


| Basic Information | |
|---|---|
| Family ID | F103864 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 101 |
| Average Sequence Length | 41 residues |
| Representative Sequence | LAGARAAGATEDEVREAISFAIRANAAKTHADILKVYEAP |
| Number of Associated Samples | 92 |
| Number of Associated Scaffolds | 101 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 3.96 % |
| % of genes near scaffold ends (potentially truncated) | 93.07 % |
| % of genes from short scaffolds (< 2000 bps) | 93.07 % |
| Associated GOLD sequencing projects | 87 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.58 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (94.059 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (14.852 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.663 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (33.663 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.53% β-sheet: 0.00% Coil/Unstructured: 51.47% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 101 Family Scaffolds |
|---|---|---|
| PF05175 | MTS | 20.79 |
| PF04794 | YdjC | 14.85 |
| PF00291 | PALP | 3.96 |
| PF06325 | PrmA | 2.97 |
| PF00480 | ROK | 2.97 |
| PF13659 | Obsolete Pfam Family | 2.97 |
| PF00144 | Beta-lactamase | 2.97 |
| PF01799 | Fer2_2 | 1.98 |
| PF00398 | RrnaAD | 0.99 |
| PF08240 | ADH_N | 0.99 |
| PF02475 | Met_10 | 0.99 |
| PF00085 | Thioredoxin | 0.99 |
| PF00578 | AhpC-TSA | 0.99 |
| PF12840 | HTH_20 | 0.99 |
| PF02738 | MoCoBD_1 | 0.99 |
| COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
|---|---|---|---|
| COG3394 | Chitooligosaccharide deacetylase ChbG, YdjC/CelG family | Carbohydrate transport and metabolism [G] | 14.85 |
| COG1940 | Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain | Transcription [K] | 5.94 |
| COG2264 | Ribosomal protein L11 methylase PrmA | Translation, ribosomal structure and biogenesis [J] | 3.96 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 2.97 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 2.97 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 2.97 |
| COG2890 | Methylase of polypeptide chain release factors | Translation, ribosomal structure and biogenesis [J] | 2.97 |
| COG3897 | Protein N-terminal and lysine N-methylase, NNT1/EFM7 family | Posttranslational modification, protein turnover, chaperones [O] | 2.97 |
| COG0030 | 16S rRNA A1518 and A1519 N6-dimethyltransferase RsmA/KsgA/DIM1 (may also have DNA glycosylase/AP lyase activity) | Translation, ribosomal structure and biogenesis [J] | 0.99 |
| COG1092 | 23S rRNA G2069 N7-methylase RlmK or C1962 C5-methylase RlmI | Translation, ribosomal structure and biogenesis [J] | 0.99 |
| COG2265 | tRNA/tmRNA/rRNA uracil-C5-methylase, TrmA/RlmC/RlmD family | Translation, ribosomal structure and biogenesis [J] | 0.99 |
| COG2520 | tRNA G37 N-methylase Trm5 | Translation, ribosomal structure and biogenesis [J] | 0.99 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 94.06 % |
| Unclassified | root | N/A | 5.94 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002120|C687J26616_10171289 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 676 | Open in IMG/M |
| 3300002122|C687J26623_10045231 | All Organisms → cellular organisms → Bacteria | 1187 | Open in IMG/M |
| 3300002123|C687J26634_10018237 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2814 | Open in IMG/M |
| 3300004156|Ga0062589_102251586 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 559 | Open in IMG/M |
| 3300004268|Ga0066398_10123634 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 624 | Open in IMG/M |
| 3300004643|Ga0062591_101927886 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 607 | Open in IMG/M |
| 3300004781|Ga0062379_10133698 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 609 | Open in IMG/M |
| 3300005174|Ga0066680_10566015 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 713 | Open in IMG/M |
