


| Basic Information | |
|---|---|
| Family ID | F103573 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 101 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MEDARFFHQQANWCYQLAWQCFDLAVAHQLNTMGNEHTAKARELRS |
| Number of Associated Samples | 88 |
| Number of Associated Scaffolds | 101 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 82.18 % |
| % of genes near scaffold ends (potentially truncated) | 60.40 % |
| % of genes from short scaffolds (< 2000 bps) | 90.10 % |
| Associated GOLD sequencing projects | 82 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.73 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (79.208 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (18.812 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.743 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.426 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.41% β-sheet: 0.00% Coil/Unstructured: 44.59% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.73 |
| Powered by PDBe Molstar | |
| SCOP family | SCOP domain | Representative PDB | TM-score |
|---|---|---|---|
| a.25.1.1: Ferritin | d3ka8a_ | 3ka8 | 0.94341 |
| a.25.1.1: Ferritin | d4iwka_ | 4iwk | 0.92829 |
| a.25.1.1: Ferritin | d3pwfa1 | 3pwf | 0.9268 |
| a.25.1.1: Ferritin | d1nfva_ | 1nfv | 0.92332 |
| a.25.1.1: Ferritin | d2fzfa1 | 2fzf | 0.92311 |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 101 Family Scaffolds |
|---|---|---|
| PF09361 | Phasin_2 | 69.31 |
| PF08309 | LVIVD | 1.98 |
| PF04545 | Sigma70_r4 | 1.98 |
| PF13356 | Arm-DNA-bind_3 | 0.99 |
| PF06055 | ExoD | 0.99 |
| PF01070 | FMN_dh | 0.99 |
| PF02735 | Ku | 0.99 |
| PF00226 | DnaJ | 0.99 |
| COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
|---|---|---|---|
| COG5276 | Uncharacterized secreted protein, contains LVIVD repeats, choice-of-anchor domain | Function unknown [S] | 1.98 |
| COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 0.99 |
| COG1273 | Non-homologous end joining protein Ku, dsDNA break repair | Replication, recombination and repair [L] | 0.99 |
| COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 0.99 |
| COG3932 | Exopolysaccharide synthesis protein ExoD | Cell wall/membrane/envelope biogenesis [M] | 0.99 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 79.21 % |
| Unclassified | root | N/A | 20.79 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_100868280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1270 | Open in IMG/M |
| 3300000559|F14TC_105516286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 515 | Open in IMG/M |
| 3300000789|JGI1027J11758_12986436 | Not Available | 804 | Open in IMG/M |
| 3300003911|JGI25405J52794_10001289 | All Organisms → cellular organisms → Bacteria | 4079 | Open in IMG/M |
| 3300004281|Ga0066397_10105656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 596 | Open in IMG/M |
| 3300005174|Ga0066680_10967263 | Not Available | 501 | Open in IMG/M |
| 3300005177|Ga0066690_10292533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1099 | Open in IMG/M |
| 3300005184|Ga0066671_10400299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 878 | Open in IMG/M |
| 3300005187|Ga0066675_10351921 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1078 | Open in IMG/M |
| 3300005332|Ga0066388_100659772 | All Organisms → cellular organisms → Bacteria | 1659 | Open in IMG/M |
| 3300005332|Ga0066388_100965159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1421 | Open in IMG/M |
| 3300005363|Ga0008090_15834616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 571 | Open in IMG/M |
| 3300005436|Ga0070713_102068693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 552 | Open in IMG/M |
| 3300005467|Ga0070706_100484373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1151 | Open in IMG/M |
| 3300005471|Ga0070698_100176564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2075 | Open in IMG/M |
| 3300005559|Ga0066700_10178157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1457 | Open in IMG/M |
| 3300005566|Ga0066693_10060564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1289 | Open in IMG/M |
| 3300005569|Ga0066705_10255556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1111 | Open in IMG/M |
| 3300005575|Ga0066702_10117062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1543 | Open in IMG/M |
| 3300005587|Ga0066654_10126810 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1270 | Open in IMG/M |
| 3300005713|Ga0066905_100203156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1483 | Open in IMG/M |
| 3300005713|Ga0066905_100745937 | Not Available | 844 | Open in IMG/M |
| 3300005764|Ga0066903_102554806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 989 | Open in IMG/M |
| 3300005764|Ga0066903_102935873 | Not Available | 924 | Open in IMG/M |
| 3300005764|Ga0066903_104245301 | Not Available | 766 | Open in IMG/M |
| 3300005764|Ga0066903_107185152 | Not Available | 576 | Open in IMG/M |
| 3300005937|Ga0081455_10082944 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2621 | Open in IMG/M |
| 3300006038|Ga0075365_10002761 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 8768 | Open in IMG/M |
| 3300006177|Ga0075362_10428015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 670 | Open in IMG/M |
| 3300006791|Ga0066653_10413529 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 690 | Open in IMG/M |
| 3300007255|Ga0099791_10611246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 533 | Open in IMG/M |
| 3300009038|Ga0099829_11310318 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300009156|Ga0111538_10549950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1463 | Open in IMG/M |
| 3300009792|Ga0126374_11562767 | Not Available | 544 | Open in IMG/M |
| 3300010043|Ga0126380_10597770 | Not Available | 868 | Open in IMG/M |
| 3300010043|Ga0126380_10647317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 841 | Open in IMG/M |
| 3300010047|Ga0126382_10668205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 866 | Open in IMG/M |
| 3300010047|Ga0126382_11620004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 601 | Open in IMG/M |
| 3300010061|Ga0127462_117138 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 692 | Open in IMG/M |
| 3300010065|Ga0127435_140595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 950 | Open in IMG/M |
| 3300010065|Ga0127435_142590 | Not Available | 523 | Open in IMG/M |
| 3300010071|Ga0127477_157143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 895 | Open in IMG/M |
| 3300010106|Ga0127472_1130948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 823 | Open in IMG/M |
| 3300010154|Ga0127503_10208204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 717 | Open in IMG/M |
| 3300010321|Ga0134067_10185043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 759 | Open in IMG/M |
| 3300010322|Ga0134084_10184656 | Not Available | 721 | Open in IMG/M |
| 3300010361|Ga0126378_10302500 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1703 | Open in IMG/M |
