
| COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
|---|---|---|---|
| COG3439 | Uncharacterized conserved protein, DUF302 family | Function unknown [S] | 1.98 |
| COG2132 | Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) | Cell cycle control, cell division, chromosome partitioning [D] | 0.99 |
| COG3544 | Uncharacterized conserved protein, DUF305 family | Function unknown [S] | 0.99 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 70.30 % |
| Unclassified | root | N/A | 29.70 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459007|GJ61VE201BO681 | Not Available | 513 | Open in IMG/M |
| 2170459011|GKWS7RC01CNUBW | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
| 3300000955|JGI1027J12803_106528463 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300000956|JGI10216J12902_106407915 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300002128|JGI24036J26619_10018288 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1291 | Open in IMG/M |
| 3300002899|JGIcombinedJ43975_10077312 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300004479|Ga0062595_101841864 | Not Available | 577 | Open in IMG/M |
| 3300005093|Ga0062594_101082993 | Not Available | 781 | Open in IMG/M |
| 3300005175|Ga0066673_10073411 | All Organisms → cellular organisms → Bacteria | 1783 | Open in IMG/M |
| 3300005289|Ga0065704_10349266 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 799 | Open in IMG/M |
| 3300005294|Ga0065705_10761628 | Not Available | 626 | Open in IMG/M |
| 3300005338|Ga0068868_102052246 | Not Available | 543 | Open in IMG/M |
| 3300005343|Ga0070687_100481964 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 831 | Open in IMG/M |
| 3300005355|Ga0070671_101668417 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300005356|Ga0070674_101648732 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 579 | Open in IMG/M |
| 3300005436|Ga0070713_100765093 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
| 3300005439|Ga0070711_101818571 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300005536|Ga0070697_100590651 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 975 | Open in IMG/M |
| 3300005555|Ga0066692_10472925 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300005844|Ga0068862_102217625 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300006163|Ga0070715_10655709 | Not Available | 622 | Open in IMG/M |
| 3300006173|Ga0070716_100045209 | All Organisms → cellular organisms → Bacteria | 2471 | Open in IMG/M |
| 3300006797|Ga0066659_10303786 | All Organisms → cellular organisms → Bacteria | 1219 | Open in IMG/M |
| 3300006797|Ga0066659_11057474 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 678 | Open in IMG/M |
| 3300006800|Ga0066660_10623780 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514 | 898 | Open in IMG/M |
| 3300009012|Ga0066710_103858627 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 562 | Open in IMG/M |
| 3300009038|Ga0099829_11387240 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 580 | Open in IMG/M |
| 3300009137|Ga0066709_101304929 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1064 | Open in IMG/M |
| 3300009137|Ga0066709_102569916 | Not Available | 684 | Open in IMG/M |