| 3300005174|Ga0066680_10851107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → Cupriavidus taiwanensis | 545 | Open in IMG/M |
| 3300005186|Ga0066676_10020491 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 3449 | Open in IMG/M |
| 3300005186|Ga0066676_10376315 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 954 | Open in IMG/M |
| 3300005331|Ga0070670_102098455 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 521 | Open in IMG/M |
| 3300005332|Ga0066388_104032607 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300005446|Ga0066686_11068191 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 520 | Open in IMG/M |
| 3300005446|Ga0066686_11068192 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 520 | Open in IMG/M |
| 3300005467|Ga0070706_100344789 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1389 | Open in IMG/M |
| 3300005468|Ga0070707_100306474 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1543 | Open in IMG/M |
| 3300005547|Ga0070693_100891301 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 666 | Open in IMG/M |
| 3300005574|Ga0066694_10520913 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 554 | Open in IMG/M |
| 3300006049|Ga0075417_10405989 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 675 | Open in IMG/M |
| 3300006169|Ga0082029_1202422 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 587 | Open in IMG/M |
| 3300006806|Ga0079220_11282316 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 612 | Open in IMG/M |
| 3300006914|Ga0075436_100717778 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 741 | Open in IMG/M |
| 3300006918|Ga0079216_10224770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes friuliensis | 1050 | Open in IMG/M |
| 3300006969|Ga0075419_10187102 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1366 | Open in IMG/M |
| 3300007076|Ga0075435_101192960 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 666 | Open in IMG/M |
| 3300007258|Ga0099793_10244365 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300009038|Ga0099829_10625554 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 895 | Open in IMG/M |
| 3300009090|Ga0099827_10430824 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1129 | Open in IMG/M |
| 3300009094|Ga0111539_10840524 | Not Available | 1068 | Open in IMG/M |
| 3300009100|Ga0075418_12096303 | Not Available | 616 | Open in IMG/M |
| 3300009147|Ga0114129_11482820 | Not Available | 834 | Open in IMG/M |
| 3300009148|Ga0105243_11889875 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 630 | Open in IMG/M |
| 3300009162|Ga0075423_10049397 | All Organisms → cellular organisms → Bacteria | 4329 | Open in IMG/M |
| 3300009777|Ga0105164_10172693 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1102 | Open in IMG/M |
| 3300009816|Ga0105076_1114715 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 532 | Open in IMG/M |
| 3300010303|Ga0134082_10099028 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1152 | Open in IMG/M |
| 3300010321|Ga0134067_10496363 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 505 | Open in IMG/M |
| 3300010335|Ga0134063_10008973 | All Organisms → cellular organisms → Bacteria | 3855 | Open in IMG/M |
| 3300010337|Ga0134062_10108747 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1197 | Open in IMG/M |
| 3300010359|Ga0126376_13228213 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 504 | Open in IMG/M |
| 3300010360|Ga0126372_12371023 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 581 | Open in IMG/M |
| 3300010361|Ga0126378_13437696 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Microbacterium → Microbacterium mangrovi | 502 | Open in IMG/M |
| 3300010362|Ga0126377_10919720 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 938 | Open in IMG/M |
| 3300010391|Ga0136847_10118771 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 623 | Open in IMG/M |
