


| Basic Information | |
|---|---|
| Family ID | F103871 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 101 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MVQIPGLILDYSKKKPPAKAVVYQTYDALAGFIKRPQVALTRR |
| Number of Associated Samples | 79 |
| Number of Associated Scaffolds | 101 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 73.27 % |
| % of genes near scaffold ends (potentially truncated) | 46.53 % |
| % of genes from short scaffolds (< 2000 bps) | 95.05 % |
| Associated GOLD sequencing projects | 78 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.23 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (50.495 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh (21.782 % of family members) |
| Environment Ontology (ENVO) | Unclassified (64.356 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (99.010 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.25% β-sheet: 0.00% Coil/Unstructured: 57.75% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.23 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 101 Family Scaffolds |
|---|---|---|
| PF01053 | Cys_Met_Meta_PP | 31.68 |
| PF02574 | S-methyl_trans | 19.80 |
| PF02955 | GSH-S_ATP | 15.84 |
| PF00903 | Glyoxalase | 7.92 |
| PF12681 | Glyoxalase_2 | 4.95 |
| PF00132 | Hexapep | 2.97 |
| PF01641 | SelR | 1.98 |
| PF00487 | FA_desaturase | 0.99 |
| PF03190 | Thioredox_DsbH | 0.99 |
| PF05050 | Methyltransf_21 | 0.99 |
| PF00581 | Rhodanese | 0.99 |
| PF14489 | QueF | 0.99 |
| PF14129 | DUF4296 | 0.99 |
| PF08443 | RimK | 0.99 |
| COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
|---|---|---|---|
| COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 31.68 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 31.68 |
| COG0189 | Glutathione synthase, LysX or RimK-type ligase, ATP-grasp superfamily | Translation, ribosomal structure and biogenesis [J] | 31.68 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 31.68 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 31.68 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 31.68 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 31.68 |
| COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 31.68 |
| COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 31.68 |
| COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 31.68 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 31.68 |
| COG4100 | Cystathionine beta-lyase family protein involved in aluminum resistance | Inorganic ion transport and metabolism [P] | 31.68 |
| COG0646 | Methionine synthase I (cobalamin-dependent), methyltransferase domain | Amino acid transport and metabolism [E] | 19.80 |
| COG2040 | Homocysteine/selenocysteine methylase (S-methylmethionine-dependent) | Amino acid transport and metabolism [E] | 19.80 |
| COG0229 | Peptide methionine sulfoxide reductase MsrB | Posttranslational modification, protein turnover, chaperones [O] | 1.98 |
| COG1331 | Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains | General function prediction only [R] | 0.99 |
| COG1398 | Fatty-acid desaturase | Lipid transport and metabolism [I] | 0.99 |
| COG3239 | Fatty acid desaturase | Lipid transport and metabolism [I] | 0.99 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 50.50 % |
| Unclassified | root | N/A | 49.50 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001349|JGI20160J14292_10037526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Piscirickettsiaceae → Methylophaga → Methylophaga thiooxydans | 2374 | Open in IMG/M |
| 3300001945|GOS2241_1010970 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1488 | Open in IMG/M |
| 3300001949|GOS2238_1022913 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1518 | Open in IMG/M |
| 3300001955|GOS2237_1021956 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 3847 | Open in IMG/M |
| 3300001957|GOS2250_1026861 | All Organisms → cellular organisms → Bacteria | 1439 | Open in IMG/M |
| 3300001958|GOS2232_1005697 | Not Available | 762 | Open in IMG/M |
