


| Basic Information | |
|---|---|
| Family ID | F103927 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 101 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MIINLLATWIPALLIAFLGVLKLLGNPRVVEEMSKLGVGRYLRLL |
| Number of Associated Samples | 85 |
| Number of Associated Scaffolds | 101 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 94.06 % |
| % of genes near scaffold ends (potentially truncated) | 97.03 % |
| % of genes from short scaffolds (< 2000 bps) | 95.05 % |
| Associated GOLD sequencing projects | 81 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (94.059 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (22.772 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.713 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (50.495 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.42% β-sheet: 0.00% Coil/Unstructured: 46.58% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 101 Family Scaffolds |
|---|---|---|
| PF01638 | HxlR | 37.62 |
| PF14499 | DUF4437 | 20.79 |
| PF00440 | TetR_N | 5.94 |
| PF13561 | adh_short_C2 | 1.98 |
| PF01451 | LMWPc | 1.98 |
| PF02678 | Pirin | 1.98 |
| PF02065 | Melibiase | 0.99 |
| PF06736 | TMEM175 | 0.99 |
| PF00175 | NAD_binding_1 | 0.99 |
| PF02801 | Ketoacyl-synt_C | 0.99 |
| PF04264 | YceI | 0.99 |
| PF01061 | ABC2_membrane | 0.99 |
| PF10048 | DUF2282 | 0.99 |
| PF12681 | Glyoxalase_2 | 0.99 |
| PF00857 | Isochorismatase | 0.99 |
| PF02558 | ApbA | 0.99 |
| PF13193 | AMP-binding_C | 0.99 |
| PF07366 | SnoaL | 0.99 |
| PF00085 | Thioredoxin | 0.99 |
| PF12698 | ABC2_membrane_3 | 0.99 |
| PF03358 | FMN_red | 0.99 |
| COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
|---|---|---|---|
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 37.62 |
| COG1741 | Redox-sensitive bicupin YhaK, pirin superfamily | General function prediction only [R] | 1.98 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.99 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.99 |
| COG2353 | Polyisoprenoid-binding periplasmic protein YceI | General function prediction only [R] | 0.99 |
| COG3345 | Alpha-galactosidase | Carbohydrate transport and metabolism [G] | 0.99 |
| COG3548 | Uncharacterized membrane protein | Function unknown [S] | 0.99 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 94.06 % |
| Unclassified | root | N/A | 5.94 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000955|JGI1027J12803_103836361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Bacteriovoracaceae → Bacteriovorax → Bacteriovorax stolpii | 543 | Open in IMG/M |
| 3300004479|Ga0062595_100475500 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
| 3300004479|Ga0062595_102292696 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300005332|Ga0066388_102910035 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 875 | Open in IMG/M |
| 3300005332|Ga0066388_103245219 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 831 | Open in IMG/M |
| 3300005467|Ga0070706_100924548 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 805 | Open in IMG/M |
| 3300005468|Ga0070707_100803367 | Not Available | 904 | Open in IMG/M |
| 3300005468|Ga0070707_102157297 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Bacteriovoracaceae → Bacteriovorax → Bacteriovorax stolpii | 525 | Open in IMG/M |
