


| Basic Information | |
|---|---|
| Family ID | F103857 |
| Family Type | Metagenome |
| Number of Sequences | 101 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MPIDPTDLAKSIGALGSLDPERGLAPTLQQIADSAKQLFAA |
| Number of Associated Samples | 66 |
| Number of Associated Scaffolds | 101 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 99.01 % |
| % of genes near scaffold ends (potentially truncated) | 98.02 % |
| % of genes from short scaffolds (< 2000 bps) | 90.10 % |
| Associated GOLD sequencing projects | 63 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (66.337 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (27.723 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.653 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (37.624 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.58% β-sheet: 0.00% Coil/Unstructured: 59.42% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 101 Family Scaffolds |
|---|---|---|
| PF06772 | LtrA | 3.96 |
| PF00534 | Glycos_transf_1 | 2.97 |
| PF14325 | DUF4383 | 1.98 |
| PF09844 | DUF2071 | 1.98 |
| PF00296 | Bac_luciferase | 1.98 |
| PF00561 | Abhydrolase_1 | 1.98 |
| PF09557 | DUF2382 | 0.99 |
| PF05239 | PRC | 0.99 |
| PF13276 | HTH_21 | 0.99 |
| PF12902 | Ferritin-like | 0.99 |
| PF00892 | EamA | 0.99 |
| PF01451 | LMWPc | 0.99 |
| PF13464 | DUF4115 | 0.99 |
| PF00872 | Transposase_mut | 0.99 |
| PF13581 | HATPase_c_2 | 0.99 |
| PF07592 | DDE_Tnp_ISAZ013 | 0.99 |
| PF00436 | SSB | 0.99 |
| PF03861 | ANTAR | 0.99 |
| PF13751 | DDE_Tnp_1_6 | 0.99 |
| PF01625 | PMSR | 0.99 |
| PF12697 | Abhydrolase_6 | 0.99 |
| PF13185 | GAF_2 | 0.99 |
| COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
|---|---|---|---|
| COG4292 | Low temperature requirement protein LtrA (function unknown) | Function unknown [S] | 3.96 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 1.98 |
| COG0225 | Peptide methionine sulfoxide reductase MsrA | Posttranslational modification, protein turnover, chaperones [O] | 0.99 |
| COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 0.99 |
| COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 0.99 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.99 |
| COG3707 | Two-component response regulator, AmiR/NasT family, consists of REC and RNA-binding antiterminator (ANTAR) domains | Transcription [K] | 0.99 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 66.34 % |
| All Organisms | root | All Organisms | 33.66 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000858|JGI10213J12805_10441013 | Not Available | 508 | Open in IMG/M |
| 3300003373|JGI25407J50210_10016621 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1906 | Open in IMG/M |
| 3300004016|Ga0058689_10108098 | Not Available | 597 | Open in IMG/M |
| 3300004479|Ga0062595_100717915 | Not Available | 806 | Open in IMG/M |
| 3300005562|Ga0058697_10051625 | Not Available | 1579 | Open in IMG/M |
| 3300005562|Ga0058697_10659775 | Not Available | 552 | Open in IMG/M |