| 3300009137|Ga0066709_104284056 | Not Available | 520 | Open in IMG/M |
| 3300009553|Ga0105249_13262571 | Not Available | 522 | Open in IMG/M |
| 3300010047|Ga0126382_11431200 | Not Available | 632 | Open in IMG/M |
| 3300010304|Ga0134088_10096681 | All Organisms → cellular organisms → Bacteria | 1387 | Open in IMG/M |
| 3300010336|Ga0134071_10814242 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300010337|Ga0134062_10058834 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula → Pedosphaera parvula Ellin514 | 1581 | Open in IMG/M |
| 3300012200|Ga0137382_10281620 | All Organisms → cellular organisms → Bacteria | 1157 | Open in IMG/M |
| 3300012200|Ga0137382_11189033 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 542 | Open in IMG/M |
| 3300012202|Ga0137363_11602500 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300012203|Ga0137399_10086447 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2394 | Open in IMG/M |
| 3300012203|Ga0137399_10245792 | Not Available | 1466 | Open in IMG/M |
| 3300012205|Ga0137362_10342992 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1293 | Open in IMG/M |
| 3300012205|Ga0137362_11173135 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300012208|Ga0137376_11196789 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300012209|Ga0137379_11231282 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300012354|Ga0137366_10780198 | Not Available | 679 | Open in IMG/M |
| 3300012361|Ga0137360_10493048 | Not Available | 1042 | Open in IMG/M |
| 3300012361|Ga0137360_11025366 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 712 | Open in IMG/M |
| 3300012362|Ga0137361_10531219 | All Organisms → cellular organisms → Bacteria | 1080 | Open in IMG/M |
| 3300012582|Ga0137358_10529196 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300012683|Ga0137398_10427490 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 904 | Open in IMG/M |
| 3300012884|Ga0157300_1092411 | Not Available | 546 | Open in IMG/M |
| 3300012927|Ga0137416_10054951 | All Organisms → cellular organisms → Bacteria | 2813 | Open in IMG/M |
| 3300012929|Ga0137404_10260841 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1491 | Open in IMG/M |
| 3300012929|Ga0137404_10286074 | All Organisms → cellular organisms → Bacteria | 1426 | Open in IMG/M |
| 3300012929|Ga0137404_10633605 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
| 3300012951|Ga0164300_10196252 | Not Available | 985 | Open in IMG/M |
| 3300012957|Ga0164303_10105118 | All Organisms → cellular organisms → Bacteria | 1408 | Open in IMG/M |
| 3300012960|Ga0164301_11215377 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300012960|Ga0164301_11228446 | Not Available | 604 | Open in IMG/M |
| 3300012975|Ga0134110_10040312 | All Organisms → cellular organisms → Bacteria | 1835 | Open in IMG/M |
| 3300012988|Ga0164306_10629582 | Not Available | 844 | Open in IMG/M |
| 3300013306|Ga0163162_13498779 | Not Available | 500 | Open in IMG/M |
| 3300015053|Ga0137405_1226079 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300015053|Ga0137405_1401550 | All Organisms → cellular organisms → Bacteria | 4992 | Open in IMG/M |
