


| Basic Information | |
|---|---|
| Family ID | F103816 |
| Family Type | Metagenome |
| Number of Sequences | 101 |
| Average Sequence Length | 40 residues |
| Representative Sequence | NQTDDIFLAQILGHKLLGPNASLSVGQSYKDFYVV |
| Number of Associated Samples | 62 |
| Number of Associated Scaffolds | 101 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 9.90 % |
| % of genes near scaffold ends (potentially truncated) | 63.37 % |
| % of genes from short scaffolds (< 2000 bps) | 82.18 % |
| Associated GOLD sequencing projects | 54 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (61.386 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (23.762 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.644 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.485 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.62% β-sheet: 0.00% Coil/Unstructured: 52.38% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 101 Family Scaffolds |
|---|---|---|
| PF00106 | adh_short | 2.97 |
| PF13676 | TIR_2 | 2.97 |
| PF16095 | COR | 2.97 |
| PF12799 | LRR_4 | 2.97 |
| PF07723 | LRR_2 | 1.98 |
| PF00560 | LRR_1 | 1.98 |
| PF13516 | LRR_6 | 1.98 |
| PF16684 | Telomere_res | 0.99 |
| PF08843 | AbiEii | 0.99 |
| PF05708 | Peptidase_C92 | 0.99 |
| PF00206 | Lyase_1 | 0.99 |
| PF00196 | GerE | 0.99 |
| PF10926 | DUF2800 | 0.99 |
| PF00140 | Sigma70_r1_2 | 0.99 |
| PF02679 | ComA | 0.99 |
| PF00108 | Thiolase_N | 0.99 |
| PF13610 | DDE_Tnp_IS240 | 0.99 |
| PF13602 | ADH_zinc_N_2 | 0.99 |
| PF03060 | NMO | 0.99 |
| PF02826 | 2-Hacid_dh_C | 0.99 |
| PF01909 | NTP_transf_2 | 0.99 |
| PF01048 | PNP_UDP_1 | 0.99 |
| PF04389 | Peptidase_M28 | 0.99 |
| PF03235 | DUF262 | 0.99 |
| PF13546 | DDE_5 | 0.99 |
| PF01526 | DDE_Tnp_Tn3 | 0.99 |
| PF00483 | NTP_transferase | 0.99 |
| PF13504 | Obsolete Pfam Family | 0.99 |
| PF00171 | Aldedh | 0.99 |
| PF02577 | BFN_dom | 0.99 |
| PF03200 | Glyco_hydro_63 | 0.99 |
| COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
|---|---|---|---|
| COG4886 | Leucine-rich repeat (LRR) protein | Transcription [K] | 1.98 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.99 |
| COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 0.99 |
| COG0516 | IMP dehydrogenase/GMP reductase | Nucleotide transport and metabolism [F] | 0.99 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.99 |
| COG0775 | Nucleoside phosphorylase/nucleosidase, includes 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase MtnN and futalosine hydrolase MqnB | Nucleotide transport and metabolism [F] | 0.99 |
| COG0813 | Purine-nucleoside phosphorylase | Nucleotide transport and metabolism [F] | 0.99 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.99 |
| COG1259 | Bifunctional DNase/RNase | General function prediction only [R] | 0.99 |
| COG1479 | DNAse/DNA nickase specific for phosphorothioated or glycosylated phage DNA, GmrSD/DndB/SspE family, contains DUF262 and HNH nuclease domains | Defense mechanisms [V] | 0.99 |