| 3300006049|Ga0075417_10386234 | Not Available | 691 | Open in IMG/M |
| 3300006169|Ga0082029_1338498 | Not Available | 556 | Open in IMG/M |
| 3300006853|Ga0075420_101940480 | Not Available | 503 | Open in IMG/M |
| 3300009100|Ga0075418_11726814 | Not Available | 680 | Open in IMG/M |
| 3300009147|Ga0114129_10626423 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1391 | Open in IMG/M |
| 3300009789|Ga0126307_10450682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes hulinensis | 1038 | Open in IMG/M |
| 3300009789|Ga0126307_10694021 | Not Available | 821 | Open in IMG/M |
| 3300009789|Ga0126307_10738335 | Not Available | 794 | Open in IMG/M |
| 3300009789|Ga0126307_11129730 | Not Available | 634 | Open in IMG/M |
| 3300009821|Ga0105064_1005179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2189 | Open in IMG/M |
| 3300010036|Ga0126305_10608244 | Not Available | 735 | Open in IMG/M |
| 3300010036|Ga0126305_11209623 | Not Available | 522 | Open in IMG/M |
| 3300010037|Ga0126304_10745209 | Not Available | 663 | Open in IMG/M |
| 3300010041|Ga0126312_10014173 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5329 | Open in IMG/M |
| 3300010041|Ga0126312_10170193 | All Organisms → cellular organisms → Bacteria | 1517 | Open in IMG/M |
| 3300010042|Ga0126314_10305274 | Not Available | 1136 | Open in IMG/M |
| 3300010042|Ga0126314_11060061 | Not Available | 603 | Open in IMG/M |
| 3300010044|Ga0126310_10538203 | Not Available | 860 | Open in IMG/M |
| 3300010044|Ga0126310_10849576 | Not Available | 706 | Open in IMG/M |
| 3300010044|Ga0126310_10992064 | Not Available | 661 | Open in IMG/M |
| 3300010045|Ga0126311_10441558 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1008 | Open in IMG/M |
| 3300010166|Ga0126306_10506300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Thermobispora → environmental samples → uncultured Thermobispora sp. | 955 | Open in IMG/M |
| 3300010999|Ga0138505_100003410 | Not Available | 1529 | Open in IMG/M |
| 3300012937|Ga0162653_100044085 | Not Available | 678 | Open in IMG/M |
| 3300013306|Ga0163162_11651576 | Not Available | 731 | Open in IMG/M |
| 3300014487|Ga0182000_10105533 | Not Available | 953 | Open in IMG/M |
| 3300014487|Ga0182000_10111451 | Not Available | 935 | Open in IMG/M |
| 3300014487|Ga0182000_10119306 | Not Available | 913 | Open in IMG/M |
| 3300015077|Ga0173483_10349549 | Not Available | 742 | Open in IMG/M |
| 3300017792|Ga0163161_10531375 | Not Available | 961 | Open in IMG/M |
| 3300018028|Ga0184608_10064728 | All Organisms → cellular organisms → Bacteria | 1470 | Open in IMG/M |
| 3300018066|Ga0184617_1012445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Nitriliruptoria → Nitriliruptorales → unclassified Nitriliruptorales → Nitriliruptorales bacterium | 1737 | Open in IMG/M |
| 3300018066|Ga0184617_1142172 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 698 | Open in IMG/M |