| 3300017654|Ga0134069_1282011 | Not Available | 585 | Open in IMG/M |
| 3300018071|Ga0184618_10407176 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300018076|Ga0184609_10295698 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 757 | Open in IMG/M |
| 3300019356|Ga0173481_10156424 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 946 | Open in IMG/M |
| 3300019789|Ga0137408_1310893 | Not Available | 807 | Open in IMG/M |
| 3300019789|Ga0137408_1326911 | All Organisms → cellular organisms → Bacteria | 2130 | Open in IMG/M |
| 3300019789|Ga0137408_1326912 | All Organisms → cellular organisms → Bacteria | 2082 | Open in IMG/M |
| 3300019882|Ga0193713_1193598 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
| 3300019883|Ga0193725_1024046 | Not Available | 1651 | Open in IMG/M |
| 3300019886|Ga0193727_1166013 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300019888|Ga0193751_1030405 | All Organisms → cellular organisms → Bacteria | 2537 | Open in IMG/M |
| 3300020062|Ga0193724_1025247 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1265 | Open in IMG/M |
| 3300020579|Ga0210407_10245169 | All Organisms → cellular organisms → Bacteria | 1396 | Open in IMG/M |
| 3300021080|Ga0210382_10025290 | All Organisms → cellular organisms → Bacteria | 2186 | Open in IMG/M |
| 3300021168|Ga0210406_10617056 | Not Available | 845 | Open in IMG/M |
| 3300021168|Ga0210406_10808782 | Not Available | 713 | Open in IMG/M |
| 3300021344|Ga0193719_10357985 | Not Available | 606 | Open in IMG/M |
| 3300021411|Ga0193709_1105883 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 597 | Open in IMG/M |
| 3300025315|Ga0207697_10030239 | All Organisms → cellular organisms → Bacteria | 2216 | Open in IMG/M |
| 3300025907|Ga0207645_10013899 | All Organisms → cellular organisms → Bacteria | 5400 | Open in IMG/M |
| 3300025928|Ga0207700_11443604 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300026523|Ga0209808_1277640 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300026523|Ga0209808_1318736 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300026538|Ga0209056_10398000 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300026552|Ga0209577_10023766 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5393 | Open in IMG/M |
| 3300026552|Ga0209577_10504108 | Not Available | 803 | Open in IMG/M |
| 3300026557|Ga0179587_10030506 | All Organisms → cellular organisms → Bacteria | 2989 | Open in IMG/M |
| 3300027876|Ga0209974_10172827 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300028381|Ga0268264_12342411 | Not Available | 540 | Open in IMG/M |
| 3300028536|Ga0137415_10134604 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2313 | Open in IMG/M |
| 3300028828|Ga0307312_10642167 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300028881|Ga0307277_10262073 | Not Available | 763 | Open in IMG/M |
| 3300030939|Ga0138303_1437705 | Not Available | 773 | Open in IMG/M |
| 3300030972|Ga0075400_11797479 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300031547|Ga0310887_10576858 | Not Available | 687 | Open in IMG/M |
| 3300031854|Ga0310904_10145483 | All Organisms → cellular organisms → Bacteria | 1370 | Open in IMG/M |