| 3300001962|GOS2239_1054445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1911 | Open in IMG/M |
| 3300001965|GOS2243_1029945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1633 | Open in IMG/M |
| 3300001965|GOS2243_1083485 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1771 | Open in IMG/M |
| 3300001966|GOS2245_1090478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 940 | Open in IMG/M |
| 3300001967|GOS2242_1099947 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1659 | Open in IMG/M |
| 3300001974|GOS2246_10024662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1714 | Open in IMG/M |
| 3300002033|GOS24894_10301490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1890 | Open in IMG/M |
| 3300002040|GOScombined01_100120315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1598 | Open in IMG/M |
| 3300002040|GOScombined01_100367027 | Not Available | 866 | Open in IMG/M |
| 3300002040|GOScombined01_103521254 | Not Available | 846 | Open in IMG/M |
| 3300002040|GOScombined01_103697488 | Not Available | 957 | Open in IMG/M |
| 3300002040|GOScombined01_105550695 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 818 | Open in IMG/M |
| 3300002686|Ga0005232J37287_136456 | Not Available | 503 | Open in IMG/M |
| 3300003474|NAP4_1089605 | Not Available | 634 | Open in IMG/M |
| 3300003477|nap3_10076915 | Not Available | 775 | Open in IMG/M |
| 3300004941|Ga0068514_1011981 | Not Available | 923 | Open in IMG/M |
| 3300005074|Ga0070431_1243052 | Not Available | 579 | Open in IMG/M |
| 3300005432|Ga0066845_10381321 | Not Available | 546 | Open in IMG/M |
| 3300005464|Ga0068484_103736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 975 | Open in IMG/M |
| 3300005510|Ga0066825_10231541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → unclassified Pelagibacteraceae → Pelagibacteraceae bacterium BACL5 MAG-120820-bin39 | 680 | Open in IMG/M |
| 3300005510|Ga0066825_10267443 | Not Available | 629 | Open in IMG/M |
| 3300005522|Ga0066861_10219693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 650 | Open in IMG/M |
| 3300005523|Ga0066865_10338061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 570 | Open in IMG/M |
| 3300005934|Ga0066377_10176510 | Not Available | 654 | Open in IMG/M |
| 3300005960|Ga0066364_10135115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 840 | Open in IMG/M |
| 3300005960|Ga0066364_10232131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 642 | Open in IMG/M |
| 3300005971|Ga0066370_10062226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1189 | Open in IMG/M |
| 3300005971|Ga0066370_10307421 | Not Available | 567 | Open in IMG/M |
| 3300005971|Ga0066370_10371572 | Not Available | 516 | Open in IMG/M |
| 3300006024|Ga0066371_10268985 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 533 | Open in IMG/M |
| 3300006027|Ga0075462_10171917 | Not Available | 658 | Open in IMG/M |
| 3300006166|Ga0066836_10613545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 658 | Open in IMG/M |
| 3300006305|Ga0068468_1065987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1277 | Open in IMG/M |
| 3300006329|Ga0068486_1067744 | Not Available | 1567 | Open in IMG/M |
| 3300006334|Ga0099675_1358456 | Not Available | 709 | Open in IMG/M |
| 3300006334|Ga0099675_1410665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1387 | Open in IMG/M |
| 3300006334|Ga0099675_1659220 | Not Available | 692 | Open in IMG/M |
| 3300006337|Ga0068495_1162004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1425 | Open in IMG/M |
| 3300006337|Ga0068495_1433554 | Not Available | 1163 | Open in IMG/M |
| 3300006345|Ga0099693_1037428 | Not Available | 1561 | Open in IMG/M |
| 3300006345|Ga0099693_1344048 | Not Available | 785 | Open in IMG/M |
| 3300006345|Ga0099693_1384412 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 880 | Open in IMG/M |
| 3300006350|Ga0099954_1025611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 653 | Open in IMG/M |