| COG1809 | Phosphosulfolactate synthase, CoM biosynthesis protein A | Coenzyme transport and metabolism [H] | 0.99 |
| COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 0.99 |
| COG2253 | Predicted nucleotidyltransferase component of viral defense system | Defense mechanisms [V] | 0.99 |
| COG2820 | Uridine phosphorylase | Nucleotide transport and metabolism [F] | 0.99 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.99 |
| COG4644 | Transposase and inactivated derivatives, TnpA family | Mobilome: prophages, transposons [X] | 0.99 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 61.39 % |
| All Organisms | root | All Organisms | 38.61 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2035918004|FACENC_F56XM5W01BVNST | Not Available | 519 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100854346 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 791 | Open in IMG/M |
| 3300003219|JGI26341J46601_10222761 | Not Available | 507 | Open in IMG/M |
| 3300004152|Ga0062386_100223499 | Not Available | 1486 | Open in IMG/M |
| 3300004152|Ga0062386_100281930 | Not Available | 1322 | Open in IMG/M |
| 3300004152|Ga0062386_100383372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobulbaceae → Desulfobulbus → Desulfobulbus oralis | 1130 | Open in IMG/M |
| 3300004152|Ga0062386_100588191 | Not Available | 909 | Open in IMG/M |
| 3300004152|Ga0062386_100686705 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Fimbriiglobus → Fimbriiglobus ruber | 840 | Open in IMG/M |
| 3300004152|Ga0062386_100822244 | Not Available | 766 | Open in IMG/M |
| 3300004152|Ga0062386_101330375 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 598 | Open in IMG/M |
| 3300004152|Ga0062386_101553138 | Not Available | 552 | Open in IMG/M |
| 3300005468|Ga0070707_102180507 | Not Available | 521 | Open in IMG/M |
| 3300005536|Ga0070697_101408302 | Not Available | 622 | Open in IMG/M |
| 3300005764|Ga0066903_108788489 | Not Available | 513 | Open in IMG/M |
| 3300006028|Ga0070717_10670558 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
| 3300006172|Ga0075018_10687957 | Not Available | 552 | Open in IMG/M |
| 3300006173|Ga0070716_100998535 | Not Available | 662 | Open in IMG/M |
| 3300009176|Ga0105242_11884402 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300009665|Ga0116135_1022423 | Not Available | 2163 | Open in IMG/M |
| 3300010048|Ga0126373_12102177 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 626 | Open in IMG/M |
| 3300010339|Ga0074046_10072361 | Not Available | 2248 | Open in IMG/M |
| 3300010339|Ga0074046_10925355 | Not Available | 505 | Open in IMG/M |
| 3300010341|Ga0074045_10234730 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1217 | Open in IMG/M |
| 3300010376|Ga0126381_102105936 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300012202|Ga0137363_10007266 | All Organisms → cellular organisms → Bacteria | 6938 | Open in IMG/M |