| 3300010399|Ga0134127_12899860 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300011438|Ga0137451_1245142 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 565 | Open in IMG/M |
| 3300012199|Ga0137383_10774567 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 700 | Open in IMG/M |
| 3300012200|Ga0137382_10956213 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 616 | Open in IMG/M |
| 3300012203|Ga0137399_10900927 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300012207|Ga0137381_11337380 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 609 | Open in IMG/M |
| 3300012350|Ga0137372_10886333 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 634 | Open in IMG/M |
| 3300012363|Ga0137390_10550052 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
| 3300012401|Ga0134055_1281983 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 743 | Open in IMG/M |
| 3300012685|Ga0137397_10269680 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1268 | Open in IMG/M |
| 3300012922|Ga0137394_10763467 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 812 | Open in IMG/M |
| 3300012922|Ga0137394_10983070 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 702 | Open in IMG/M |
| 3300012923|Ga0137359_10923785 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300014262|Ga0075301_1180887 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 507 | Open in IMG/M |
| 3300014271|Ga0075326_1239922 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 554 | Open in IMG/M |
| 3300014272|Ga0075327_1021289 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1945 | Open in IMG/M |
| 3300018063|Ga0184637_10101367 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1773 | Open in IMG/M |
| 3300018082|Ga0184639_10410969 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 697 | Open in IMG/M |
| 3300018466|Ga0190268_10593514 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 782 | Open in IMG/M |
| 3300018482|Ga0066669_12395260 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 506 | Open in IMG/M |
| 3300019789|Ga0137408_1003420 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1416 | Open in IMG/M |
| 3300021168|Ga0210406_10792266 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 722 | Open in IMG/M |
| 3300025146|Ga0209322_10369194 | Not Available | 562 | Open in IMG/M |
| 3300025164|Ga0209521_10682412 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 500 | Open in IMG/M |
| 3300025167|Ga0209642_10351425 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 831 | Open in IMG/M |
| 3300025173|Ga0209824_10290541 | Not Available | 563 | Open in IMG/M |
| 3300025289|Ga0209002_10277037 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 997 | Open in IMG/M |
| 3300025309|Ga0209212_1182740 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1131 | Open in IMG/M |
| 3300025311|Ga0209343_10398381 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 903 | Open in IMG/M |
| 3300025311|Ga0209343_10485531 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 778 | Open in IMG/M |
| 3300025923|Ga0207681_11566922 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 552 | Open in IMG/M |
| 3300026018|Ga0208418_1036212 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 529 | Open in IMG/M |
| 3300026312|Ga0209153_1063566 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1330 | Open in IMG/M |
| 3300026312|Ga0209153_1084170 | All Organisms → cellular organisms → Bacteria | 1175 | Open in IMG/M |
| 3300026331|Ga0209267_1074482 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1478 | Open in IMG/M |
| 3300026331|Ga0209267_1108346 | All Organisms → cellular organisms → Bacteria | 1177 | Open in IMG/M |
| 3300026334|Ga0209377_1152942 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 869 | Open in IMG/M |
| 3300026529|Ga0209806_1105402 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1190 | Open in IMG/M |
| 3300027013|Ga0209884_1038954 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 513 | Open in IMG/M |