| 3300006350|Ga0099954_1089935 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1756 | Open in IMG/M |
| 3300006351|Ga0099953_1064580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1534 | Open in IMG/M |
| 3300006351|Ga0099953_1422022 | Not Available | 649 | Open in IMG/M |
| 3300006351|Ga0099953_1459816 | Not Available | 1428 | Open in IMG/M |
| 3300006351|Ga0099953_1462302 | Not Available | 654 | Open in IMG/M |
| 3300006385|Ga0079050_1035140 | Not Available | 1182 | Open in IMG/M |
| 3300006400|Ga0075503_1157608 | Not Available | 534 | Open in IMG/M |
| 3300006413|Ga0099963_1059548 | Not Available | 725 | Open in IMG/M |
| 3300006478|Ga0100224_1027081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1171 | Open in IMG/M |
| 3300006480|Ga0100226_1483239 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 516 | Open in IMG/M |
| 3300006481|Ga0100229_1108567 | Not Available | 1720 | Open in IMG/M |
| 3300007041|Ga0101669_119805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 645 | Open in IMG/M |
| 3300007116|Ga0101667_1024157 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
| 3300007137|Ga0101673_1026400 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
| 3300007144|Ga0101670_1045095 | Not Available | 723 | Open in IMG/M |
| 3300007152|Ga0101672_1028765 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 921 | Open in IMG/M |
| 3300007152|Ga0101672_1074175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 582 | Open in IMG/M |
| 3300007329|Ga0079240_1453657 | Not Available | 749 | Open in IMG/M |
| 3300009126|Ga0118723_1071784 | Not Available | 2224 | Open in IMG/M |
| 3300012394|Ga0123365_1015671 | Not Available | 628 | Open in IMG/M |
| 3300012936|Ga0163109_10880039 | Not Available | 654 | Open in IMG/M |
| 3300012954|Ga0163111_11841208 | Not Available | 606 | Open in IMG/M |
| 3300016762|Ga0182084_1267491 | Not Available | 536 | Open in IMG/M |
| 3300017726|Ga0181381_1025937 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1324 | Open in IMG/M |
| 3300017767|Ga0181406_1207435 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 581 | Open in IMG/M |
| 3300017818|Ga0181565_10083376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2277 | Open in IMG/M |
| 3300017818|Ga0181565_10522936 | Not Available | 769 | Open in IMG/M |
| 3300017956|Ga0181580_10173770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1528 | Open in IMG/M |
| 3300017958|Ga0181582_10696375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 612 | Open in IMG/M |
| 3300017964|Ga0181589_10532374 | Not Available | 755 | Open in IMG/M |
| 3300017968|Ga0181587_10366938 | Not Available | 957 | Open in IMG/M |
| 3300018418|Ga0181567_10328466 | Not Available | 1024 | Open in IMG/M |
| 3300018421|Ga0181592_10170084 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1649 | Open in IMG/M |
| 3300018421|Ga0181592_11017468 | Not Available | 533 | Open in IMG/M |
| 3300018426|Ga0181566_10080378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2495 | Open in IMG/M |
| 3300018876|Ga0181564_10091914 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1917 | Open in IMG/M |
| 3300018895|Ga0193547_10013803 | Not Available | 846 | Open in IMG/M |
| 3300019262|Ga0182066_1631876 | Not Available | 775 | Open in IMG/M |
| 3300019266|Ga0182061_1554822 | Not Available | 719 | Open in IMG/M |
| 3300019267|Ga0182069_1605413 | Not Available | 624 | Open in IMG/M |
| 3300019281|Ga0182077_1119839 | Not Available | 803 | Open in IMG/M |
| 3300020014|Ga0182044_1041477 | Not Available | 819 | Open in IMG/M |
| 3300020378|Ga0211527_10074176 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1021 | Open in IMG/M |
| 3300020392|Ga0211666_10150515 | Not Available | 911 | Open in IMG/M |
| 3300020440|Ga0211518_10259332 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 834 | Open in IMG/M |
| 3300020442|Ga0211559_10433094 | Not Available | 606 | Open in IMG/M |
| 3300021364|Ga0213859_10229743 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 853 | Open in IMG/M |