| 3300018066|Ga0184617_1245258 | Not Available | 537 | Open in IMG/M |
| 3300018422|Ga0190265_10336341 | Not Available | 1592 | Open in IMG/M |
| 3300018422|Ga0190265_10353153 | Not Available | 1557 | Open in IMG/M |
| 3300018465|Ga0190269_11870406 | Not Available | 516 | Open in IMG/M |
| 3300018466|Ga0190268_11519272 | Not Available | 583 | Open in IMG/M |
| 3300018466|Ga0190268_12021041 | Not Available | 531 | Open in IMG/M |
| 3300019767|Ga0190267_11380649 | Not Available | 533 | Open in IMG/M |
| 3300020003|Ga0193739_1051946 | Not Available | 1054 | Open in IMG/M |
| 3300020005|Ga0193697_1151977 | Not Available | 513 | Open in IMG/M |
| 3300020016|Ga0193696_1111086 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300022534|Ga0224452_1180054 | Not Available | 650 | Open in IMG/M |
| 3300022694|Ga0222623_10128251 | Not Available | 988 | Open in IMG/M |
| 3300022694|Ga0222623_10242716 | Not Available | 696 | Open in IMG/M |
| 3300027909|Ga0209382_11537465 | Not Available | 661 | Open in IMG/M |
| 3300028707|Ga0307291_1188916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium | 530 | Open in IMG/M |
| 3300028718|Ga0307307_10310158 | Not Available | 509 | Open in IMG/M |
| 3300028720|Ga0307317_10023591 | Not Available | 1893 | Open in IMG/M |
| 3300028722|Ga0307319_10096503 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
| 3300028722|Ga0307319_10139490 | Not Available | 784 | Open in IMG/M |
| 3300028744|Ga0307318_10004257 | All Organisms → cellular organisms → Bacteria | 4633 | Open in IMG/M |
| 3300028744|Ga0307318_10196524 | Not Available | 697 | Open in IMG/M |
| 3300028787|Ga0307323_10333435 | Not Available | 544 | Open in IMG/M |
| 3300028791|Ga0307290_10383895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 514 | Open in IMG/M |
| 3300028793|Ga0307299_10260038 | Not Available | 652 | Open in IMG/M |
| 3300028796|Ga0307287_10034238 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1824 | Open in IMG/M |
| 3300028796|Ga0307287_10174838 | Not Available | 816 | Open in IMG/M |
| 3300028810|Ga0307294_10027537 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1544 | Open in IMG/M |
| 3300028811|Ga0307292_10072412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1321 | Open in IMG/M |
| 3300028814|Ga0307302_10028672 | Not Available | 2551 | Open in IMG/M |
| 3300028814|Ga0307302_10692793 | Not Available | 506 | Open in IMG/M |
| 3300028875|Ga0307289_10005844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4761 | Open in IMG/M |
| 3300028878|Ga0307278_10080066 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1472 | Open in IMG/M |
| 3300030496|Ga0268240_10113793 | Not Available | 643 | Open in IMG/M |
| 3300030496|Ga0268240_10193103 | Not Available | 518 | Open in IMG/M |
| 3300030499|Ga0268259_10068204 | Not Available | 753 | Open in IMG/M |
| 3300030499|Ga0268259_10113838 | Not Available | 616 | Open in IMG/M |
| 3300030510|Ga0268243_1034664 | Not Available | 1051 | Open in IMG/M |