| 3300031854|Ga0310904_11412180 | Not Available | 507 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 26.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 15.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.89% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.94% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.95% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.97% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.98% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 1.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.98% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.99% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.99% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.99% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.99% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.99% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.99% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.99% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.99% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.99% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.99% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.99% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.99% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459007 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect in plug lysis (for fosmid construction) 10-21cm | Environmental | Open in IMG/M |
| 2170459011 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 indirect Gram positive lysis 0-10cm | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002128 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Environmental | Open in IMG/M |
| 3300002899 | Soil microbial communities from Manhattan, Kansas, USA - Combined assembly of Kansas soil 100-500um Nextera (ASSEMBLY_DATE=20140607) | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012884 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
| 3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
| 3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020062 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021411 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3c2 | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300030939 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A9_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300030972 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB4 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| L02_02162130 | 2170459007 | Grass Soil | MAGSFTLGFDVEVVNNDAVELLIGFILGTLATPVASVAIAHW |
| F64_05477520 | 2170459011 | Grass Soil | MAASFTLGFDVEVVNNDAVDLLVDFILRTLATPVASAAIAHW |
| JGI1027J12803_1065284631 | 3300000955 | Soil | GFDFEVVNNDAVDLLIGFIWTLATPIASAAIAHW* |
| JGI10216J12902_1064079152 | 3300000956 | Soil | MAGSFTLGFDVEVVNNDAVDLSIGFIWRLAMPVTSAAIA |
| JGI24036J26619_100182881 | 3300002128 | Corn, Switchgrass And Miscanthus Rhizosphere | MAGSFTLGFDVELVNNDAVDPLIGFIWTLATPVASAAKAHR* |
| JGIcombinedJ43975_100773121 | 3300002899 | Soil | VSALFMAASFTLGFDVEVVNNDAADLLVDFMWTLATPVASAAKAHW* |
| Ga0062595_1018418641 | 3300004479 | Soil | MAASFTLGFDVEVVNNDAADLLVDFMWTLATPVASAAKAHW* |
| Ga0062594_1010829932 | 3300005093 | Soil | TLSSELSSRVSTFMAGSFTLGFDFEVVNNDAVDPLVGFIRALATPVASTTIGHW* |