| 3300005471|Ga0070698_100422579 | All Organisms → cellular organisms → Bacteria | 1267 | Open in IMG/M |
| 3300005518|Ga0070699_101981049 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 532 | Open in IMG/M |
| 3300005552|Ga0066701_10321835 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
| 3300005921|Ga0070766_10973348 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus → Terriglobus albidus | 583 | Open in IMG/M |
| 3300006028|Ga0070717_12160618 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300006049|Ga0075417_10134760 | All Organisms → cellular organisms → Bacteria | 1141 | Open in IMG/M |
| 3300006058|Ga0075432_10390555 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300006163|Ga0070715_11009161 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300006358|Ga0068871_100528003 | All Organisms → cellular organisms → Bacteria | 1066 | Open in IMG/M |
| 3300006844|Ga0075428_102540950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Bacteriovoracaceae → Bacteriovorax → Bacteriovorax stolpii | 524 | Open in IMG/M |
| 3300006852|Ga0075433_10669693 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
| 3300006853|Ga0075420_101882737 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300006871|Ga0075434_101964446 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300006903|Ga0075426_10636715 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300006903|Ga0075426_11540339 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 505 | Open in IMG/M |
| 3300007076|Ga0075435_100607590 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
| 3300007076|Ga0075435_100756145 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
| 3300007255|Ga0099791_10237314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Bacteriovoracaceae → Bacteriovorax → Bacteriovorax stolpii | 863 | Open in IMG/M |
| 3300009012|Ga0066710_102532495 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 741 | Open in IMG/M |
| 3300009088|Ga0099830_11157729 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 642 | Open in IMG/M |
| 3300009147|Ga0114129_10818284 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1187 | Open in IMG/M |
| 3300009522|Ga0116218_1105167 | All Organisms → cellular organisms → Bacteria | 1285 | Open in IMG/M |
| 3300009792|Ga0126374_10974535 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 663 | Open in IMG/M |
| 3300010046|Ga0126384_10653752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Bacteriovoracaceae → Bacteriovorax → Bacteriovorax stolpii | 926 | Open in IMG/M |
| 3300010329|Ga0134111_10312891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Bacteriovoracaceae → Bacteriovorax → Bacteriovorax stolpii | 656 | Open in IMG/M |
| 3300010366|Ga0126379_11294268 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 835 | Open in IMG/M |
| 3300010376|Ga0126381_102208815 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 791 | Open in IMG/M |
| 3300011269|Ga0137392_10191203 | All Organisms → cellular organisms → Bacteria | 1670 | Open in IMG/M |
| 3300011271|Ga0137393_10265551 | All Organisms → cellular organisms → Bacteria | 1458 | Open in IMG/M |
| 3300012189|Ga0137388_11547461 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300012203|Ga0137399_10268598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1402 | Open in IMG/M |