| 3300031731|Ga0307405_10052053 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2544 | Open in IMG/M |
| 3300031824|Ga0307413_10484518 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
| 3300031852|Ga0307410_10056874 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Kineosporiales → Kineosporiaceae → Kineosporia | 2661 | Open in IMG/M |
| 3300031852|Ga0307410_10514098 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
| 3300031852|Ga0307410_10989804 | Not Available | 725 | Open in IMG/M |
| 3300031852|Ga0307410_11116935 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | 684 | Open in IMG/M |
| 3300031901|Ga0307406_10111366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1885 | Open in IMG/M |
| 3300031901|Ga0307406_10350584 | Not Available | 1153 | Open in IMG/M |
| 3300031911|Ga0307412_12050034 | Not Available | 530 | Open in IMG/M |
| 3300031995|Ga0307409_100004980 | All Organisms → cellular organisms → Bacteria | 7564 | Open in IMG/M |
| 3300031995|Ga0307409_100582136 | Not Available | 1103 | Open in IMG/M |
| 3300031995|Ga0307409_101424270 | Not Available | 719 | Open in IMG/M |
| 3300032002|Ga0307416_100389827 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1426 | Open in IMG/M |
| 3300032004|Ga0307414_10014176 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4768 | Open in IMG/M |
| 3300032004|Ga0307414_10116436 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2046 | Open in IMG/M |
| 3300032004|Ga0307414_10861864 | Not Available | 829 | Open in IMG/M |
| 3300032004|Ga0307414_11143812 | Not Available | 720 | Open in IMG/M |
| 3300032005|Ga0307411_10430465 | Not Available | 1098 | Open in IMG/M |
| 3300032005|Ga0307411_11867057 | Not Available | 559 | Open in IMG/M |
| 3300032126|Ga0307415_100204244 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → unclassified Mycolicibacterium → Mycolicibacterium sp. YH-1 | 1570 | Open in IMG/M |
| 3300032126|Ga0307415_101588870 | Not Available | 628 | Open in IMG/M |
| 3300032126|Ga0307415_102326732 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 526 | Open in IMG/M |
| 3300032159|Ga0268251_10077248 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1146 | Open in IMG/M |
| 3300032159|Ga0268251_10262081 | Not Available | 703 | Open in IMG/M |
| 3300034377|Ga0334931_073397 | Not Available | 782 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 27.72% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 21.78% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 15.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.94% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.95% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.96% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 3.96% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.97% |
| Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 2.97% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 1.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.98% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.99% |