| Ga0066673_100734112 | 3300005175 | Soil | MVGSFTFGFDVEVVNNDAADLSIGFIWRQAMAVASAAIAHW* |
| Ga0065704_103492662 | 3300005289 | Switchgrass Rhizosphere | GSFTLGFDFEVVNNDAVDLLIGFIWTLATPIASAAIGHW* |
| Ga0065705_107616281 | 3300005294 | Switchgrass Rhizosphere | SKLSSRVSTLFMADSLTLGFDVEVVNNDAVDLWIGFILRLPTPVASAAIAHW* |
| Ga0068868_1020522461 | 3300005338 | Miscanthus Rhizosphere | VAGSFTLGFDVEVVNNDAVDLLIGFMWTLATPVASAAMAHW* |
| Ga0070687_1004819642 | 3300005343 | Switchgrass Rhizosphere | MAGSFTLGFDVELVNNDAVDPLIGFIWTLATPVASAAKAKW* |
| Ga0070671_1016684171 | 3300005355 | Switchgrass Rhizosphere | MAGSFTFGFDVEVLNNDAVDLLIGFIWTLATPVASAAITHW* |
| Ga0070674_1016487322 | 3300005356 | Miscanthus Rhizosphere | MAGSFTLGFDVELVNNDAVDPLIGFIWTLATLVASAAKAKW* |
| Ga0070713_1007650931 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | HVFVLSLGLIMAASFPLGFDVEVVNNDVVDLLVGFIRTLATPVASAAIAHWWDFVVPPMS |
| Ga0070711_1018185711 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | FPLGFDVEVVNNDVVDLLVGFIRTLATPVASAAIAHWWDFVVPPMS* |
| Ga0070697_1005906511 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MAGSFTFGFDVEALNNDAVDLLIGFISTLATPVASAAIMHW* |
| Ga0066692_104729251 | 3300005555 | Soil | RVSTLFMAGSFTLGFDVEVVNNDAGDLLIGFICRLSTPFASAAIALW* |
| Ga0068862_1022176251 | 3300005844 | Switchgrass Rhizosphere | AGSLRLGFDVEVVNNDAVDLLISFIWGLATPVACGAIALR* |
| Ga0070715_106557092 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | FTLGFDVEVVNNDAVDLLVDFIRALATPVASAAIVHW* |
| Ga0070716_1000452093 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MNAVKVSKSPTLFMAGSFTFGFDVEVLNNDAVDLLIGFIWTLATPVASAAITHW* |
| Ga0066659_103037862 | 3300006797 | Soil | MAGSFTLGFDFEVVNNDAVDLLIGFIWGLATPVVSAAIALW* |
| Ga0066659_110574742 | 3300006797 | Soil | MAGSFTLGFDVEVVNNDAVDLLIGFIWRLAVPVASAAIAYTRDFVVPLMR* |
| Ga0066660_106237801 | 3300006800 | Soil | VSTLFMAGSLSLGFDVEVVNNGAVDLLVGFIWGLAPPVVSAAIAHWREFVVPPMR* |
| Ga0066710_1038586271 | 3300009012 | Grasslands Soil | MAASFTLGFDVEIVNNDAVDLLVDFMWTLATPVASAAIAHWWDFVVPSMS |
| Ga0099829_113872401 | 3300009038 | Vadose Zone Soil | MAGSFTLGFDVEVVNNDAVDLLIGFIWTLATPVASAAIAHPRDFVLSRMR* |
| Ga0066709_1013049292 | 3300009137 | Grasslands Soil | MAASFTLGFDVEIVNNDAVDLLVDFMWTLATPVASAAIAHWWDFVVPPMS* |
| Ga0066709_1025699161 | 3300009137 | Grasslands Soil | LLKGFALSSKLSSRVSTLFMAGSFKLGFDVEVVDNDAGDLLISFMWRLATPVASPAIGH* |
| Ga0066709_1042840561 | 3300009137 | Grasslands Soil | MAGSLALGFDVEVVNNDAVDLLVGFIWGLTTAVASAAIPHWRDFLVPPMR* |
| Ga0105249_132625711 | 3300009553 | Switchgrass Rhizosphere | VSTLSMAGSFTLGFDVEVVNNDAVDPAVDFIRALATPVASATIAHW* |
| Ga0126382_114312001 | 3300010047 | Tropical Forest Soil | LGFDVEVVNNDAVDLLSGFIWRLPTPVASAAIAHW* |
| Ga0134088_100966813 | 3300010304 | Grasslands Soil | GFDFEVVNNDAVDLLIGFIWGLATPVVSAAIAHWRDFVVPPMR* |
| Ga0134071_108142421 | 3300010336 | Grasslands Soil | TLFMAGSFTLGFDFEVVNNDAVDLLIGFIWGLATPVVSAAIAHWRDFVVPPMR* |
| Ga0134062_100588342 | 3300010337 | Grasslands Soil | SKLSSRVSTLFMVGSFTFGFDVEVVNNDAVDPSIGFIWRQAMAVASAAIAHW* |
| Ga0137382_102816203 | 3300012200 | Vadose Zone Soil | LSSRVSTLFMAGSFTLGFDFEVVNNDAMDLLIGFIWTLATPVASAAIAHTRDFVVPPMR* |
| Ga0137382_111890332 | 3300012200 | Vadose Zone Soil | FMAGSFTLGFDVELVNNDAVDLSADFIRGLGTPVASAAIAHW* |