| 3300012209|Ga0137379_11299990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Bacteriovoracaceae → Bacteriovorax → Bacteriovorax stolpii | 633 | Open in IMG/M |
| 3300012211|Ga0137377_10957726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Bacteriovoracaceae → Bacteriovorax → Bacteriovorax stolpii | 787 | Open in IMG/M |
| 3300012363|Ga0137390_11493644 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 617 | Open in IMG/M |
| 3300012363|Ga0137390_11819409 | Not Available | 540 | Open in IMG/M |
| 3300012685|Ga0137397_10170386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Bacteriovoracaceae → Bacteriovorax → Bacteriovorax stolpii | 1616 | Open in IMG/M |
| 3300012685|Ga0137397_10181282 | All Organisms → cellular organisms → Bacteria | 1564 | Open in IMG/M |
| 3300012917|Ga0137395_10799189 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 683 | Open in IMG/M |
| 3300012923|Ga0137359_11547663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Bacteriovoracaceae → Bacteriovorax → Bacteriovorax stolpii | 551 | Open in IMG/M |
| 3300012925|Ga0137419_10630141 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300012927|Ga0137416_12041872 | Not Available | 526 | Open in IMG/M |
| 3300012930|Ga0137407_11329981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Bacteriovoracaceae → Bacteriovorax → Bacteriovorax stolpii | 683 | Open in IMG/M |
| 3300012948|Ga0126375_10277930 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1150 | Open in IMG/M |
| 3300012971|Ga0126369_10435427 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1357 | Open in IMG/M |
| 3300014164|Ga0181532_10709638 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus → Terriglobus albidus | 542 | Open in IMG/M |
| 3300014165|Ga0181523_10818493 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus → Terriglobus albidus | 507 | Open in IMG/M |
| 3300014878|Ga0180065_1069939 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300015054|Ga0137420_1310425 | All Organisms → cellular organisms → Bacteria | 4276 | Open in IMG/M |
| 3300016294|Ga0182041_10785833 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300016422|Ga0182039_10445814 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1108 | Open in IMG/M |
| 3300016422|Ga0182039_11944922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Bacteriovoracaceae → Bacteriovorax → Bacteriovorax stolpii | 540 | Open in IMG/M |
| 3300017927|Ga0187824_10145406 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus → Terriglobus albidus | 783 | Open in IMG/M |
| 3300018476|Ga0190274_13725758 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300021168|Ga0210406_10310460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Bacteriovoracaceae → Bacteriovorax → Bacteriovorax stolpii | 1280 | Open in IMG/M |
| 3300021170|Ga0210400_11530064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Bacteriovoracaceae → Bacteriovorax → Bacteriovorax stolpii | 528 | Open in IMG/M |
| 3300021559|Ga0210409_11156164 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 649 | Open in IMG/M |
| 3300025905|Ga0207685_10680255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Bacteriovoracaceae → Bacteriovorax → Bacteriovorax stolpii | 559 | Open in IMG/M |
| 3300025922|Ga0207646_10017206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp. OHSU_II-uncloned | 6771 | Open in IMG/M |