| 3300012202|Ga0137363_10320323 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1277 | Open in IMG/M |
| 3300012202|Ga0137363_10477373 | Not Available | 1045 | Open in IMG/M |
| 3300012582|Ga0137358_10682451 | Not Available | 687 | Open in IMG/M |
| 3300012923|Ga0137359_10452434 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1136 | Open in IMG/M |
| 3300016270|Ga0182036_10276210 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Fimbriiglobus → Fimbriiglobus ruber | 1268 | Open in IMG/M |
| 3300016270|Ga0182036_10325035 | Not Available | 1178 | Open in IMG/M |
| 3300016270|Ga0182036_10607744 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
| 3300016270|Ga0182036_11429776 | Not Available | 579 | Open in IMG/M |
| 3300016294|Ga0182041_10906432 | Not Available | 793 | Open in IMG/M |
| 3300016357|Ga0182032_10045714 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. | 2803 | Open in IMG/M |
| 3300016357|Ga0182032_11390510 | Not Available | 607 | Open in IMG/M |
| 3300016387|Ga0182040_10517521 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
| 3300016387|Ga0182040_11326673 | Not Available | 608 | Open in IMG/M |
| 3300016404|Ga0182037_10048686 | Not Available | 2819 | Open in IMG/M |
| 3300016404|Ga0182037_11171573 | Not Available | 674 | Open in IMG/M |
| 3300016404|Ga0182037_11284358 | Not Available | 645 | Open in IMG/M |
| 3300016422|Ga0182039_10537027 | Not Available | 1015 | Open in IMG/M |
| 3300016422|Ga0182039_10735642 | Not Available | 872 | Open in IMG/M |
| 3300016445|Ga0182038_10058194 | Not Available | 2621 | Open in IMG/M |
| 3300017975|Ga0187782_11526759 | Not Available | 526 | Open in IMG/M |
| 3300018034|Ga0187863_10123404 | Not Available | 1448 | Open in IMG/M |
| 3300018037|Ga0187883_10460374 | Not Available | 654 | Open in IMG/M |
| 3300018042|Ga0187871_10200236 | Not Available | 1117 | Open in IMG/M |
| 3300020582|Ga0210395_11101139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium | 586 | Open in IMG/M |
| 3300021088|Ga0210404_10808674 | Not Available | 536 | Open in IMG/M |
| 3300021178|Ga0210408_10198006 | Not Available | 1597 | Open in IMG/M |
| 3300021361|Ga0213872_10019387 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 3133 | Open in IMG/M |
| 3300021361|Ga0213872_10133190 | All Organisms → cellular organisms → Bacteria | 1094 | Open in IMG/M |
| 3300021372|Ga0213877_10004625 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3228 | Open in IMG/M |
| 3300021372|Ga0213877_10089550 | Not Available | 925 | Open in IMG/M |
| 3300021372|Ga0213877_10213645 | Not Available | 630 | Open in IMG/M |
| 3300021405|Ga0210387_10695754 | Not Available | 901 | Open in IMG/M |
| 3300021444|Ga0213878_10023362 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2294 | Open in IMG/M |
| 3300021444|Ga0213878_10041749 | Not Available | 1771 | Open in IMG/M |
| 3300021444|Ga0213878_10045815 | Not Available | 1697 | Open in IMG/M |