| Sub-Biocrust Soil | Environmental → Terrestrial → Soil → Unclassified → Desert → Sub-Biocrust Soil | 0.99% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.99% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.99% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000858 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
| 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
| 3300004016 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005562 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009821 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010999 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t3i015 | Environmental | Open in IMG/M |
| 3300012937 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t5i015 | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
| 3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300020003 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2 | Environmental | Open in IMG/M |
| 3300020005 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2 | Environmental | Open in IMG/M |
| 3300020016 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1 | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028707 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148 | Environmental | Open in IMG/M |
| 3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028810 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300030496 | Bulk soil microbial communities from Mexico - Penjamo (Pe) metaG (v2) | Environmental | Open in IMG/M |
| 3300030499 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (v2) | Host-Associated | Open in IMG/M |
| 3300030510 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG (v2) | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300032159 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e (v2) | Host-Associated | Open in IMG/M |
| 3300034377 | Sub-biocrust soil microbial communities from Mojave Desert, California, United States - 27HNS | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10213J12805_104410131 | 3300000858 | Soil | MPIDPTDLAKSIGALGTLDPTRGLARTLQQVTDGAKQLFRADAAGLM |
| JGI25407J50210_100166212 | 3300003373 | Tabebuia Heterophylla Rhizosphere | MPIDPTDVVKSIGTLGSLDPERGLAPTLQQIADSAKQLFAADGPG* |
| Ga0058689_101080981 | 3300004016 | Agave | MPIDPTDLANSIGALGCLDPARGLAPTLQQVTDGAKQLFWADAAG |
| Ga0062595_1007179151 | 3300004479 | Soil | MPINPTDLAKSIGALGSLDPGRGLAPTLQQIADSAKQLFSADGAGLMLV |
| Ga0058697_100516251 | 3300005562 | Agave | MPIDPTDLAKSIGALGSLDPERGLAPTLQQIADSAKQLF |
| Ga0058697_106597751 | 3300005562 | Agave | MPINPTDLAKSIGALGSLDPERGLAPTLQQIADSAKQLFRADGAGLM |
| Ga0075417_103862342 | 3300006049 | Populus Rhizosphere | MPIDPTDLATSIGALGSLDPERGLARTLQQVTDGAKRLF |
| Ga0082029_13384982 | 3300006169 | Termite Nest | MPIDPTDLAKSIGALGSLDPERGLAPTLQQIVDAA |
| Ga0075420_1019404801 | 3300006853 | Populus Rhizosphere | MPINPTDLAKSIGGLGSLDPGQGLALTLQQIADAAK |