| 3300023105|Ga0255782_10151042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1188 | Open in IMG/M |
| 3300023170|Ga0255761_10280193 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 884 | Open in IMG/M |
| 3300023170|Ga0255761_10381000 | Not Available | 705 | Open in IMG/M |
| 3300023173|Ga0255776_10358951 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 799 | Open in IMG/M |
| 3300023175|Ga0255777_10625392 | Not Available | 529 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 21.78% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 21.78% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 19.80% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 11.88% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 4.95% |
| Volcanic Co2 Seeps | Environmental → Aquatic → Marine → Volcanic → Unclassified → Volcanic Co2 Seeps | 2.97% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 1.98% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.98% |
| Estuarine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Estuarine | 1.98% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 1.98% |
| Volcanic Co2 Seep | Environmental → Aquatic → Marine → Volcanic → Unclassified → Volcanic Co2 Seep | 1.98% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 0.99% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.99% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.99% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.99% |
| Marine Water | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine Water | 0.99% |
| Volcanic Co2 Seep Seawater | Environmental → Aquatic → Marine → Volcanic → Unclassified → Volcanic Co2 Seep Seawater | 0.99% |
| Marine Benthic Sponge Stylissa Massa Associated | Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Marine Benthic Sponge Stylissa Massa Associated | 0.99% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001349 | Pelagic Microbial community sample from North Sea - COGITO 998_met_10 | Environmental | Open in IMG/M |
| 3300001945 | Marine microbial communities from Galapagos, Equador - GS026 | Environmental | Open in IMG/M |
| 3300001949 | Marine microbial communities from Panama City, Panama - GS022 | Environmental | Open in IMG/M |
| 3300001955 | Marine microbial communities from Gulf of Panama, Panama - GS021 | Environmental | Open in IMG/M |
| 3300001957 | Marine microbial communities from Wolf Island, Equador - GS035 | Environmental | Open in IMG/M |
| 3300001958 | Marine microbial communities from Gulf of Mexico, USA - GS016 | Environmental | Open in IMG/M |
| 3300001962 | Marine microbial communities from Cocos Island, Costa Rica - GS023 | Environmental | Open in IMG/M |
| 3300001965 | Marine microbial communities from Coastal Floreana, Equador - GS028 | Environmental | Open in IMG/M |
| 3300001966 | Marine microbial communities from Roca Redonda, Equador - GS030 | Environmental | Open in IMG/M |
| 3300001967 | Marine microbial communities from Devil's Crown, Floreana Island, Equador - GS027 | Environmental | Open in IMG/M |
| 3300001974 | Marine microbial communities from Upwelling, Fernandina Island, Equador - GS031 | Environmental | Open in IMG/M |
| 3300002033 | Marine microbial communities from the Sargasso Sea - GS000a &b | Environmental | Open in IMG/M |
| 3300002040 | GS000c - Sargasso Station 3 | Environmental | Open in IMG/M |
| 3300002686 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - MetaT SI072_135m_B (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300003474 | Estuarine microbial communities from the Sarno estuary, Gulf of Naples, Italy - Sample Station 4 | Environmental | Open in IMG/M |
| 3300003477 | Estuarine microbial communities from the Sarno estuary, Gulf of Naples, Italy - Sample Station 3 | Environmental | Open in IMG/M |
| 3300004941 | Marine water microbial communities from the Pohang Bay, Korea with extracellular vesicles - Pohang-0.2um | Environmental | Open in IMG/M |