| 3300021444|Ga0213878_10047713 | Not Available | 1666 | Open in IMG/M |
| 3300021444|Ga0213878_10062602 | Not Available | 1469 | Open in IMG/M |
| 3300021444|Ga0213878_10071487 | All Organisms → cellular organisms → Bacteria | 1380 | Open in IMG/M |
| 3300021444|Ga0213878_10104006 | Not Available | 1154 | Open in IMG/M |
| 3300021444|Ga0213878_10157709 | Not Available | 943 | Open in IMG/M |
| 3300021444|Ga0213878_10401017 | Not Available | 597 | Open in IMG/M |
| 3300021559|Ga0210409_10577390 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 992 | Open in IMG/M |
| 3300025612|Ga0208691_1150470 | Not Available | 524 | Open in IMG/M |
| 3300025910|Ga0207684_10828945 | Not Available | 781 | Open in IMG/M |
| 3300025910|Ga0207684_11146009 | Not Available | 646 | Open in IMG/M |
| 3300025922|Ga0207646_11277424 | Not Available | 642 | Open in IMG/M |
| 3300027812|Ga0209656_10002332 | All Organisms → cellular organisms → Bacteria | 12296 | Open in IMG/M |
| 3300027812|Ga0209656_10034372 | All Organisms → cellular organisms → Bacteria | 2977 | Open in IMG/M |
| 3300027812|Ga0209656_10044561 | Not Available | 2545 | Open in IMG/M |
| 3300027824|Ga0209040_10042618 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2788 | Open in IMG/M |
| 3300027824|Ga0209040_10371633 | Not Available | 672 | Open in IMG/M |
| 3300031525|Ga0302326_10854665 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 1302 | Open in IMG/M |
| 3300031573|Ga0310915_10611606 | Not Available | 772 | Open in IMG/M |
| 3300031719|Ga0306917_11080747 | Not Available | 625 | Open in IMG/M |
| 3300031744|Ga0306918_11062044 | Not Available | 628 | Open in IMG/M |
| 3300031770|Ga0318521_10833415 | Not Available | 563 | Open in IMG/M |
| 3300031833|Ga0310917_10046320 | Not Available | 2651 | Open in IMG/M |
| 3300031879|Ga0306919_10139690 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 1756 | Open in IMG/M |
| 3300031890|Ga0306925_10092991 | All Organisms → cellular organisms → Bacteria | 3204 | Open in IMG/M |
| 3300031890|Ga0306925_11528310 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 652 | Open in IMG/M |
| 3300031942|Ga0310916_10540121 | Not Available | 992 | Open in IMG/M |
| 3300031945|Ga0310913_10142317 | All Organisms → cellular organisms → Bacteria | 1652 | Open in IMG/M |
| 3300031946|Ga0310910_10503590 | Not Available | 961 | Open in IMG/M |
| 3300031946|Ga0310910_10769298 | Not Available | 759 | Open in IMG/M |
| 3300031947|Ga0310909_10125527 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp. | 2089 | Open in IMG/M |
| 3300031954|Ga0306926_11380005 | Not Available | 819 | Open in IMG/M |
| 3300032001|Ga0306922_10258491 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 1872 | Open in IMG/M |
| 3300032041|Ga0318549_10544105 | Not Available | 521 | Open in IMG/M |
| 3300032076|Ga0306924_10182713 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Fimbriiglobus → Fimbriiglobus ruber | 2407 | Open in IMG/M |