| Ga0075418_117268142 | 3300009100 | Populus Rhizosphere | MPIDPTDLATSIGALGSLDPERGLARTLQQVTDGAKR |
| Ga0114129_106264231 | 3300009147 | Populus Rhizosphere | MPIDPSGLAKSIGALHTLDPRRGLAPTPQQVADAAKQ |
| Ga0126307_104506823 | 3300009789 | Serpentine Soil | MPIDPTDLAKSIGALGSLDPGRGLAPTLQQIADSAKQLF |
| Ga0126307_106940211 | 3300009789 | Serpentine Soil | MPIDPTDLAKSIGGLGSLDPQRGLAPTLQQIADSAKQLFAADGAGLML |
| Ga0126307_107383351 | 3300009789 | Serpentine Soil | MPIDPSELAQSIGALDSLNPQQGLAPTLQQVTDGAKQLF |
| Ga0126307_111297301 | 3300009789 | Serpentine Soil | MPIDPSELAQSIGALDSLNPQQGLAPTLQQVTDGAKQLFGADGAG |
| Ga0105064_10051793 | 3300009821 | Groundwater Sand | MPIDPTDLAKSIGALGTLDPERGLAPTLQQLTDAAKQLFRADAAGLMLVDR |
| Ga0126305_106082441 | 3300010036 | Serpentine Soil | MPIDPTDLAKSIGALGSLDPGRGLAPTLQQIADSAKQLFA |
| Ga0126305_112096231 | 3300010036 | Serpentine Soil | MPIDPTDLAHSIGALGSLDPQRGLAPTLQQVTDGAKQLFRAD |
| Ga0126304_107452091 | 3300010037 | Serpentine Soil | MPIDPTDLAKSIGGLGSLDPQRGLAPTLQQIADSAKQLFAA |
| Ga0126312_100141736 | 3300010041 | Serpentine Soil | MPIDPTELAKSIGALGSLDPERGLAPTLQQIADATK |
| Ga0126312_101701931 | 3300010041 | Serpentine Soil | MPIDPTDLAKSIGALGSLDPGRGLAPTLQQIADSAKQLFAAD |
| Ga0126314_103052742 | 3300010042 | Serpentine Soil | MPIDPTDLAKSIGGLGSLDPERGLAPTLQQIADSAKQLFAADGAGLMLV |
| Ga0126314_110600611 | 3300010042 | Serpentine Soil | MPIDPTDLAKSIGALGSLDPEQGLARTLQQVTDGAKQL |
| Ga0126310_105382031 | 3300010044 | Serpentine Soil | MPIDPSELTKSIGALGTLDPDHDLAPTLQQVVVAAKQLFEADGAGLM |
| Ga0126310_108495761 | 3300010044 | Serpentine Soil | MPIDPTDLAKSIGALGSLDPGRGLAPTLQQIADSAKQ |
| Ga0126310_109920641 | 3300010044 | Serpentine Soil | MPIDPTDLAKSIGGLGSLDPERGLAPTLQQIADSAKQLFAADGAGLML |
| Ga0126311_104415581 | 3300010045 | Serpentine Soil | MPIDPSELTKSIGAIGSLDPERGLAPTLQQVVAAAKQLFEADGAGLML |
| Ga0126306_105063002 | 3300010166 | Serpentine Soil | VPIDPTELTKSIGAIGSLDPERGLAPTLQQVVVAAKQLFEADGAGLMLID |
| Ga0138505_1000034101 | 3300010999 | Soil | MPIDPTELANSIGALGSLDPERGLARTLQQVTDGAKRLFRA |
| Ga0162653_1000440851 | 3300012937 | Soil | MPIDPTDLAKSIGGLGSLDPERGLAPTLQQIADSAKQLFLADGAGLML |
| Ga0163162_116515761 | 3300013306 | Switchgrass Rhizosphere | MPIDPTDLATSIGALGSLDPERGLARTLQQVTDGAKQLFR |
| Ga0182000_101055331 | 3300014487 | Soil | MPIDPTDLAKSIGALGSLDPGRGLAPTLQQIADAAR |
| Ga0182000_101114511 | 3300014487 | Soil | MPIDPTDLAKSIGALGSLDPERGLARTLQQVTDGAKQLFRADAAGLM |
| Ga0182000_101193062 | 3300014487 | Soil | MPIDPTDLAKSIGALGSLDPGRGLAPTLQQIADAAKQLF |
| Ga0173483_103495491 | 3300015077 | Soil | MPIDPTDLAHSIGALGSLDPQRGLAPTLQQVTDGAKQLFAADGAGLML |
| Ga0163161_105313751 | 3300017792 | Switchgrass Rhizosphere | MPIDPTDLATSIGGLGSLDPERGLARTLQQVTDGAKRLFRADGAGLMLID |
| Ga0184608_100647283 | 3300018028 | Groundwater Sediment | MPINPTDLANSIGALGSLDPERGLARTLQQLTDGAKQLFSADAAGLML |
| Ga0184617_10124454 | 3300018066 | Groundwater Sediment | MPIDPTDLAKSIGALGSLDPERGLAPTLQQIADSAKQLFAA |
| Ga0184617_11421722 | 3300018066 | Groundwater Sediment | VPIDPTDLAKSIGALGSLDAGKGLAPTLQQIADSAKQLFGA |