| 3300005074 | Marine benthic sponge Stylissa massa associated microbial communities from Guam, USA | Host-Associated | Open in IMG/M |
| 3300005432 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201310SV78 | Environmental | Open in IMG/M |
| 3300005464 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT233_1_0025m | Environmental | Open in IMG/M |
| 3300005510 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306SV45 | Environmental | Open in IMG/M |
| 3300005522 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV257 | Environmental | Open in IMG/M |
| 3300005523 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV265 | Environmental | Open in IMG/M |
| 3300005934 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_SurfaceB_ad_5m_LV_B | Environmental | Open in IMG/M |
| 3300005960 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_SurfaceA_ad_6m_LV_A | Environmental | Open in IMG/M |
| 3300005971 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_SurfaceA_ad_5m_LV_A | Environmental | Open in IMG/M |
| 3300006024 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_DCM_ad_63m_LV_B | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006166 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV91 | Environmental | Open in IMG/M |
| 3300006305 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_1_0025m | Environmental | Open in IMG/M |
| 3300006329 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT233_1_0500m | Environmental | Open in IMG/M |
| 3300006334 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_0025m | Environmental | Open in IMG/M |
| 3300006337 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT237_3_0025m | Environmental | Open in IMG/M |
| 3300006345 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_0075m | Environmental | Open in IMG/M |
| 3300006350 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_0075m | Environmental | Open in IMG/M |
| 3300006351 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_0045m | Environmental | Open in IMG/M |
| 3300006385 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S5 Surf_B metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006400 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006413 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_2_0025m | Environmental | Open in IMG/M |
| 3300006478 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_1_0125m | Environmental | Open in IMG/M |
| 3300006480 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_1_0075m | Environmental | Open in IMG/M |
| 3300006481 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_2_0025m | Environmental | Open in IMG/M |
| 3300007041 | Seawater microbiome, Papua New Guinea CO2 seep, Upa-Upasina 'control', water-ic | Environmental | Open in IMG/M |
| 3300007116 | Seawater microbiome, Papua New Guinea CO2 seep, Upa-Upasina 'bubble' site, waterEBis3 | Environmental | Open in IMG/M |
| 3300007137 | Seawater microbiome, Papua New Guinea CO2 seep, Dobu 'control', water-dc | Environmental | Open in IMG/M |
| 3300007144 | Seawater microbiome, Papua New Guinea CO2 seep, Upa-Upasina 'control', waterEBic1 | Environmental | Open in IMG/M |
| 3300007152 | Seawater microbiome, Papua New Guinea CO2 seep, Dobu 'bubble', waterEBds3 | Environmental | Open in IMG/M |
| 3300007329 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S5 c16 Surf_B metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009126 | Combined Assembly of Gp0139357, Gp0139356 | Environmental | Open in IMG/M |
| 3300012394 | Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_201_2m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012936 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaG | Environmental | Open in IMG/M |
| 3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
| 3300016762 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071413CT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017726 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 | Environmental | Open in IMG/M |