| Ga0137363_116025001 | 3300012202 | Vadose Zone Soil | AASFTLGFDVEVVNNDAVDLLVDFMWRVATPVASAAIAHWWDFVVLPMG* |
| Ga0137399_100864472 | 3300012203 | Vadose Zone Soil | MADSLRLGFDVEVVNNDAVDLLIGFMWTLATPVAFAAIAHW* |
| Ga0137399_102457921 | 3300012203 | Vadose Zone Soil | MAGSFTLGFDVELVNNDAVDLSVDFIRGLATPVASAAIARPRDF |
| Ga0137362_103429922 | 3300012205 | Vadose Zone Soil | FMAGSFTLGFDVEVVNSDAVDLLIGFIRTLAAPVASAAIPHW* |
| Ga0137362_111731351 | 3300012205 | Vadose Zone Soil | MAACFTLGFDVEVVNNDAVDLLVDFMWRLATPVASAAI |
| Ga0137376_111967891 | 3300012208 | Vadose Zone Soil | MAGSLALGFDIEVVNNDAVDLLVGFIWGLATPVVSAAIA |
| Ga0137379_112312821 | 3300012209 | Vadose Zone Soil | MAGSFTLGFDVEVVNNDAVDLLIGFIWTLATPVAS |
| Ga0137366_107801981 | 3300012354 | Vadose Zone Soil | GFALSSKLSSRVSTLFMAGSFTLGFDVEVVNNDAVDLSIGFIWRLAMPVTSAAIAHW* |
| Ga0137360_104930481 | 3300012361 | Vadose Zone Soil | RVSTLFMAGSFTLGFDVEVVNSDAVDLLIGFIRTLAMPVASAAIPHW* |
| Ga0137360_110253662 | 3300012361 | Vadose Zone Soil | MAASFPLGFDVEVVNNDAVDLLVGFIWTLATPVASAAIAHWWDFVVPPMS* |
| Ga0137361_105312191 | 3300012362 | Vadose Zone Soil | RVSTLFMAGSFTLGFDVEVVSNDAVDLLVAFIWTLATPVASAAIAHW* |
| Ga0137358_105291962 | 3300012582 | Vadose Zone Soil | MAGSFTLGFDVEVVNNDAVDLLIGFIWTLATPVASAAIAHW* |
| Ga0137398_104274902 | 3300012683 | Vadose Zone Soil | AISPKLSSRVSTFMVGSFTLGFDFEVVNNDAVDLLSGFILRTLATPVASAAIAHW* |
| Ga0157300_10924112 | 3300012884 | Soil | TLGFDVEVVNNDAVDLSIGFIWRLAMPVTSAAIAHW* |
| Ga0137416_100549516 | 3300012927 | Vadose Zone Soil | MAASFTLGFDVEVVNNDAVDLLIGFMWTLATPVAFAAIAHW* |
| Ga0137404_102608412 | 3300012929 | Vadose Zone Soil | MAASFTLGFDVEVVNNDAVDLLVDFMWRLATPVASAAIAHWWDFVVPPMS* |
| Ga0137404_102860743 | 3300012929 | Vadose Zone Soil | MAASGFDVEVVNNDAVDLSIDFMWRLATPVASAAIAHWWDFVVPPMR* |
| Ga0137404_106336051 | 3300012929 | Vadose Zone Soil | TLGFDVEVVNNDAVDLLVDFMWRLATPVASAAIADWWDFVVPPMS* |
| Ga0164300_101962521 | 3300012951 | Soil | MFMAGSFTLGFDVEVVDNDAVDLLVGFIWTLATPVESAAIAHWRDFVVPPVRQCLL |
| Ga0164303_101051182 | 3300012957 | Soil | MSDSLALGFDVEVVNNDAVDLLIGFMWTLATPVASAAMAHW* |
| Ga0164301_112153771 | 3300012960 | Soil | MAGSFTLGFDVELVNNAVDLLIGFIWTLATPVASAT |
| Ga0164301_112284461 | 3300012960 | Soil | SLTLGFDVEVVNNDSVDLLIGFIWRLPTPVASVAIAHW* |
| Ga0134110_100403121 | 3300012975 | Grasslands Soil | KGFALSSKLSSRVSTLFMAGSFKLGFDVEVVDNDAGDLLISFMWRLATPVASPAIGH* |
| Ga0164306_106295823 | 3300012988 | Soil | LFVAASFTVGFDVEVVNNDAVDLLVDFMWTLAPPVASAAISHW* |
| Ga0163162_134987791 | 3300013306 | Switchgrass Rhizosphere | TLGFDVDVANNDAVNLLIDFIGTLATPLASAAKAHW* |
| Ga0137405_12260792 | 3300015053 | Vadose Zone Soil | MAASFTLGFDVEVVNNDADLLVDFMWTLATPVASATTAHWWDFVVPPM |
| Ga0137405_14015507 | 3300015053 | Vadose Zone Soil | MAGSFTLGFDVELVNNDAVDLLVDFMWRLATPIASATTAHW* |
| Ga0134069_12820112 | 3300017654 | Grasslands Soil | VSTLFMVGSFTFGFDVEVVNNDAVDLSIGFIWRQAMAVASAAIAHW |
| Ga0184618_104071761 | 3300018071 | Groundwater Sediment | MAGSFTLGFDVELVNNDAVDLLIGFIWTLATPVASAPI |
| Ga0184609_102956981 | 3300018076 | Groundwater Sediment | MAASFTLGFDVEVVNNDAVDLLVDFMWTLATPVASAAIAHWWDFVVPPMS |
| Ga0173481_101564241 | 3300019356 | Soil | GFALSSKLSSRVSTLFMAGSFTLGFEVEVVNNDGVDLSIGFIWRLAMPVTSAAIAHW |
| Ga0137408_13108932 | 3300019789 | Vadose Zone Soil | GSFTLGFDVELVNNDAVDLLVDFMWRLATPIASATTAHW |