| 3300025922|Ga0207646_11502455 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 583 | Open in IMG/M |
| 3300025939|Ga0207665_11213692 | Not Available | 602 | Open in IMG/M |
| 3300025941|Ga0207711_10513930 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Bacteriovoracaceae → Bacteriovorax → Bacteriovorax stolpii | 1117 | Open in IMG/M |
| 3300026088|Ga0207641_12401152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Bacteriovoracaceae → Bacteriovorax → Bacteriovorax stolpii | 526 | Open in IMG/M |
| 3300026285|Ga0209438_1006121 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4088 | Open in IMG/M |
| 3300027527|Ga0209684_1011882 | All Organisms → cellular organisms → Bacteria | 1384 | Open in IMG/M |
| 3300027669|Ga0208981_1150041 | Not Available | 592 | Open in IMG/M |
| 3300027669|Ga0208981_1155535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Bacteriovoracaceae → Bacteriovorax → Bacteriovorax stolpii | 580 | Open in IMG/M |
| 3300027869|Ga0209579_10754642 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus → Terriglobus albidus | 526 | Open in IMG/M |
| 3300027873|Ga0209814_10117814 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1132 | Open in IMG/M |
| 3300027875|Ga0209283_10533065 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 752 | Open in IMG/M |
| 3300027875|Ga0209283_10766424 | Not Available | 597 | Open in IMG/M |
| 3300027875|Ga0209283_10819390 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter bradus | 570 | Open in IMG/M |
| 3300027882|Ga0209590_10798606 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 600 | Open in IMG/M |
| 3300027903|Ga0209488_10814317 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300028380|Ga0268265_10549813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Bacteriovoracaceae → Bacteriovorax → Bacteriovorax stolpii | 1096 | Open in IMG/M |
| 3300029636|Ga0222749_10056765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae | 1743 | Open in IMG/M |
| 3300029636|Ga0222749_10316713 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 810 | Open in IMG/M |
| 3300031152|Ga0307501_10145738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Bacteriovoracaceae → Bacteriovorax → Bacteriovorax stolpii | 639 | Open in IMG/M |
| 3300031456|Ga0307513_10866580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Bacteriovoracaceae → Bacteriovorax → Bacteriovorax stolpii | 610 | Open in IMG/M |
| 3300031474|Ga0170818_109113994 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Bacteriovoracaceae → Bacteriovorax → Bacteriovorax stolpii | 576 | Open in IMG/M |
| 3300031720|Ga0307469_10300953 | All Organisms → cellular organisms → Bacteria | 1321 | Open in IMG/M |
| 3300031754|Ga0307475_11225729 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 583 | Open in IMG/M |
| 3300031798|Ga0318523_10204482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Bacteriovoracaceae → Bacteriovorax → Bacteriovorax stolpii | 986 | Open in IMG/M |
| 3300031820|Ga0307473_10306915 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
| 3300031823|Ga0307478_10259416 | All Organisms → cellular organisms → Bacteria | 1414 | Open in IMG/M |
| 3300031912|Ga0306921_10061218 | All Organisms → cellular organisms → Bacteria | 4296 | Open in IMG/M |