| 3300032261|Ga0306920_103134536 | Not Available | 620 | Open in IMG/M |
| 3300032955|Ga0335076_10243062 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1695 | Open in IMG/M |
| 3300032955|Ga0335076_10283239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya → unclassified Leptolyngbya → Leptolyngbya sp. PCC 7375 | 1549 | Open in IMG/M |
| 3300032955|Ga0335076_11212721 | Not Available | 638 | Open in IMG/M |
| 3300033289|Ga0310914_10051800 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3387 | Open in IMG/M |
| 3300033289|Ga0310914_11150900 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 677 | Open in IMG/M |
| 3300033289|Ga0310914_11407250 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 23.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.83% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 13.86% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 11.88% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.93% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.95% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.97% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.97% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 2.97% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.98% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.98% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.98% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.99% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.99% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.99% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.99% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.99% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.99% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2035918004 | Soil microbial communities from sample at FACE Site 2 North Carolina CO2- | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003219 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Host-Associated | Open in IMG/M |
| 3300021372 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R01 | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021444 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02 | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300025612 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FACENCA_5395670 | 2035918004 | Soil | MTDDIFLAQILGHKLLPGAAALSVGQSYKDFYVING |
| JGIcombinedJ26739_1008543461 | 3300002245 | Forest Soil | XKPQNITDDIFLAQILGHKLLGPNASFSVGQSYKDFYIRNG* |
| JGI26341J46601_102227611 | 3300003219 | Bog Forest Soil | KPKNMTEDIFIAEILGHKLLPGAAALSVGQSYKDFYVAGG* |
| Ga0062386_1002234991 | 3300004152 | Bog Forest Soil | CHKFKPKNQTDDIFLAQILGHKLLGPNASLSVGQSYKDFYVR* |
| Ga0062386_1002819301 | 3300004152 | Bog Forest Soil | RSAYGAMCCHKFKPQNMTDVQILGHKLLGPNAVGQSYKDFYVK* |
| Ga0062386_1003833722 | 3300004152 | Bog Forest Soil | PKNQTDDIFLAQILGHKLLGPNASLSVRQSYKDFYIRMP* |
| Ga0062386_1005881911 | 3300004152 | Bog Forest Soil | CHMFKPKNITDDIFLAQILGHKLLGPNASLSVGQSYKDFYIRKP* |