| Ga0184617_12452581 | 3300018066 | Groundwater Sediment | MPIDPTDLAKSIGGLGSLDPGRGLAPTLQQIADSAKQ |
| Ga0190265_103363411 | 3300018422 | Soil | MPIDPTDLAKSIGALGSLDPERGLAPTLQQIADAAKQLF |
| Ga0190265_103531532 | 3300018422 | Soil | MPIDPTDLTKSIGAIGSLDPERGLAPTLQQVVLAAKQLFEADGPG |
| Ga0190269_118704061 | 3300018465 | Soil | MPIDPTELAKSIGALGSLDPGRGLAPTLQQIADSAKQLFSADGAGLMLIDAE |
| Ga0190268_115192721 | 3300018466 | Soil | MPIDPTDLAKSIGAVGSLDPARGLAPTFQQVTDGAKQLFGADAAGL |
| Ga0190268_120210411 | 3300018466 | Soil | MPINPTDLAKSIGALGSLDPERGLAPTLQQIADSAKQL |
| Ga0190267_113806491 | 3300019767 | Soil | MPIDPTDLAKSIGGLGSLDPERGLAPTLQQIADSAKQLFAA |
| Ga0193739_10519462 | 3300020003 | Soil | MPIDPTDLTKSIGALGSLDPERGLARTLQQVTDGA |
| Ga0193697_11519771 | 3300020005 | Soil | MPIDPTDLAKSIGALGSLDAGKGLAPTLQQVADSAKQLFGAD |
| Ga0193696_11110861 | 3300020016 | Soil | VPIDPTDLAKSIGALGSLDAGKGLAPTLQQVADSAKQLFGADAA |
| Ga0224452_11800541 | 3300022534 | Groundwater Sediment | MPIDPTDLATSIGALGSLDPEQGLARTLQQVTDGAKQLF |
| Ga0222623_101282511 | 3300022694 | Groundwater Sediment | MPIDPTDLAKSIGGLGTLDPERGLAPTLQQIADSAK |
| Ga0222623_102427162 | 3300022694 | Groundwater Sediment | VPIDPTDLAKSIGALGSLDAGKGLAPTLQQIADSAKQLFAADGAG |
| Ga0209382_115374651 | 3300027909 | Populus Rhizosphere | MPIDPTDLATSIGALGSLDPERGLARTLQQVTDGAKRLFRADAAGLML |
| Ga0307291_11889161 | 3300028707 | Soil | VPIDPTDLAKSIGALGSLDAGKGLAPTLQQVADSAKQLFGADAAGLML |
| Ga0307307_103101581 | 3300028718 | Soil | MPIDPTDLAKSIGALGSLDPERGLAPTLQQIADSAKQLFA |
| Ga0307317_100235914 | 3300028720 | Soil | MPIDPTDLAKSIGALGSLDPQRGLAPTLQQIADSAKQ |
| Ga0307319_100965031 | 3300028722 | Soil | MPIDPTDLAKSIGGLGSLDPERGLAPTLQQIADSAKQLFAADGA |
| Ga0307319_101394901 | 3300028722 | Soil | VPIDPTDLAKSIGALGSLDPERGLAPTLQQIADSAKQLFAADGAG |
| Ga0307318_100042577 | 3300028744 | Soil | VPIDPTDLAKSIGALGSLDAGKGLAPTLQQVADSAKQLFGADAAELML |
| Ga0307318_101965241 | 3300028744 | Soil | MPIDPTDLAKSIGALGSLDAGKGLAPTLQQIADSAKQLFAADGAGLMLID |
| Ga0307323_103334351 | 3300028787 | Soil | MPIDPTDLATSIGALGSLDPERGLARTLQQVTDGAKQLF |
| Ga0307290_103838951 | 3300028791 | Soil | MPINPTDLTKSIGALGTLDPGRGLAPTLQQIADSAKQLFAADGAG |
| Ga0307299_102600381 | 3300028793 | Soil | MPIDPTDLAKSIGGLGSLDPGRGLAPTLQQIADSAKQLFAADGAGLML |
| Ga0307287_100342382 | 3300028796 | Soil | MPIDPTDLATSIGALGGLDPQRGLARTLQQVTDGAKQLFRADAAGLMLIDAE |
| Ga0307287_101748382 | 3300028796 | Soil | MPIDPTDLAKSIGALGSLDPQQGLAPTLQQISDSAKQLFAADGAGL |
| Ga0307294_100275371 | 3300028810 | Soil | MPIDPTDLAKSIGGLGSLDPERGLAPTLQQIADSAK |
| Ga0307292_100724121 | 3300028811 | Soil | MPIDPTDLAKSIGDLGSLDPGRGLAPTLQQIADSAKQLFAADGA |
| Ga0307302_100286721 | 3300028814 | Soil | MPIDPTDLAKSIGGLGTLDPERGLAPTLQQIADSAKQLFAA |
| Ga0307302_106927931 | 3300028814 | Soil | MPIDPTDLAKSIGALGSLDPGRGLAPTLQQIADAAKQLFSADGAGLMLVDA |
| Ga0307289_100058448 | 3300028875 | Soil | MPIDPTDLATSIGALGSLDPERGLARTLQQVTDGAKQLFQAD |
| Ga0307278_100800662 | 3300028878 | Soil | MPIDPTDLAKSIGALGSLDPERGLALTLQQVTDAAKRL |