| 3300031962|Ga0307479_10679198 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1009 | Open in IMG/M |
| 3300031962|Ga0307479_11198981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Bacteriovoracaceae → Bacteriovorax → Bacteriovorax stolpii | 723 | Open in IMG/M |
| 3300031962|Ga0307479_11434948 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 648 | Open in IMG/M |
| 3300032068|Ga0318553_10610928 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Bacteriovoracaceae → Bacteriovorax → Bacteriovorax stolpii | 571 | Open in IMG/M |
| 3300032160|Ga0311301_10005562 | All Organisms → cellular organisms → Bacteria | 43882 | Open in IMG/M |
| 3300032174|Ga0307470_11498833 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Bacteriovoracaceae → Bacteriovorax → Bacteriovorax stolpii | 561 | Open in IMG/M |
| 3300032174|Ga0307470_11816666 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → unclassified Nitrospiraceae → Nitrospiraceae bacterium | 516 | Open in IMG/M |
| 3300032180|Ga0307471_103969459 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Oligoflexia → Bacteriovoracales → Bacteriovoracaceae → Bacteriovorax → Bacteriovorax stolpii | 523 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 22.77% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 11.88% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 10.89% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 9.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.93% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.97% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.98% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.98% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.98% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.98% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.99% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.99% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.99% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.99% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.99% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.99% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.99% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.99% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014878 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200A_16_10D | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027527 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027669 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031152 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S | Environmental | Open in IMG/M |
| 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Host-Associated | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J12803_1038363611 | 3300000955 | Soil | MVIQLLATWVPALLIGLSGVLKLTRNPKIVETMTALGVGRH |
| Ga0062595_1004755001 | 3300004479 | Soil | MLIHVLATWIPALLIGLSGVLKLTGNPKIVETMTALGVGRRLRLLGVMELAFA |
| Ga0062595_1022926961 | 3300004479 | Soil | VGARIVIQLLATWVPALLIGLSGVLKLTRNPKIVETMTALGVGR |
| Ga0066388_1029100352 | 3300005332 | Tropical Forest Soil | MIINLIATWIPALGIAFLGVLKLTRNARVAREMSELGVGRYLRLL |
| Ga0066388_1032452192 | 3300005332 | Tropical Forest Soil | PALMIALLGVLKLSGIPRIAEEMSKLGVGRYLRLLGVMEIAFAALLSSQPQ* |
| Ga0070706_1009245481 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MIIYLLATWIPALLIALLGVLKLTGNPRVAEEMSKLGVGRYLRLLGVM |