| 3300027765|Ga0209073_10225021 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 721 | Open in IMG/M |
| 3300027873|Ga0209814_10518159 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 529 | Open in IMG/M |
| 3300027880|Ga0209481_10431792 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 677 | Open in IMG/M |
| 3300027882|Ga0209590_10063520 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2102 | Open in IMG/M |
| 3300030619|Ga0268386_10987839 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 519 | Open in IMG/M |
| 3300031548|Ga0307408_101468679 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 644 | Open in IMG/M |
| 3300031720|Ga0307469_11213135 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 713 | Open in IMG/M |
| 3300031731|Ga0307405_10945543 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 732 | Open in IMG/M |
| 3300031740|Ga0307468_100159949 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1462 | Open in IMG/M |
| 3300031911|Ga0307412_10287838 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1293 | Open in IMG/M |
| 3300031911|Ga0307412_10464412 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1046 | Open in IMG/M |
| 3300031949|Ga0214473_10538912 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1297 | Open in IMG/M |
| 3300031965|Ga0326597_10638245 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1132 | Open in IMG/M |
| 3300032180|Ga0307471_100339795 | Not Available | 1607 | Open in IMG/M |
| 3300032205|Ga0307472_100064440 | All Organisms → cellular organisms → Bacteria | 2359 | Open in IMG/M |
| 3300032205|Ga0307472_100082705 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2142 | Open in IMG/M |
| 3300034178|Ga0364934_0224527 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 711 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 14.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 12.87% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 9.90% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.95% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.95% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.96% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 3.96% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 3.96% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 3.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.97% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.97% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.97% |
| Wastewater | Environmental → Aquatic → Freshwater → Drinking Water → Unchlorinated → Wastewater | 1.98% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 1.98% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.98% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.98% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.98% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.99% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.99% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.99% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.99% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.99% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.99% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.99% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.99% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.99% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002120 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 | Environmental | Open in IMG/M |
| 3300002122 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_2 | Environmental | Open in IMG/M |
| 3300002123 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_3 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300004781 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare2Fresh | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009777 | Wastewater microbial communities from Netherlands to study Microbial Dark Matter (Phase II) - VDW unchlorinated drinking water | Environmental | Open in IMG/M |