| Ga0062386_1006867052 | 3300004152 | Bog Forest Soil | HKFKPKNQTDDIFLAQILGHKLLGPNASLSVGQSYKDFYIRKR* |
| Ga0062386_1008222441 | 3300004152 | Bog Forest Soil | MFKPKNQTDDIFLAQILGHKLLGPNASLSVGQSYKDFYIR* |
| Ga0062386_1013303752 | 3300004152 | Bog Forest Soil | MIVPGNRHSRFKLKNITDDIFLAQILGHKILGPNASLSQSYKDFYVRLG* |
| Ga0062386_1015531383 | 3300004152 | Bog Forest Soil | FKPKNQTDDIFLAQILGHKLLGPNASLSVGQSYKDFYVVGA* |
| Ga0070707_1021805072 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | YGAICCHLFKPKNQTDDIFLAQILGHKLLGPNASLSVGQSYKDFYVVETA* |
| Ga0070697_1014083021 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | KNQTDDIFLAQILGHKLLGPNASLSVGQSYKDFYVVETA* |
| Ga0066903_1087884891 | 3300005764 | Tropical Forest Soil | KNQTDDIFLAQILGHQLLGPNASLSVGQSYKDFYVVGG* |
| Ga0070717_106705583 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | CHRFKPKNMTEDIFIAEILGHKLLPGATALSVGQRYKDFYVKS* |
| Ga0075018_106879571 | 3300006172 | Watersheds | KPKNQTDDIFLAQILGHKLLGPNASLSVGQSYKDFYIRKP* |
| Ga0070716_1009985352 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | INMTEDIFIAEILGHKLLPGATALSVGQSYKDFYIRNG* |
| Ga0105242_118844021 | 3300009176 | Miscanthus Rhizosphere | YGAICCHLFKPKNQTDDIFLAQILGHKLLGPNASLSVGQSYKDFYVVGD* |
| Ga0116135_10224232 | 3300009665 | Peatland | MTDDIFLAQILGHKLLGPNAALSGGQSYKDFFVK* |
| Ga0126373_121021771 | 3300010048 | Tropical Forest Soil | PKKQTDDIFLAKIIGHKLLGPNASLSVGQSYKGFYVV* |
| Ga0074046_100723611 | 3300010339 | Bog Forest Soil | MCCHKFKPQNMTDVQILGHKLLGPNAVGQSYKDFYVK* |
| Ga0074046_109253552 | 3300010339 | Bog Forest Soil | MTDDIFLAQILGHKLLGPNASLSVGQSYKDFYVVER* |
| Ga0074045_102347304 | 3300010341 | Bog Forest Soil | FKPKNQTDDIFLAQILGHKLLGPNASLSVGQSYKDFYISKV* |
| Ga0126381_1021059361 | 3300010376 | Tropical Forest Soil | TDDIFLAQILGHKLLGPNASLSFGQSYNNFYVKR* |
| Ga0137363_100072661 | 3300012202 | Vadose Zone Soil | ICCHLFKPKNQTDDIFLAQILGHKLLGPNASLSVGQSYKDFYVVGD* |
| Ga0137363_103203233 | 3300012202 | Vadose Zone Soil | MTEDIFIAEILGHKLLPGATALSVGQSYKDFYIRKP* |
| Ga0137363_104773732 | 3300012202 | Vadose Zone Soil | MTEDIFIAEILGHKLFPGATALSVGQSYKDFYVVETA* |
| Ga0137358_106824512 | 3300012582 | Vadose Zone Soil | AYSAICCQKFKPQNMTDDIFISEILGHKLLPGAAALSVGQSYKDFYIRNG* |
| Ga0137359_104524342 | 3300012923 | Vadose Zone Soil | MTEDIFLAQILGHKLLPGAAALSVGQSYKDFYVVGD* |
| Ga0182036_102762101 | 3300016270 | Soil | ICCHKFKPQNQTDDIFLAQILGHKLLGPNASLSVGQSYKDFYVVG |
| Ga0182036_103250352 | 3300016270 | Soil | MADDIFLAQILGHKLLPGAAGLSIGKSYKDFYVVGT |
| Ga0182036_106077441 | 3300016270 | Soil | NMTDDIFLAQILGHKLLPGAAALSVGQSYKDFYVKESPTKP |
| Ga0182036_114297761 | 3300016270 | Soil | GAICRHRFKPKNMTDDIFLAQILGDELLGPNAVLSVGHSYKDFYVEA |
| Ga0182041_109064321 | 3300016294 | Soil | SAYGAICCHKFKPRNQTDDIFLAQILGHELLAPNASLSVGQSYKDFYVAGE |
| Ga0182032_100457141 | 3300016357 | Soil | NMTDDIFLAQILGHKLLPGAAALSVGQSYKDFYVKESPIKP |
| Ga0182032_113905102 | 3300016357 | Soil | CCHKFKPQNQTDDIFLAQILGHKLLGPNASLSVGQSYKDFYVVG |