| Ga0070707_1008033671 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MLIQLVATWVPALLIGLSGVLKVSGNPKIVQTMTSLGVGRHVRML |
| Ga0070707_1021572972 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VVQLLATWIPALLIALSGVLKLSGNPKIVEGMAALGVGRYVR |
| Ga0070698_1004225793 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MVIQLLATWIPALLIALSGVLKLSGNPKIVEGMAALGVGRYVRLLGVMEL |
| Ga0070699_1019810491 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MIINLLATWIPALGIAFLGVLKLLGNSRVVEEMSKLGVGRYLR |
| Ga0066701_103218353 | 3300005552 | Soil | MIINLLVSWIPALGIAFLGVLKLLGNSRVVEEMSK |
| Ga0070766_109733481 | 3300005921 | Soil | MTINMFATWIPALLIGVGGVLKLSGNPTIAGEMSKLGVGRY |
| Ga0070717_121606182 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MITNLLATWIPALLIAFLGVLKLTNNPRVVEEMSKVGVGRYLRLLGV |
| Ga0075417_101347602 | 3300006049 | Populus Rhizosphere | MIVQLLATWIPALLIALSGVMKLAGNPKILEGMTTLGVGRYVRLLGVMELA |
| Ga0075432_103905551 | 3300006058 | Populus Rhizosphere | MIINLLATWIPALGIAFLGVLKLTGNPRVAEEMSKLGVGRYLRLLGVME |
| Ga0070715_110091611 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MIINLLATWIPALLIAFLGVLKLLRISRVVEEMSKVGVGRYLR |
| Ga0068871_1005280031 | 3300006358 | Miscanthus Rhizosphere | MLVRLLATWIPALLIGLSGVLKLTGNPKILETMTALGVGR |
| Ga0075428_1025409502 | 3300006844 | Populus Rhizosphere | MLIQLLATWIPALLIGLSGVLKLTGNPKIVETMTAL |
| Ga0075433_106696931 | 3300006852 | Populus Rhizosphere | MIINLLATWIPALGIAFLGALKLTGNPRVAEEMSKVGVGPYLRLLGVME |
| Ga0075420_1018827372 | 3300006853 | Populus Rhizosphere | VVQLLATWIPALLIALSGVLKLSGNPKIVETMTALGVGRHVRLL |
| Ga0075434_1019644462 | 3300006871 | Populus Rhizosphere | MVVQLLATWIPALLIALSGVLKLSGNPKIVETMTALGVGRHVRLL |
| Ga0075426_106367152 | 3300006903 | Populus Rhizosphere | MIINLLTTWIPALGIAFLGVLKLTGNPRVAEEMSKLGVGRYLRLLGVMEIAFA |
| Ga0075426_115403391 | 3300006903 | Populus Rhizosphere | MIINLLATWIPALGIAFLGVLKLTGNPRVAEEMSK |
| Ga0075435_1006075901 | 3300007076 | Populus Rhizosphere | MIINLLATWIPALLIAFLGVLKLLGNPRVVQEMSRV |
| Ga0075435_1007561451 | 3300007076 | Populus Rhizosphere | VVQLLATWIPALLIALSGVLKLSGNPKIVEGMAALGVGRYVRLLGVMEVAFAAL |
| Ga0099791_102373141 | 3300007255 | Vadose Zone Soil | MVVQLLATWIPALLIALSGVLKLSGNPKIVETMTALGVGRHVRVLGVMEVA |
| Ga0066710_1025324951 | 3300009012 | Grasslands Soil | MIINLLATWIPALLIALSGVLKLSGNAKIVESLCRDLSSRA |
| Ga0099830_111577292 | 3300009088 | Vadose Zone Soil | MIINLLATWIPALGIAFLGALKLLGNSRVVEEMSKLGVGRYLRLLGVMEIAFAALF |
| Ga0114129_108182841 | 3300009147 | Populus Rhizosphere | MIINPLATWIPVLGIAFMGVLKLTGNPRIAKELSKLGVG |
| Ga0116218_11051673 | 3300009522 | Peatlands Soil | MIINLFATWIPALLIGIGGLLKLSGNPKIAGEMSKLGVGRYLR |
| Ga0126374_109745351 | 3300009792 | Tropical Forest Soil | AIGTGASMIINLLATWIPALGIAFLGVLKLTGNPRVAEELSKLGVGRYLRLLGVM* |
| Ga0126384_106537521 | 3300010046 | Tropical Forest Soil | MIINLLATWIPALLIGLSGALKLSGNPKIVEGMSKLGVGRYLGLLGVM |
| Ga0134111_103128912 | 3300010329 | Grasslands Soil | MLIHLLATWIPALLIALSGVLKLSGNPKILETMTALGVGRHVR |
| Ga0126379_112942681 | 3300010366 | Tropical Forest Soil | MVIYQLATWMPAVLIAFSGVLKLSGNPKMVGEMSQLGVGRYLRLLG |
| Ga0126381_1022088152 | 3300010376 | Tropical Forest Soil | MIISLLATWIPALGIAFLGVLKLTGSPRVAEEMSKLGVGRYLRLLR |
| Ga0137392_101912031 | 3300011269 | Vadose Zone Soil | MVVQFLATWIPALLIALSGVLKLSGNPKIVEGMAALGVGRYVRLLGVMELAF |