| 3300017767 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20 | Environmental | Open in IMG/M |
| 3300017818 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017956 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017958 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017964 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071410BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017968 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071409AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018418 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018426 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018876 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018895 | Metatranscriptome of marine prokaryotic communities collected during Tara Oceans survey from station TARA_011 - TARA_X100000009 (ERX1408504-ERR1336912) | Environmental | Open in IMG/M |
| 3300019262 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101412AT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019266 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101407AT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019267 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071402VT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019281 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071409AT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020014 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011503CT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020378 | Marine microbial communities from Tara Oceans - TARA_B100000066 (ERX556006-ERR599102) | Environmental | Open in IMG/M |
| 3300020392 | Marine microbial communities from Tara Oceans - TARA_B100000963 (ERX555916-ERR599163) | Environmental | Open in IMG/M |
| 3300020440 | Marine microbial communities from Tara Oceans - TARA_E500000178 (ERX555952-ERR599043) | Environmental | Open in IMG/M |
| 3300020442 | Marine microbial communities from Tara Oceans - TARA_B100002019 (ERX556121-ERR599162) | Environmental | Open in IMG/M |
| 3300021364 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304 | Environmental | Open in IMG/M |
| 3300023105 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG | Environmental | Open in IMG/M |
| 3300023170 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG | Environmental | Open in IMG/M |
| 3300023173 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071413AT metaG | Environmental | Open in IMG/M |
| 3300023175 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI20160J14292_100375261 | 3300001349 | Pelagic Marine | GLILDCSKKKPPAKAGSCDLNALAGFIKRPQVVLTRR* |
| GOS2241_10109702 | 3300001945 | Marine | MVQIPGFILDYSKKKPPTKAGLKDFDALAGFFKRPQVALTRRYVIYSK* |
| GOS2238_10229132 | 3300001949 | Marine | MVQIPGLILDYPKKKPPAKAWSKDFCALAGFIKRPQVALTGAGFLYQ* |
| GOS2237_10219563 | 3300001955 | Marine | MVQIPGLILDYSKKKPPAKAVVYQTSNALAGFIKRPQVVLTQR* |
| GOS2250_10268611 | 3300001957 | Marine | MVQIPGLIYGYSKKKPPTKAGLNDLCALAGFIKRP |
| GOS2232_10056972 | 3300001958 | Marine | MVQIPGLILDYSKKKPPAKAWSEDLCALAGFIKRPQVALTQR* |
| GOS2239_10544454 | 3300001962 | Marine | MVQIPGLIFDLSKKKPPAKAGLKDLCALAGFIKRPQVALTQRLIKI* |
| GOS2243_10299452 | 3300001965 | Marine | MVQIPGLILDYSKKKPPAKAVVFVTLALAGFIKRPQVALTRR* |
| GOS2243_10834853 | 3300001965 | Marine | MVQIPGLILDFSKKKPPAKAGLKDLGALAGFIKRPQVALTQR* |
| GOS2245_10904782 | 3300001966 | Marine | MVQIPGLILDYSKKKPPTKAVVCKTYDALAGFIKRPQVALTRR* |
| GOS2242_10999474 | 3300001967 | Marine | MVQIPDLILDNSKKKPPAKAWSEDFCALAGFIKRPQVALTRR* |
| GOS2246_100246622 | 3300001974 | Marine | MVQIPGLILDYSKKKPPTKAVSYDLNALAGFIKRPQVVLTQR* |
| GOS24894_103014904 | 3300002033 | Marine | MVQIPGLILDYSKKKPPAKAGSEDFCALAGFIKRPQVALTPLDGL |
| GOScombined01_1001203152 | 3300002040 | Marine | MVQIPGLILDYSKKKPPAKAVVYQTYDALAGFIKRPQVALTQR* |
| GOScombined01_1003670272 | 3300002040 | Marine | MVQIPGLIFSLFKKKPPTKAGSLDLNALAGFIKRPQFVLTRRYTIYSKK |
| GOScombined01_1035212541 | 3300002040 | Marine | MVQIPGLILDYSKKKPPTKAGLLDLDALAGFIKRPQVALTRR* |