| 3300009816 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011438 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT500_2 | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012401 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300014262 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D1 | Environmental | Open in IMG/M |
| 3300014271 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D2 | Environmental | Open in IMG/M |
| 3300014272 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailB_D1 | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300025146 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 1 | Environmental | Open in IMG/M |
| 3300025164 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 4 | Environmental | Open in IMG/M |
| 3300025167 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025173 | Wastewater microbial communities from Netherlands to study Microbial Dark Matter (Phase II) - VDW unchlorinated drinking water (SPAdes) | Environmental | Open in IMG/M |
| 3300025289 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 2 | Environmental | Open in IMG/M |
| 3300025309 | Soil microbial communities from Rifle, Colorado, USA - Groundwater C2 | Environmental | Open in IMG/M |
| 3300025311 | Groundwater microbial communities from Rifle, Colorado - Rifle CSP2_plank lowO2_0.2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026018 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300027013 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300030619 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (Novaseq) | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300034178 | Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| C687J26616_101712891 | 3300002120 | Soil | GGQHALSEADLAGARAAGATEDEVRETISFAIRANAAKTHADILKVWDGDR* |
| C687J26623_100452313 | 3300002122 | Soil | VTWHARAAGATEDELREAISFAIRANAAKTHADILKVWSD* |
| C687J26634_100182371 | 3300002123 | Soil | LSEADLAGARAAGATEDEVREAISFAIRANAAKTHADILKVWDGDR* |
| Ga0062589_1022515861 | 3300004156 | Soil | LSERDLAGARQSGATEDEVREAISFAIRANAAKTHADILKVYEEPGRQALA* |
| Ga0066398_101236342 | 3300004268 | Tropical Forest Soil | LSERDLAGARQSGANEDEVREAISFAIRANAAKTHADILKVYEER* |
| Ga0062591_1019278863 | 3300004643 | Soil | HALSERDLAGARQSGATEDEVREAISFAIRANAAKTHADILKVYEESGR* |
| Ga0062379_101336981 | 3300004781 | Wetland Sediment | RDLAGARAAGASEDEVREAISFAIRANAAKTHADILKVYEPGA* |
| Ga0066680_105660153 | 3300005174 | Soil | KRDLAGARASGASEDEVREAISFAIRANAAKAHADILKVYTDSVS* |
| Ga0066680_108511072 | 3300005174 | Soil | RDLAGARNSGATEDEVREAVSFAIRANAAKAHADILSVWTERAG* |
| Ga0066676_100204913 | 3300005186 | Soil | LAGARASGASEDEVREAISFAIRANAAKAHADILKVWTDGGG* |
| Ga0066676_103763151 | 3300005186 | Soil | EHALAKRDLAGARAAGASEDEVREAISFAIRANAAKTHADILSVYEPGS* |
| Ga0070670_1020984552 | 3300005331 | Switchgrass Rhizosphere | KRDLAGARASGATEDEVREAISFAIRANAAKTHADILKVYTDGSGG* |
| Ga0066388_1040326072 | 3300005332 | Tropical Forest Soil | QHPLSERDLAGARNSGATEDEVREAISFAIRANAAKAHADILSVWSERAG* |
| Ga0066686_110681912 | 3300005446 | Soil | LSERDLAGARAAGATEDEVREAISFAIRANAAKTHADILTVYEPR* |
| Ga0066686_110681922 | 3300005446 | Soil | LSERDLAGARAAGATEDEVREAISFAIRANAAKTHADILKVYEPR* |
| Ga0070706_1003447891 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | KRDLAGARAAGATEDEVREAISFAIHANAAKTHADILKVYEPR* |
| Ga0070707_1003064744 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | AGARAAGASEEEVREAISFAIRANAAKTHADILKVYEPGS* |
| Ga0070693_1008913012 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | VTWHARAAGATEDELREAISFAIRANAAKTHADILKVWQD* |
| Ga0066694_105209131 | 3300005574 | Soil | APRDLAGARAAGATEDEVREAISFAIRANAAKTHADILKVWKDGGR* |
| Ga0075417_104059893 | 3300006049 | Populus Rhizosphere | KRDLAGARQSGASEDEVREAISFAIRANAAKTHADILKVYEER* |
| Ga0082029_12024222 | 3300006169 | Termite Nest | MRDLAGARAAGATEDEVREAISFAIRANAAKTHADILKVYEPPA* |