| Ga0268240_101137931 | 3300030496 | Soil | MPIDPSDLAKSIGALDSLDPEQGLAPTLQQVVDGAKQLFRADGAG |
| Ga0268240_101931031 | 3300030496 | Soil | MPIDPTDLAKSIGGLGSLDPEGGLAPTLQQIADSAKQLFAAH |
| Ga0268259_100682041 | 3300030499 | Agave | MPIDPTELAKSIGALGSLDPERGLAPTLQQIADATKQLFAADAAGL |
| Ga0268259_101138381 | 3300030499 | Agave | MPIDPTDLAKSIGALGSLDPGRGLAPTLQQIADSAKQLFRADG |
| Ga0268243_10346643 | 3300030510 | Soil | MPIDPTDLAKSIGALGSLDPERGLACTLQQVTDGAKQLFRADAA |
| Ga0307405_100520533 | 3300031731 | Rhizosphere | MPTDLAKSIGALGSLDPEQGLARTLQQVTDGAKQLFGAD |
| Ga0307413_104845182 | 3300031824 | Rhizosphere | MPIDPSELAQSIGALDSLNPQHGLAPTLQQVTDGAKQLFRADGA |
| Ga0307410_100568741 | 3300031852 | Rhizosphere | MPIDPTDLAKSIGALGSLDPGRGLAPTLQQIADSAKQLFAADGA |
| Ga0307410_105140981 | 3300031852 | Rhizosphere | MPIDPTELTKSIGAIGSLDPERGLAPTLQQIVQAAKQLFGADGAGLM |
| Ga0307410_109898041 | 3300031852 | Rhizosphere | MPIDPTDLAKSIGALGSLDPGRGLAPTLQQIAEAAK |
| Ga0307410_111169351 | 3300031852 | Rhizosphere | MPIDPTDLSKSIGALGTLDPERGLAQTLQQIADAAKQLFAAD |
| Ga0307406_101113663 | 3300031901 | Rhizosphere | MPIDPTDLAKSIGALGSLDPGRGLAPTLQQIADSAKQLFAADGAGLM |
| Ga0307406_103505842 | 3300031901 | Rhizosphere | MPIDPTDLAKSIGALGSLDPQRGLARTLQQVTDGAKQLFRADAAGLMLID |
| Ga0307412_120500341 | 3300031911 | Rhizosphere | MPIDPTDLANSIGALGSLDPERGLARTLQQVTDGAKQLFRADGAGL |
| Ga0307409_1000049801 | 3300031995 | Rhizosphere | MPIDPTELTKSIGAIGSLDPERGLAPTLQQVVVAAKQLFEADGAGLML |
| Ga0307409_1005821361 | 3300031995 | Rhizosphere | MPIDPTDLANSIGALGSLDPARGLARTLQQVTDGAKQLFRADAAGLMLIDA |
| Ga0307409_1014242701 | 3300031995 | Rhizosphere | MPIDPSELAKSIGALGSLDPERGLAPTLQQVSDGAKQLFRADGAGL |
| Ga0307416_1003898272 | 3300032002 | Rhizosphere | MPTDLAKSIGALGSLDPEQGLARTLQQLTDGAKQLFGADA |
| Ga0307414_100141769 | 3300032004 | Rhizosphere | MPIDPTELTKSIGAIGSLDPERGLAPTLQQVVVAAKQLFEADGAGLMLVDRE |
| Ga0307414_101164361 | 3300032004 | Rhizosphere | VPIDPTDLAKSIGALGSLDAGRGLAPTLQQVADSAKQLFAADG |
| Ga0307414_108618641 | 3300032004 | Rhizosphere | MPIDPSELAKSIGALGSLDPERGLAPTLQQVTDGAKQLF |
| Ga0307414_111438121 | 3300032004 | Rhizosphere | MPIDPSELTKSIGAIGSLDPERGLAPTLQQVVAAAKQLFEADGAGLM |
| Ga0307411_104304651 | 3300032005 | Rhizosphere | MPIDPTDLAKSIGALGGLDPQRGLAPTLQQVTDGAK |
| Ga0307411_118670571 | 3300032005 | Rhizosphere | MPIDPTDLANSIGALGSLDPARGLARTLQQVTDGAKQLF |
| Ga0307415_1002042441 | 3300032126 | Rhizosphere | MPIDPTDLAKSIGALGSLDPERGLAPTLQQIADGAKQLFAADAAGLMLV |
| Ga0307415_1015888701 | 3300032126 | Rhizosphere | MAGKAGSIMPIDPSQLAQSIGALDSLNPQQGLAPTLQQVTD |
| Ga0307415_1023267321 | 3300032126 | Rhizosphere | MPIDPSNLAKSIGALDSLDPERGLAPTLQRVTDAAKQLFRADAA |
| Ga0268251_100772481 | 3300032159 | Agave | MPIDPTDLAKSIGALGSLDPERGLAPTLQQIADSAKQLFAADGAGLMLV |
| Ga0268251_102620811 | 3300032159 | Agave | MPIDPTDLAKSIGALGSLDPERGLAPTLQQIADSAKQLFAADGAGLMLVD |
| Ga0334931_073397_651_782 | 3300034377 | Sub-Biocrust Soil | MPIDPTDLARSIGALGPLDPERRLAPTLQQIADSAKQLFAADGA |
| ⦗Top⦘ |