| Ga0182040_105175211 | 3300016387 | Soil | FKPRNQTDDIFLAQILGHKLLGPNAALSVGQSYKDFYVAGT |
| Ga0182040_113266732 | 3300016387 | Soil | MADDIFLAQILGHKLLPGAAGLSVGQSYKDFYVVGM |
| Ga0182037_100486861 | 3300016404 | Soil | ICCHKFKPQNQTDDIFLAQILGHKLLGPNPSLSVGQSYKDFYVVEK |
| Ga0182037_111715731 | 3300016404 | Soil | NQTDDIFLAQILGHKLLGPNASLSVGQSYKDFYVV |
| Ga0182037_112843581 | 3300016404 | Soil | KPKNQTDDIFLAQILGHKLLGPNASLSVGQSYKDFYVVAG |
| Ga0182039_105370271 | 3300016422 | Soil | KFKPRNQTDDIFLAQILGHKLLGPNASLSVGQSYKDFYVVEG |
| Ga0182039_107356421 | 3300016422 | Soil | PQNQTDDIFLAQILGHKLLGPNPSLSVGQSYKDFYVVEK |
| Ga0182038_100581946 | 3300016445 | Soil | MADDIFLAQILGHKLLPGAAGLSIGKSYKDFYVVGM |
| Ga0187782_115267592 | 3300017975 | Tropical Peatland | VDAPYGAICCPKFKPKNMTDDIFLAQILGHKLLPGTAALSVGQSYKDFYVRN |
| Ga0187863_101234043 | 3300018034 | Peatland | NMTDDIFLAQILGHKLLGPNAALSGGQSYKDFFVK |
| Ga0187883_104603742 | 3300018037 | Peatland | FCCHFFKPKNMTDDIFLAQILGHKLLGPNAALSGGQSYKDFFVK |
| Ga0187871_102002364 | 3300018042 | Peatland | KNMTDDIFLAQILGHKLLGPNAALSVGQSYKDFYVA |
| Ga0210395_111011391 | 3300020582 | Soil | KNQTDDIFLAQILGHKLLGPNASLSVGQSYKDFYIRKP |
| Ga0210404_108086742 | 3300021088 | Soil | MESRPPVKRYGAICCHLFKPENITIDIFLAQILAHKPLPGAAALFVGQSYNDF |
| Ga0210408_101980062 | 3300021178 | Soil | MESRPPAKRYGAICCHLFKPENITIDIFLAQILAHKPLPGAAALFVGQSYNDFYVAES |
| Ga0213872_100193873 | 3300021361 | Rhizosphere | MTDDIFLAQILGHKLLPGAAALSVGQSYKDFYVVASPHTK |
| Ga0213872_101331901 | 3300021361 | Rhizosphere | RFKPKNMTDDIFLAEILGHKLLPGSAALSVGQSYKDFYVVD |
| Ga0213877_100046252 | 3300021372 | Bulk Soil | MTDDIFLAEILGHKLLPGAAALSMGQSYKDFYVKE |
| Ga0213877_100895502 | 3300021372 | Bulk Soil | ALRNMTDDIFLAQILGHKLLGPNASLSIGQSYKDFYVVGK |
| Ga0213877_102136451 | 3300021372 | Bulk Soil | MTDDIFLAEILGHKLLPGAAALSVGQSYKDFYVKQ |
| Ga0210387_106957541 | 3300021405 | Soil | QTIDIFLAQILGPNASLSVGQNHKDLHSLVLSPYC |
| Ga0213878_100233623 | 3300021444 | Bulk Soil | MTPDIFMAEILGHKLLPGSAALSVGQSYKDFYVKQ |
| Ga0213878_100417491 | 3300021444 | Bulk Soil | LIFPKNMTDDIFLGEILGHKLLPGTAALSVGQSYKDFHVVG |
| Ga0213878_100458152 | 3300021444 | Bulk Soil | MYTALRNMTDDIFLAQILGHKLLGPNASLSIGQSYKDFYVVGK |
| Ga0213878_100477135 | 3300021444 | Bulk Soil | MTDDIFMAEILGHKLLPGAAALSVGQSYKDFYVRN |
| Ga0213878_100626022 | 3300021444 | Bulk Soil | MTDDIFLAQILGHKLLPGAAALSVGQSYKDFYVKP |
| Ga0213878_100714872 | 3300021444 | Bulk Soil | MTDDIFLAEILGHKLLPGAAALSVGQSYKDFYVVGK |
| Ga0213878_101040062 | 3300021444 | Bulk Soil | MTDDIFLAQILGHKLLPGAAALSVGQSYKDFYVAGK |
| Ga0213878_101577092 | 3300021444 | Bulk Soil | LYAAFPGNMTDDIFLAEILGHKLLPGAAALSVGQSYKDFYVK |
| Ga0213878_104010171 | 3300021444 | Bulk Soil | RFKPKNMTDDIFLAEILGHKLLPGAAALSVGQSYKDFFVK |
| Ga0210409_105773903 | 3300021559 | Soil | AICCHLFKPKNQTDDIFLAQILGHKLLGPNASLSVGQSYKDFYVVETA |
| Ga0208691_11504701 | 3300025612 | Peatland | PKNITDDIFLAQILGHKLLGPNASLSVGQSYKDFYIR |