| GOScombined01_1036974881 | 3300002040 | Marine | MVQIPGLILDFSKKKPPAKAGLNDLCALAGFIKRSQ |
| GOScombined01_1055506952 | 3300002040 | Marine | MVQIPDLILDNSKKKPPAKAGSEDFCALAGFIKRPQVALTRR* |
| Ga0005232J37287_1364561 | 3300002686 | Marine | VYNTVQIPGLILDYSKKKPPTKAVSCDLNALAGFIKRPQV |
| NAP4_10896052 | 3300003474 | Estuarine | YNMVQIPGLILDYSKKKPPAKAVVYQTYDALAGFIKRPQVALTRR* |
| nap3_100769152 | 3300003477 | Estuarine | MVQIPDLILDCSKKKPPTKAGLKDLFALAGFIKRPQVVLTRR* |
| Ga0068514_10119811 | 3300004941 | Marine Water | MVQIPGLILDCSKKKPPTKAVVYQTYDALAGFIKRPQVALTQR* |
| Ga0070431_12430521 | 3300005074 | Marine Benthic Sponge Stylissa Massa Associated | MVQIPGLILNCSKKKPPTKAVVVDLNALAGFIKRPQVVLTRR |
| Ga0066845_103813212 | 3300005432 | Marine | MVQIPGLILDYSKKKPPAKAVVYQTYDALAGFIKRPQVALTRR* |
| Ga0068484_1037362 | 3300005464 | Marine | MVQIPGLISDFSKKKPPAKAGLNDLCALAGFIKRPQVALTQR* |
| Ga0066825_102315411 | 3300005510 | Marine | MVQIPVLILENDKKKPPAKAVVYQTYDALAGFIKRPQVALTRR* |
| Ga0066825_102674432 | 3300005510 | Marine | MVQIPGLILDCSKKKPPAKAVVYQTYDALAGFIKRPQVALTRR* |
| Ga0066861_102196932 | 3300005522 | Marine | MVQIPGLILDYSKKKPPTKAVSFDLNALAGFIKRPQVVLTRR* |
| Ga0066865_103380612 | 3300005523 | Marine | MVQIPGLILDYSKKKPPTKAVVVRLMPLAGFIKRPQVALTQR* |
| Ga0066377_101765102 | 3300005934 | Marine | MVQIPGLVLDCSKKKPPAKAVVVRLMALAGFIKRPQVALTQR* |
| Ga0066364_101351152 | 3300005960 | Marine | MVQIPGLILDFSKKKPPTKAGLKDLGALAGFIKRPQVALTQR* |
| Ga0066364_102321312 | 3300005960 | Marine | MVQIPGLISDCSKKKPPAKAGLNDLCALAGFIKRPQVALTQR* |
| Ga0066370_100622262 | 3300005971 | Marine | MVQIPGLILDFSKKKPPTKAGLKDLGALAGFIKRPQVALTQRWIKYSEN* |
| Ga0066370_103074211 | 3300005971 | Marine | MVQIPGLILDCSKKKPPAKAGLNDLCALAGFIKRPQVALTQR |
| Ga0066370_103715722 | 3300005971 | Marine | SKKKPPTKAGLKDFDALAGFFKRPQVALTQRYKIYSK* |
| Ga0066371_102689852 | 3300006024 | Marine | VYNTVQIPGFYLRKKKPPTKAGLRLNALAGFIKRPQVVITQR* |
| Ga0075462_101719172 | 3300006027 | Aqueous | GLILDCSKKKPPTKAVSCDSNALAGFIKRPQVALTGADGLYQLFQ* |
| Ga0066836_106135452 | 3300006166 | Marine | MVQIPGLILKVQKKTPTKAVAMRLIALAGFIKRSAI* |
| Ga0068468_10659872 | 3300006305 | Marine | MVQIPGLILDCSKKKPPAKAGLKDLCALAGFIKRPQVALTQR* |
| Ga0068486_10677442 | 3300006329 | Marine | MVQIPGLILDFSKKKPPAKAGLLDFNALAGFIKRPQVVLTQRFAIYSKKFRILSTIN* |
| Ga0099675_13584562 | 3300006334 | Marine | MVQIPGLILDCSKKKPPAKAGLNDLCALAGFIKRPQVALTQRL |
| Ga0099675_14106652 | 3300006334 | Marine | MVQIPDLILDCSKKKPPAKAVSLDLNALAGFIKRPQVVLTRR* |
| Ga0099675_16592201 | 3300006334 | Marine | MVQIPGLILDFSKKKPPTKAGLKDLGALAGFIKRPQVALTQR |
| Ga0068495_11620042 | 3300006337 | Marine | MVQIPGLILDFSKKKPPAKAGLNDLCALAGFIKRPQVALTQR* |
| Ga0068495_14335541 | 3300006337 | Marine | MVQIPGLILDCSKKKPPAKAGLNDLCALAGFIKRPQVALTQRLKIYTKK |
| Ga0099693_10374281 | 3300006345 | Marine | MVQIPGLITDFSKKKPPAKAGPNDLCALAGFIKRPQVALTRAD |
| Ga0099693_13440482 | 3300006345 | Marine | MVQIPGFILDYSKKKPPTKAGLKDFDALAGFFKRPQVALTRRYKIYSK* |
| Ga0099693_13844122 | 3300006345 | Marine | MVQIPGLILDYSKKKPPAKAGLYDYCALAGFIKHPQVALTQR* |
| Ga0099954_10256112 | 3300006350 | Marine | MVQIPGLILDCSKKKPPAKAGLKDLGALAGFIKRPQVVLTRR* |
| Ga0099954_10899352 | 3300006350 | Marine | MVQIPGFISDFSKKKPPAKAGLNDICALAGFIKRPQVALTQR* |
| Ga0099953_10645802 | 3300006351 | Marine | MVQIPGLISDCSKKKPPAKAGLNDFCALAGFIKRPQVALTQR* |
| Ga0099953_14220221 | 3300006351 | Marine | MVQIPDLILDYSKKKPPTKAGSFDLNALAGFIKRPQVVLTRR* |
| Ga0099953_14598162 | 3300006351 | Marine | MVQIPGLILDCSKKKPPAKAGLQDLDALAGFFTRPQVVLTGAK |
| Ga0099953_14623022 | 3300006351 | Marine | MVQIPGLILDLSKKKPPAKAGLNDLCALAGFVKRPQVALTQRF* |
| Ga0079050_10351402 | 3300006385 | Marine | MVQIPGLILDFSKKKPPTKAGLKDLGALAGFIKRPQVAL |
| Ga0075503_11576081 | 3300006400 | Aqueous | MVQIPGLILDYSKKKPPTKAGLIDLIALAGFIKAPQFDL |
| Ga0099963_10595481 | 3300006413 | Marine | MVQIPGLILDYSKKKPPTKAGLKDLGALAGFIKRPQVALTQR |
| Ga0100224_10270812 | 3300006478 | Marine | MVQIPGLILDYSKKKPPAKAWSDDFCALAGFIKRPQVALTQRY* |
| Ga0100226_14832392 | 3300006480 | Marine | MVQIPGLIFDCTKKNHLLNGGLNDLCALAGFIKRPQVAITRR* |