| Ga0079220_112823161 | 3300006806 | Agricultural Soil | ARAAGATEDELREAISFAIRANAAKTHADILKVWQD* |
| Ga0075436_1007177783 | 3300006914 | Populus Rhizosphere | ARAAGATEDEVREAISFAIRANAAKTHADILKVYSDGGG* |
| Ga0079216_102247703 | 3300006918 | Agricultural Soil | LAGARAAGASEDEVREAISFAIRANAAKTHADILQVYTDGGR* |
| Ga0075419_101871021 | 3300006969 | Populus Rhizosphere | KRDLAGARQSGASEDEVREAISFAIRANAAKAHADILKVYEAR* |
| Ga0075435_1011929601 | 3300007076 | Populus Rhizosphere | ASGASEDEVREAISFAIRANAAKAHADILKVYTDGVS* |
| Ga0099793_102443652 | 3300007258 | Vadose Zone Soil | LAGARQSGATEDELREAISFAIRANAAKTHADILKVWEER* |
| Ga0099829_106255541 | 3300009038 | Vadose Zone Soil | RAAGATEDELREAISFAIRANAAKTHADILKVWQE* |
| Ga0099827_104308243 | 3300009090 | Vadose Zone Soil | RSNGASEDEVREAISFAIRANAAKAHADILKVYTDG* |
| Ga0111539_108405242 | 3300009094 | Populus Rhizosphere | DLAGARASGATEDEVREAISFAIRANAAKAHADILSVWTESG* |
| Ga0075418_120963032 | 3300009100 | Populus Rhizosphere | AGARNSGASEDEVREAISFAIRANAAKAHADILSVWTERAG* |
| Ga0114129_114828202 | 3300009147 | Populus Rhizosphere | RDLAGARASGATEDEVREAISFAIRANAAKAHADILSVWTES* |
| Ga0105243_118898753 | 3300009148 | Miscanthus Rhizosphere | AGARAAGATEDELREAISFAIRANAAKTHADILKVWQE* |
| Ga0075423_100493977 | 3300009162 | Populus Rhizosphere | MRDLAGARQNGASEDEVREAISFAIRANAAKAHADILKVYADGGS* |
| Ga0105164_101726931 | 3300009777 | Wastewater | RDLAGARAAGATEEEIREAISFAIRANAAKVHADILKVWDGER* |
| Ga0105076_11147151 | 3300009816 | Groundwater Sand | AKRDLAGARAAGATEDEVREAISFAIRANAAKAHADILEVWDGGR* |
| Ga0134082_100990284 | 3300010303 | Grasslands Soil | LAGARASGASEDEVREAISFAIRANAAKAHADILKVYTDSVS* |
| Ga0134067_104963633 | 3300010321 | Grasslands Soil | ASGATEDEVREAISFAIRANAAKTHADILTVWTDGGR* |
| Ga0134063_100089731 | 3300010335 | Grasslands Soil | SGASEDELREAISFAIRANAAKTHADILKVWTDGGS* |
| Ga0134062_101087471 | 3300010337 | Grasslands Soil | RASGASEDEVREAISFAIRANAAKAHADILKVWTDGGG* |
| Ga0126376_132282132 | 3300010359 | Tropical Forest Soil | ARAVGATEDEVREAISFAIRANAAKTHADILKVYEPPA* |
| Ga0126372_123710232 | 3300010360 | Tropical Forest Soil | AKRDLAGARNSGATEDEVREAISFAIRANAAKAHADILSVWTERAG* |
| Ga0126378_134376963 | 3300010361 | Tropical Forest Soil | MQSGASEDEVREAISFAIRANAAKTHADILKVYEAR* |
| Ga0126377_109197201 | 3300010362 | Tropical Forest Soil | KRDLAGARQSGATEDEVREAISFAIRANAAKAHADILKVYDER* |
| Ga0136847_101187711 | 3300010391 | Freshwater Sediment | ASGATEDEVREAISFAIRANAAKAHADILSVWTEKKD* |
| Ga0134127_128998602 | 3300010399 | Terrestrial Soil | WLMAPATEDEVREAMSFAIRANAAKAHADILSVWNERA* |
| Ga0137451_12451423 | 3300011438 | Soil | AGARAAGASEDEVREAISFAIRANAAKTHADILKVYEPGS* |
| Ga0137383_107745671 | 3300012199 | Vadose Zone Soil | DLAGARASGASEDEVREAISFAIRANAAKAHADILKVYTDSVS* |
| Ga0137382_109562131 | 3300012200 | Vadose Zone Soil | DLAGARASGASEDEVREAISFAIRANAAKAHADILKVWTDGGG* |
| Ga0137399_109009271 | 3300012203 | Vadose Zone Soil | KRDLAGARQSGATEDELREAISFAIRANAAKTHADILKVWEER* |
| Ga0137381_113373801 | 3300012207 | Vadose Zone Soil | ASGASEDELREAISFAIRANAAKTHADILKVWTDGGR* |
| Ga0137372_108863331 | 3300012350 | Vadose Zone Soil | AAGASEEEVREAISFAIRANAAKTHADILKVYEPGS* |
| Ga0137390_105500521 | 3300012363 | Vadose Zone Soil | KRDLAGARRAGATEDEVREAISFAIRANAAKAHADILAVYTA* |
| Ga0134055_12819833 | 3300012401 | Grasslands Soil | ASGASEDEVREAISFAIRANAAKAHADILKVYTDSVS* |
| Ga0137397_102696801 | 3300012685 | Vadose Zone Soil | GANEDEVREAISFAIRANAAKTHADILKVYEQES* |
| Ga0137394_107634673 | 3300012922 | Vadose Zone Soil | GARQSGASEDEVREAISFAIRANAAKTHADILKVYEER* |
| Ga0137394_109830703 | 3300012922 | Vadose Zone Soil | ARAAGASEDEVREAISFAIRANAAKTHADILTVYEPGS* |
| Ga0137359_109237851 | 3300012923 | Vadose Zone Soil | GARQSGATEDELREAISFAIRANAAKTHADILKVWEER* |
| Ga0075301_11808872 | 3300014262 | Natural And Restored Wetlands | DLAGARAAGASEDEVREAISFAIRANAAKTHADILKVYEPGS* |
| Ga0075326_12399223 | 3300014271 | Natural And Restored Wetlands | ARASGATEDEVREAISFAIRANAAKAHADILSVYTEPTG* |