| Ga0207684_108289453 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | ICCQKFKPQNMTDDIFLAQILGHKLLGPNAALSVGQSYKDFYIRTP |
| Ga0207684_111460091 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | GAICCHLFKPKNQTDDIFLAQILGHKLLGPNASLSVGQSYKDFYVVGD |
| Ga0207646_112774241 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MTEDIFIAEILGHKLLPGATALSVGQSYKDFYVVGA |
| Ga0209656_1000233211 | 3300027812 | Bog Forest Soil | MTDDIFLAQILGHKLLGPNVSLSVGQSYKDFYIRKP |
| Ga0209656_100343723 | 3300027812 | Bog Forest Soil | MTDDIFLAQILGHKLLGPNASLSVGQSYKDFYVVER |
| Ga0209656_100445614 | 3300027812 | Bog Forest Soil | MCCHKFKPQNMTDVQILGHKLLGPNAVGQSYKDFYVK |
| Ga0209040_100426183 | 3300027824 | Bog Forest Soil | MQIKMTEIIFLAQILSPNASLSVGQSYKDFYIRKP |
| Ga0209040_103716332 | 3300027824 | Bog Forest Soil | PKNQTDDIFLAQILGHKLLGPNASLSVGQSYKDFYIR |
| Ga0302326_108546654 | 3300031525 | Palsa | HKFKPKNQTDDIFLAQILGHKLLGPNASLSVGQSYKDFYIR |
| Ga0310915_106116062 | 3300031573 | Soil | MADDIFLAQILGHKLLPGAAGLSIGQSYKDFYVVGM |
| Ga0306917_110807471 | 3300031719 | Soil | HRFKPKNQTDDIFLAQILGHKLLGPNASLSVGQSYKDFYVVED |
| Ga0306918_110620441 | 3300031744 | Soil | RNQTDDIFLAQILGHKLLGPNASLSVGQSYKDFYVVR |
| Ga0318521_108334152 | 3300031770 | Soil | MTGDIFLAQILGHKLLGPNASLSVGQSYKDFYVVGG |
| Ga0310917_100463201 | 3300031833 | Soil | HKFKPQNQTDDIFLAQILGHKLLGPNPSLSVGQSYKDFYVVEK |
| Ga0306919_101396904 | 3300031879 | Soil | MTDDIFLAQILGHKLLPGAAALSVGQSYKDFYVKESPTKP |
| Ga0306925_100929915 | 3300031890 | Soil | MTEDIFIADILGHKLLPGAAALSVGQSYKDFYVVGD |
| Ga0306925_115283102 | 3300031890 | Soil | IFLAQILGHKLLPGAAALSVGQSYKDFYVKESPTKP |
| Ga0310916_105401212 | 3300031942 | Soil | MADDIFLAQILGHKLLPGAAGLSVGQSYKDFYVVGT |
| Ga0310913_101423172 | 3300031945 | Soil | MTDDIFLAQILGHKLLGPNASLSVGQSYKDFYVVG |
| Ga0310910_105035901 | 3300031946 | Soil | TDDIFLAQILGHKLLGPNASLSVGQSYKDFYVVGG |
| Ga0310910_107692981 | 3300031946 | Soil | ICCHKFKPRNQTDDIFLAQILGHKLLGPNASLSVGQSYKDFYVVGE |
| Ga0310909_101255274 | 3300031947 | Soil | IFLAQILGHKLLPGAAALSVGQSYKDFYVKESPIKP |
| Ga0306926_113800051 | 3300031954 | Soil | MTDDIFLAQILGHKLLGPNASLSVGQSYKDFYVVED |
| Ga0306922_102584912 | 3300032001 | Soil | MTDDIFLAQILGHKLLPGAAALSVGQSYKDFYVKESPIKP |
| Ga0318549_105441051 | 3300032041 | Soil | PQNQTDDIFLAQILGHKLLGPNASLSVGQSYKDFYVVG |
| Ga0306924_101827131 | 3300032076 | Soil | KFKPRNQTDDIFLAQILGHKLLGPNASLSVGQSYKDFYVV |
| Ga0306920_1031345362 | 3300032261 | Soil | KPKNQTDDIFLAQILGHKLLGPNASLSVGQSYKDFYVV |
| Ga0335076_102430621 | 3300032955 | Soil | DIFLAQILGHKLLGPNASLSVGQSYKDFYVDVKRF |
| Ga0335076_102832393 | 3300032955 | Soil | MTDDIFLAQILGHKLLPGAAALSVGQSYKDFYVVGG |
| Ga0335076_112127211 | 3300032955 | Soil | AICCHRFKPRNMTDDIFLAEILGHKLLPGAAALSVGQSYKDFYVVGD |
| Ga0310914_100518001 | 3300033289 | Soil | HKFKPRNQTDDIFLAQILGHKLLGPNASLSIGQSYKDFYVVWK |
| Ga0310914_111509001 | 3300033289 | Soil | ICCHLFKPRNMTDDIFLAQILGHKLLPGAAALSVGQSYKDFYVKESPIKP |
| Ga0310914_114072502 | 3300033289 | Soil | ICCHKFKPKNQTDDIFLAQILGHKLLGPNASLSVGQSYKDFYVVGD |
| ⦗Top⦘ |