| Ga0137393_102655513 | 3300011271 | Vadose Zone Soil | MVVQALATWIPALLIALSGVLKLSGNPKIMEGMTQLG |
| Ga0137388_115474612 | 3300012189 | Vadose Zone Soil | MIVQLLATWIPALLIALSGVMKLSGSPKILESMTTLGVGRYVRLLGVIELAF |
| Ga0137399_102685981 | 3300012203 | Vadose Zone Soil | MIVQLLATWIPALLIALSGVMKLSGNPKILEGMTTLGVGRYVRLLGVMEL |
| Ga0137379_112999901 | 3300012209 | Vadose Zone Soil | MLIQLLATWIPALMIGLSGVLKLTGNAKIVERMTALGVGRHVRLL |
| Ga0137377_109577261 | 3300012211 | Vadose Zone Soil | MVVQLLATWIPALLIALSGVLKLSGNPKIVEGMAALGVGRYVRLLGVMELVFAALF |
| Ga0137390_114936441 | 3300012363 | Vadose Zone Soil | MIINLLATWIPALGIAFLGVLKLLGNSRVVEEMSKLGVGRYLRLL |
| Ga0137390_118194092 | 3300012363 | Vadose Zone Soil | MIINLLATWIPALLIALLGVLKLTGNPRVAEEMSKLGVGRYLRLLGVMEIA |
| Ga0137397_101703861 | 3300012685 | Vadose Zone Soil | MIVQLLATWIPALLIALSGVMKLSGNSKILEGMTKLGVG |
| Ga0137397_101812821 | 3300012685 | Vadose Zone Soil | MLIHLLATWIPALLIALSGVLKLSGNPKIVETMTALGVGRHLRLLGVMELAF |
| Ga0137395_107991892 | 3300012917 | Vadose Zone Soil | MIINLLATWIPALGIAFLGVLKLTGNPRVAEEMSKLGVGRYLRLLGVMEI |
| Ga0137359_115476631 | 3300012923 | Vadose Zone Soil | MYTTVTIEGRMLIQLLATWIPALLIALSGVLKLSGNPKIVAGMAALGVGRYVRL |
| Ga0137419_106301411 | 3300012925 | Vadose Zone Soil | MITELLATWIPALLIALSGVMKLSGNPKILEGMTALGVGRYVR |
| Ga0137416_120418721 | 3300012927 | Vadose Zone Soil | MIVQLLATWIPALLIALSGVLKLTGSPQVLETMTALGVGRHVRLLGVME |
| Ga0137407_113299811 | 3300012930 | Vadose Zone Soil | MVIQLLATWIPALLIALSGVLKLSGNPKIVEGMAALGGERYVQLLGVMELA |
| Ga0126375_102779303 | 3300012948 | Tropical Forest Soil | MIINLLATWIPALLIALSGALKLSGNPMIVETMSKLG |
| Ga0126369_104354273 | 3300012971 | Tropical Forest Soil | MVIYQFATWMPAVLIAFSGVLKLSGNPKMVQEMSQLGVGRYLRLLGAMEV |
| Ga0181532_107096381 | 3300014164 | Bog | MIINLFATWIPALLIGLGGLLKLSGNPKIAGEMSKLGVGRYLRL |
| Ga0181523_108184931 | 3300014165 | Bog | MIINLFATWIPALLIGLGGLLKLSGNPKIAGEMSKLGVGRYLRLLGV |
| Ga0180065_10699393 | 3300014878 | Soil | MLIQLLATWIPALLIGLSGVLKLTSNPKILETMTALGVGRHVRLLGVMEL |
| Ga0137420_131042510 | 3300015054 | Vadose Zone Soil | MVIQLLATWIPALLIALSVCAEVVGQSEIVEGMAALGVGRYVRLLA* |
| Ga0182041_107858333 | 3300016294 | Soil | MMVERLATWIPALLIALSGVMKWTRNPQILESMTALGVKRY |
| Ga0182039_104458141 | 3300016422 | Soil | MIINLLATWIPALGIAFLGVLKLTGNPRVAEEMSKLGVG |
| Ga0182039_119449221 | 3300016422 | Soil | MVLDLLATWIPALLIALSGVMKLTGNAQILETMKTLGVGR |
| Ga0187824_101454062 | 3300017927 | Freshwater Sediment | MIINMLATWIPAVLIAISGALKLSGIPKIVEQLTKLG |
| Ga0190274_137257582 | 3300018476 | Soil | MLIQLLATWIPALLIGLSGVLKLTGNPKILETMTALGVGRH |
| Ga0210406_103104601 | 3300021168 | Soil | MIINLLAAWIPALLIALSGVMKLSRQPRIVDGMSKLGVGHYLVLLGVMEI |
| Ga0210400_115300641 | 3300021170 | Soil | MIVQLLATWIPALLIALSGVMKLTGNSQVLEAMTA |
| Ga0210409_111561641 | 3300021559 | Soil | MIINLLATWIPALLIALLGVLKLTGNPRVVEEMSK |
| Ga0207685_106802552 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MLIQLLATWIPALLIGLSGVLKLTGNPKILETMTALGVGRHVRLL |
| Ga0207646_100172061 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MIINLIATWIPALGIAFLGVLKLTGNPRVAEEMSKLGVGRYLR |
| Ga0207646_115024551 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MIVNLLATWIPALIIALLGVLKLVGNRQVVQELTALGVGRHLRVLGVMELAFATLFVIPATFKLGFL |
| Ga0207665_112136922 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MIINLLATWIPALGIAFLGILKLTGNPRVAEEMSELGVGRYLRLLGVME |