| Ga0137408_13269112 | 3300019789 | Vadose Zone Soil | MAASFTLGFDVEVVNNDAVDLLVDFMWRLATPVASAAIAHWWDFVVPPMN |
| Ga0137408_13269122 | 3300019789 | Vadose Zone Soil | MAASFTLGFDVEVVNNDAVDLLVDFMWRLATPVASAAIAHWWDFVVPPMS |
| Ga0193713_11935982 | 3300019882 | Soil | MAGSLALGFDVEVVNNDAVDLLVGFIWGLATPVVSAAIALW |
| Ga0193725_10240461 | 3300019883 | Soil | MAASFTLGFDVEVVNNDAVDLLVDFMWRLATPVASAAIAHWWDFVVPPM |
| Ga0193727_11660132 | 3300019886 | Soil | MAVSFILGFDVEVVNNDVVDLLVDFMWRLATPVASAAIA |
| Ga0193751_10304051 | 3300019888 | Soil | MAGSFTLGFDVEVVNSDAVDRFIAFIWRLATPVASAAIAHPRDFVVLL |
| Ga0193724_10252472 | 3300020062 | Soil | MAASFTLGFDVEVVNNDTVDLLVDFMWTLATPVASAAIAHWWDFVVPPMS |
| Ga0210407_102451692 | 3300020579 | Soil | MAGSFRLGFDVELVNNDAVDLLIGFIWTLATAVASAAIAHW |
| Ga0210382_100252903 | 3300021080 | Groundwater Sediment | MAASFTLGFDVEVVNNDAVDLLVDFMWTLATPVASAAIAHWWDFVVPPVS |
| Ga0210406_106170561 | 3300021168 | Soil | MAGSFTLGFDVEVVNNDAVDLLIGFIWTLATAVASAAIAHW |
| Ga0210406_108087821 | 3300021168 | Soil | SFRLGFDIEVVNNDAVDLLVDFMWRLATPVASATIAHW |
| Ga0193719_103579851 | 3300021344 | Soil | FMAGSFTLGFDVEVVNNDAVDPLVDFMWRLATPVASAAIAHW |
| Ga0193709_11058831 | 3300021411 | Soil | LSSELSSRVSTLFMADSFTFGFDVEVVNNDAVDLSIGFIWRLAMAVASAAIAHW |
| Ga0207697_100302392 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MAGSFTLGFDVELVNNDAVDPLIGFIWTLATPVASAAKAHR |
| Ga0207645_100138991 | 3300025907 | Miscanthus Rhizosphere | MAASFTLGFDVEVVNNDAADLLVDFMWTLATPVASAAKAHW |
| Ga0207700_114436041 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | LLMAASFPLGFDVEVVNNDVVDLLVGFIWTLATPVASAAIAHWRDFVLPPVRQCLLPLWG |
| Ga0209808_12776401 | 3300026523 | Soil | MAGSFTLGFDFEVVNNDAVDLLIGFIWGLATPVVSAAIAHWRDFVVPPMR |
| Ga0209808_13187361 | 3300026523 | Soil | LIELLKGLTLSSKLYSGVSTIFMAGSFTLGFDVELVNNDAVDLSADFIRGLGTPVASAAIAHW |
| Ga0209056_103980002 | 3300026538 | Soil | MAGSFTLGFDFEVVNNDAVDLLIGFIWGLATPVVS |
| Ga0209577_100237668 | 3300026552 | Soil | IELLKGFALSSKLSSRVSTLFMVGSFTFGFDVEVVNNDAGDLSIGFIWRQAMAVASAAIAHW |
| Ga0209577_105041081 | 3300026552 | Soil | RGLTLSSGLSSGVSTLVMAGSFTLGFDVEVVNSDAVDLLIGFIRTLAAPVASAAIPHW |
| Ga0179587_100305062 | 3300026557 | Vadose Zone Soil | MVGSFTLGFDFEVVNNDAVDLLSGFILRTLATPVASAAIAHW |
| Ga0209974_101728271 | 3300027876 | Arabidopsis Thaliana Rhizosphere | MAGSFTLGFDVEVVNNDAVDLLIGFIWTLATPVASAAIAHW |
| Ga0268264_123424112 | 3300028381 | Switchgrass Rhizosphere | FTLGFDVEVVNNDAVDLLIGFMWTLATPVASAAMAHW |
| Ga0137415_101346044 | 3300028536 | Vadose Zone Soil | SLRLGFDVEVVNNDAVDLLIGFMWTLATPVAFAAIAHW |
| Ga0307312_106421672 | 3300028828 | Soil | MAASFTLGFDVEVVNNDAVDLLVDFMWRLATPIASAAIAHWWDFVLPPMS |
| Ga0307277_102620732 | 3300028881 | Soil | SSRVSTLVITGSLTLGFDFEVVNNDAVYLLICFIRTLATPVGSAAIAHW |
| Ga0138303_14377052 | 3300030939 | Soil | MAGSFTLGFDVELVNNDAVDLSVDFIRGLATPVASAAIA |
| Ga0075400_117974791 | 3300030972 | Soil | MAASFTLGFDVEVVNNDVVDLLVGFIRTLATPVASAAIAHWRDFVVP |
| Ga0310887_105768581 | 3300031547 | Soil | MADSLTLGFDVEVVNNDAVDLWIGFILRLPTPVASAAIA |
| Ga0310904_101454832 | 3300031854 | Soil | SLTLGFDVEVVNNDAVDLLSGFIWRLPTPVASAAIAHW |
| Ga0310904_114121801 | 3300031854 | Soil | KLSSRVSTLFMADSLTLGFDVEVVNNDAVDLWIGFILRLPTPVASAAIAHW |
| ⦗Top⦘ |