| Ga0100229_11085671 | 3300006481 | Marine | MVQIPGLILDYSKKKPPAKAGLNDLCALAGFIKRPQVALTQR* |
| Ga0101669_1198052 | 3300007041 | Volcanic Co2 Seep | MVQIPGLILDCSKKKPPAKAVVYQTYDALAGFIKRPQVVLTRR* |
| Ga0101667_10241573 | 3300007116 | Volcanic Co2 Seep Seawater | MVQIPGLILDCSKKKPPAKAVVYQTNDALAGFIKRPQVALTRR* |
| Ga0101673_10264003 | 3300007137 | Volcanic Co2 Seeps | LDYSKKKPPTKAVVKDLDALAGFIKRPQVALTRR* |
| Ga0101670_10450951 | 3300007144 | Volcanic Co2 Seep | MVQIPGLILDCSKKKPPAKAGLNDLCALAGFIKRPQVALTQRYAIYSEIQDFVNYQLN |
| Ga0101672_10287653 | 3300007152 | Volcanic Co2 Seeps | MVQIPGLILDCSKKKPPAKAVVCQTNDALAGFIKRPQVALTRR* |
| Ga0101672_10741752 | 3300007152 | Volcanic Co2 Seeps | MVQIPGLISDCSKKKPPAKAGLDDLCALAGFIKRPQVALTQR* |
| Ga0079240_14536572 | 3300007329 | Marine | MVQIPGFILDYSKKKPPAKAVVYQTYDALAGFIKRPQVAL |
| Ga0118723_10717841 | 3300009126 | Marine | MVQIPGFLILLCKKKPPTKAVVIWGSVALAGFIKRSQFDLNQRL* |
| Ga0123365_10156712 | 3300012394 | Marine | MVQIPGLILDCSKKKPPAKAVVYQTYDALAGFIKRPQV |
| Ga0163109_108800391 | 3300012936 | Surface Seawater | YNMVQIPGLILDCSKKKPPAKAVVYQTYDALAGFVKRPQVALTRR* |
| Ga0163111_118412081 | 3300012954 | Surface Seawater | MVQIPGLILDCSKKKPPAKAVVYQTNDALAGFIKRPQV |
| Ga0182084_12674911 | 3300016762 | Salt Marsh | MVQIPGLILDCSKKKPPAKAVVYQTYDALAGFIKRPQVALT |
| Ga0181381_10259372 | 3300017726 | Seawater | MVQIPGLILDYSKKKPPAKAVVYQTFDALAGFIKRPQVALTQR |
| Ga0181406_12074352 | 3300017767 | Seawater | MVQIPGLILDYSKKKPPAKAVVVYALAGFIKRPQVVLTQR |
| Ga0181565_100833765 | 3300017818 | Salt Marsh | MVQIPGLILDCSKKKPPAKAVVYQTYDALAGFIKRPQVALTRR |
| Ga0181565_105229361 | 3300017818 | Salt Marsh | MVQIPGLILDCSKKKPPTKAVVYQTYDALAGFIKRPQVALTQR |
| Ga0181580_101737703 | 3300017956 | Salt Marsh | QVYNMVQIPGLILDYSKKKPPAKAVVYQTYDALAGFVKRPQVALTRR |
| Ga0181582_106963752 | 3300017958 | Salt Marsh | MVQIPGLILDYSKKKPPTKAVVYQTYDALAGFIKRPQVALTRR |
| Ga0181589_105323741 | 3300017964 | Salt Marsh | MVQIPGLILDCSKKKPPAKAVVYQTYDALAGFIKRP |
| Ga0181587_103669382 | 3300017968 | Salt Marsh | PGLILDCSKKKPPTKAVVCKTYDALAGFIKRPQVALTRR |
| Ga0181567_103284662 | 3300018418 | Salt Marsh | YNMVQIPGLILDYSKKKPPAKAVVYQTYDALAGFVKRPQVVLTRR |
| Ga0181592_101700841 | 3300018421 | Salt Marsh | VQIPGLILDCSKKKPPTKAVVYQTYDALAGFIKRPQVALTQR |
| Ga0181592_110174681 | 3300018421 | Salt Marsh | GLILDYSKKKPPAKAVVYQTYDALAGFIKRPQVALTRRC |
| Ga0181566_100803785 | 3300018426 | Salt Marsh | LDCSKKKPPAKAVVYQTYDALAGFIKRPQVALTRR |
| Ga0181564_100919142 | 3300018876 | Salt Marsh | MVQIPGLILDYSKKKPPAKAVVYQTYDALAGFVKRPQVALTRR |
| Ga0193547_100138032 | 3300018895 | Marine | MVQIPGLILDYSKKKPPAKAVVYQTYDALAGFIKRPQVALTRRS |
| Ga0182066_16318761 | 3300019262 | Salt Marsh | MVQIPGLILDYSKKKPPAKAVVYQTYDALAGFIKRPQVA |
| Ga0182061_15548222 | 3300019266 | Salt Marsh | MVQIPGLILDCSKKKPPAKAVVYQTNDALAGFIKRPQVA |
| Ga0182069_16054132 | 3300019267 | Salt Marsh | MVQIPGLILDYSKKKPPAKAVVYQTYDALAGFIKRPQVAL |
| Ga0182077_11198392 | 3300019281 | Salt Marsh | MVQIPGLILDCSKKKPPAKAVVYQTYDALAGFIKRPQVA |
| Ga0182044_10414771 | 3300020014 | Salt Marsh | MVQIPGLILDCSKKKPPAKAVVYQTNDALAGFIKRPQVAL |
| Ga0211527_100741761 | 3300020378 | Marine | CQVYNMVQIPGLILDYSKKKPPAKAVVYQTYDALAGFIKRPQVALTRR |
| Ga0211666_101505151 | 3300020392 | Marine | MVQIPGLILDYSKKKPPAKAVVIRLCALAGFIKRPQVALTQRWSI |
| Ga0211518_102593323 | 3300020440 | Marine | GLILDYSKKKPPAKAVVYQTYDALAGFIKRPQVALTRR |
| Ga0211559_104330942 | 3300020442 | Marine | CQVYNMVQIPGLILDCSKKKPPAKAVVYQTYDALAGFIKRPQVALTRR |
| Ga0213859_102297431 | 3300021364 | Seawater | LILDYSKKKPPAKAVVYQTYDALAGFIKRPQVALTRR |
| Ga0255782_101510423 | 3300023105 | Salt Marsh | AKCQVYNMVQIPGLILDCSKKKPPAKAVVYQTYDALAGFIKRPQVALTRR |
| Ga0255761_102801931 | 3300023170 | Salt Marsh | TSAKCQVYNMVQIPGLILDYSKKKPPAKAVVYQTYDALAGFIKRPQVALTRR |
| Ga0255761_103810003 | 3300023170 | Salt Marsh | QIPGLILDCSKKKPPAKAVVCQTYDALAGFIKRPQVALTRR |
| Ga0255776_103589511 | 3300023173 | Salt Marsh | MVQIPGLILDCSKKKPPAKAVVYQTNDALAGFIKRPQVALTRR |
| Ga0255777_106253922 | 3300023175 | Salt Marsh | MVQIPDLILDCSKKKPPAKAVVYQTNDALAGFIKRPQVALTRR |
| ⦗Top⦘ |