| Ga0207711_105139302 | 3300025941 | Switchgrass Rhizosphere | MVVQLLATWIPALLIALSGVLKLSGNPKIVETMTALGVGR |
| Ga0207641_124011521 | 3300026088 | Switchgrass Rhizosphere | VVQLLATWIPALLIALSGVLKLSGNPKIVETMTALGVGRH |
| Ga0209438_10061215 | 3300026285 | Grasslands Soil | MLIQLLATWIPALLIGLSGVLKLSGNPRILETMTTL |
| Ga0209684_10118823 | 3300027527 | Tropical Forest Soil | MIINLLATWIPALLVAFLGVLKLTGNARVADEMSKLGV |
| Ga0208981_11500412 | 3300027669 | Forest Soil | MIVQLLATWIPALLIALSGVMKLSGNPKILEGMRTL |
| Ga0208981_11555352 | 3300027669 | Forest Soil | MVIQLLATWVPALLIALSGVLKLSGNPKIVEGMAALGVGRYVRLLG |
| Ga0209579_107546422 | 3300027869 | Surface Soil | MTINLFATWIPALLIGVGGVLKLSGNPTIAGEMSKLGVGRYLR |
| Ga0209814_101178141 | 3300027873 | Populus Rhizosphere | MIVQLLATWIPALLIALSGVMKLAGNPKILEGMTTLGVGRYVRLLGVM |
| Ga0209283_105330652 | 3300027875 | Vadose Zone Soil | MIINLLATWIPALGIAFLGVLKLTGNPRVAEEMSKVGVGRYLRLLGVMEI |
| Ga0209283_107664242 | 3300027875 | Vadose Zone Soil | MIINLLATWIPALLIALLGVLKLTGNPRVAEEMSKL |
| Ga0209283_108193901 | 3300027875 | Vadose Zone Soil | MIVKLLATWIPALMIALLGVLKLAGNRRVIHELTALGVGRHLRVLGV |
| Ga0209590_107986062 | 3300027882 | Vadose Zone Soil | MIINLLATWIPALGIAFLGVLKLLGNSRVVEEMSKLGVGRYLRLLGVMEIAFA |
| Ga0209488_108143171 | 3300027903 | Vadose Zone Soil | MIVKLLATWIPALMIALLGVLKLAGNRRVIHELTALGVGRHLRVLGVMELAFATLFVITATF |
| Ga0268265_105498131 | 3300028380 | Switchgrass Rhizosphere | MIVQVLATWIPALLIALSGVLKLTGNPAILETMTTLGVGPYVR |
| Ga0222749_100567651 | 3300029636 | Soil | MIINLLATWIPALLIAFMGALKLTGNPRIAKELSSLGVGRYL |
| Ga0222749_103167132 | 3300029636 | Soil | MIINLLATWIPAPVIAFLGVLKLTGNPRVAEEMSKLG |
| Ga0307501_101457381 | 3300031152 | Soil | MLIHLLATWIPALLIGLSGVLKLSGNPKILETMTTLGVGRYVRLLGV |
| Ga0307513_108665801 | 3300031456 | Ectomycorrhiza | MLIQLLATWIPALLIGLSGVLKLTGNAKIVEGMAGLG |
| Ga0170818_1091139942 | 3300031474 | Forest Soil | MVIQLLATWIPALMIGLSGVLKLTGNPKIVEAMTTLGVGR |
| Ga0307469_103009531 | 3300031720 | Hardwood Forest Soil | MIINLLATWIPALLIAFLGVLKLLGNPRVVEEMSKLGVGRYLRLL |
| Ga0307475_112257292 | 3300031754 | Hardwood Forest Soil | MIINLVATWIPALGIAFLGVLKLTGNPRVAEEMSKVGVGRDYFAQRVPTK |
| Ga0318523_102044823 | 3300031798 | Soil | MVIELLATWIPALVVALSGAMKLAGNPAILKGMTALGVRRYV |
| Ga0307473_103069151 | 3300031820 | Hardwood Forest Soil | MIINLLATWIPALGIAFLGVLKLTGNPRVAEEMSKL |
| Ga0307478_102594161 | 3300031823 | Hardwood Forest Soil | MIISLLATWIPALLIALLGLLKLSGNPNVAEEMSKAGVGRYLRLLGVMEIAF |
| Ga0306921_100612185 | 3300031912 | Soil | MVIELLATWIPALVVALSGAMKLAGNPAILKGMTAL |
| Ga0307479_106791983 | 3300031962 | Hardwood Forest Soil | MITNLLATWIPALLIAFLGVLKLTNNPRVVEEMSKV |
| Ga0307479_111989812 | 3300031962 | Hardwood Forest Soil | VVQLLATWIPALLIALSGVLKLSGNPKIVEGMAALGVG |
| Ga0307479_114349481 | 3300031962 | Hardwood Forest Soil | MIINLLATWIPALGITFLGVLKLTGNPRVAEEMSKVG |
| Ga0318553_106109281 | 3300032068 | Soil | MIVELLATWIPALVVALSGAMKLAGNPTILEGMTA |
| Ga0311301_1000556237 | 3300032160 | Peatlands Soil | MIITLFATWIPTLLIGVGGVLKLSGNPKIAGEMSKLGVGRYLRLLGGIDIALA |
| Ga0307470_114988331 | 3300032174 | Hardwood Forest Soil | VVQLLATWIPALLIALSGVLKLSGNPKIVETMTALGVGRHVRLLGVM |
| Ga0307470_118166661 | 3300032174 | Hardwood Forest Soil | MIIKLVATWIPALLIAFLGVLKLLGNPRVVQEMSRV |
| Ga0307471_1039694592 | 3300032180 | Hardwood Forest Soil | MLIQLLATWIPALLIGLSGVLKLTGNPKILEAMTAVGVGRHVRLLGVME |
| ⦗Top⦘ |