| Ga0075327_10212894 | 3300014272 | Natural And Restored Wetlands | ATEDEVREAISFAIRANAAKAHADILSVYTEPTG* |
| Ga0184637_101013674 | 3300018063 | Groundwater Sediment | GARASGATEDEVREAISFAIRANAAKAHADILSVWTEKKD |
| Ga0184639_104109691 | 3300018082 | Groundwater Sediment | DLAGARKSGASEDEVREAISFAIRANAAKAHADILKVYDG |
| Ga0190268_105935141 | 3300018466 | Soil | KRDLAGARASGATEDEVREAISFAIRANAAKAHADILSVYTEPKG |
| Ga0066669_123952603 | 3300018482 | Grasslands Soil | ASGASEDEVREAISFAIRANAAKAHADILKVYADGGR |
| Ga0137408_10034201 | 3300019789 | Vadose Zone Soil | ARQSGATEDELREAISFAIRANAAKTHADILKVWNE |
| Ga0210406_107922661 | 3300021168 | Soil | AKRDLAGARAAGATEDELREAISFAIRANAAKTHADILKVWQE |
| Ga0209322_103691943 | 3300025146 | Soil | GARAAGATEDELREAISFAIRANAAKVHADILKVWDGER |
| Ga0209521_106824121 | 3300025164 | Soil | GARSAGATEAEIREAISFAIRANAAKTHADILQVWDGDR |
| Ga0209642_103514253 | 3300025167 | Soil | LAGARAAGATEDEVREAISFAIRANAAKTHADILKVYEAP |
| Ga0209824_102905412 | 3300025173 | Wastewater | RDLAGARAAGATEEEIREAISFAIRANAAKVHADILKVWDGER |
| Ga0209002_102770373 | 3300025289 | Soil | AAGATEDELREAISFAIRANAAKVHADILKVWDGER |
| Ga0209212_11827401 | 3300025309 | Soil | LAGARASGASEDEVREAISFAIRANAAKTHADILKVYTDGGR |
| Ga0209343_103983811 | 3300025311 | Groundwater | AAGASGDEVREAISFAIRANAAKTHADILKVYETGS |
| Ga0209343_104855313 | 3300025311 | Groundwater | RDLAGARAAGATEDEVREAISFAIRANAAKTHADILKVYEAP |
| Ga0207681_115669223 | 3300025923 | Switchgrass Rhizosphere | GGRASGASEDEVREAISFAIRANAAKAHADILSVYTEPKG |
| Ga0208418_10362123 | 3300026018 | Natural And Restored Wetlands | AKRDLAGARAAGASEDEVREAISFAIRANAAKTHADILKVYEPGS |
| Ga0209153_10635661 | 3300026312 | Soil | KRDLAGARASGASEDEVREAISFAIRANAAKAHADILKVYADGGR |
| Ga0209153_10841703 | 3300026312 | Soil | KRDLAGARQSGATEDELREAISFAIRANAAKTHADILKVWEER |
| Ga0209267_10744821 | 3300026331 | Soil | AKRDLAGARASGASEDEVREAISFAIRANAAKAHADILKVYTDSVS |
| Ga0209267_11083461 | 3300026331 | Soil | DLAGARRAGATEAEVREAISFAIRANAAKAHADILAVYTA |
| Ga0209377_11529423 | 3300026334 | Soil | QSGASEDEVREAISFAIRANAAKTHADILKVYEER |
| Ga0209806_11054023 | 3300026529 | Soil | AKRDLAGARQSGATEDELREAISFAIRANAAKTHADILKVWNE |
| Ga0209884_10389542 | 3300027013 | Groundwater Sand | RDLAGARAAGASEDELREAISFAIRANAAKTHADILKVWQD |
| Ga0209073_102250211 | 3300027765 | Agricultural Soil | GARAAGATEDELREAISFAIRANAAKTHADILKVWQD |
| Ga0209814_105181591 | 3300027873 | Populus Rhizosphere | KRDLAGARQSGASEDEVREAISFAIRANAAKTHADILKVYEER |
| Ga0209481_104317921 | 3300027880 | Populus Rhizosphere | ARASGATEDEVREAISFAIRANAAKAHADILSVYTEPKS |
| Ga0209590_100635205 | 3300027882 | Vadose Zone Soil | AKRDLAGARASGASEDELREAISFAIRANAAKTHADILKVWTDGGS |
| Ga0268386_109878393 | 3300030619 | Soil | GARASGATEDEVREAISFAIRANAAKVHADILSVYTEPKG |
| Ga0307408_1014686791 | 3300031548 | Rhizosphere | GARAAGATEDEVKEAISFAIRANAAKTHADILKVWKAP |
| Ga0307469_112131351 | 3300031720 | Hardwood Forest Soil | AGARNSGATEDEVREAVSFAIRANAAKAHADILSVWTERAG |
| Ga0307405_109455433 | 3300031731 | Rhizosphere | GATEDEVREAISFAIRANAAKTHADILKVYEESGR |
| Ga0307468_1001599491 | 3300031740 | Hardwood Forest Soil | AGARAAGASEDEVREAISFAIRANAAKTHADILKVYEPES |
| Ga0307412_102878384 | 3300031911 | Rhizosphere | AKRDLAGARQSGATEDEVREAISFAIRANAAKTHADILKVYEEAGR |
| Ga0307412_104644123 | 3300031911 | Rhizosphere | PRDLAGARAAGATEDEVREAISFAIRANAAKTHADILKIWKE |
| Ga0214473_105389121 | 3300031949 | Soil | ARAAGATEDEVREAISFAIRANAAKAHADILQVYTAPGK |
| Ga0326597_106382451 | 3300031965 | Soil | ATRDLAGARAAGASEQELREAISFAIRANAAKVHADILKVWDGEK |
| Ga0307471_1003397951 | 3300032180 | Hardwood Forest Soil | KRDLAGARASGATEDEVREAISFAIRANAAKAHADILSVWTEGG |
| Ga0307472_1000644401 | 3300032205 | Hardwood Forest Soil | RNSGATEDEVREAVSFAIRANAAKAHADILSVWTERAG |
| Ga0307472_1000827051 | 3300032205 | Hardwood Forest Soil | AGARAAGATEDELREAISFAIRANAAKTHADILKVWQE |
| Ga0364934_0224527_2_133 | 3300034178 | Sediment | RDLAGARAAGASEDEVREAISFAIRANAAKTHADILKVYEPGS |
| ⦗Top⦘ |