| 3300010366|Ga0126379_12912271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 573 | Open in IMG/M |
| 3300010366|Ga0126379_13582501 | Not Available | 520 | Open in IMG/M |
| 3300010398|Ga0126383_11803120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 700 | Open in IMG/M |
| 3300010398|Ga0126383_13352831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 523 | Open in IMG/M |
| 3300010999|Ga0138505_100007972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1165 | Open in IMG/M |
| 3300012021|Ga0120192_10029310 | Not Available | 905 | Open in IMG/M |
| 3300012022|Ga0120191_10011304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1116 | Open in IMG/M |
| 3300012096|Ga0137389_11230850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 641 | Open in IMG/M |
| 3300012200|Ga0137382_11065359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 578 | Open in IMG/M |
| 3300012201|Ga0137365_10111593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2057 | Open in IMG/M |
| 3300012204|Ga0137374_10667074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 785 | Open in IMG/M |
| 3300012206|Ga0137380_10333279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1355 | Open in IMG/M |
| 3300012212|Ga0150985_119917576 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1167 | Open in IMG/M |
| 3300012285|Ga0137370_10091748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1699 | Open in IMG/M |
| 3300012350|Ga0137372_10448504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 968 | Open in IMG/M |
| 3300012353|Ga0137367_10625486 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 752 | Open in IMG/M |
| 3300012359|Ga0137385_10292358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 1403 | Open in IMG/M |
| 3300012361|Ga0137360_10081649 | All Organisms → cellular organisms → Bacteria | 2426 | Open in IMG/M |
| 3300012361|Ga0137360_10516777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1017 | Open in IMG/M |
| 3300012362|Ga0137361_10150778 | All Organisms → cellular organisms → Bacteria | 2077 | Open in IMG/M |
| 3300012371|Ga0134022_1176377 | Not Available | 584 | Open in IMG/M |
| 3300012372|Ga0134037_1178243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 616 | Open in IMG/M |
| 3300012372|Ga0134037_1183697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 957 | Open in IMG/M |
| 3300012375|Ga0134034_1138537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 682 | Open in IMG/M |
| 3300012582|Ga0137358_10081572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2177 | Open in IMG/M |
| 3300012930|Ga0137407_10280390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1519 | Open in IMG/M |
| 3300012948|Ga0126375_10832987 | Not Available | 734 | Open in IMG/M |
| 3300012976|Ga0134076_10637829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 501 | Open in IMG/M |
| 3300015357|Ga0134072_10048158 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1177 | Open in IMG/M |
| 3300015371|Ga0132258_10556413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2875 | Open in IMG/M |
| 3300016294|Ga0182041_11970057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 543 | Open in IMG/M |
| 3300016357|Ga0182032_11591366 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 568 | Open in IMG/M |
| 3300016404|Ga0182037_10166854 | Not Available | 1677 | Open in IMG/M |
| 3300018431|Ga0066655_10725443 | Not Available | 673 | Open in IMG/M |
| 3300018433|Ga0066667_12020093 | Not Available | 530 | Open in IMG/M |
| 3300020199|Ga0179592_10331668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 672 | Open in IMG/M |
| 3300021286|Ga0179583_1123938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 735 | Open in IMG/M |
| 3300025910|Ga0207684_10478263 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1068 | Open in IMG/M |
| 3300025928|Ga0207700_10151562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1916 | Open in IMG/M |
| 3300026494|Ga0257159_1039657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 793 | Open in IMG/M |
| 3300026557|Ga0179587_10664359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 686 | Open in IMG/M |
| 3300027748|Ga0209689_1220831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Kaistiaceae → Kaistia | 811 | Open in IMG/M |
| 3300027874|Ga0209465_10379545 | Not Available | 708 | Open in IMG/M |
| 3300027909|Ga0209382_10033820 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 6147 | Open in IMG/M |
| 3300027909|Ga0209382_11118192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 812 | Open in IMG/M |
| 3300030829|Ga0308203_1027081 | Not Available | 780 | Open in IMG/M |
| 3300030902|Ga0308202_1036831 | Not Available | 850 | Open in IMG/M |
| 3300030903|Ga0308206_1131802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 587 | Open in IMG/M |
| 3300031545|Ga0318541_10109205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1493 | Open in IMG/M |
| 3300031781|Ga0318547_10133651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1448 | Open in IMG/M |
| 3300031793|Ga0318548_10537478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 570 | Open in IMG/M |
| 3300031897|Ga0318520_10462102 | Not Available | 781 | Open in IMG/M |
| 3300031947|Ga0310909_10558284 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 958 | Open in IMG/M |
| 3300032065|Ga0318513_10359910 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 709 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 18.81% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 12.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 12.87% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 10.89% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 9.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.93% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.97% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.97% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 1.98% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.98% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.98% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 1.98% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.99% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.99% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.99% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.99% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.99% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300004281 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006177 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Host-Associated | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010061 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010065 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010071 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010106 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010999 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t3i015 | Environmental | Open in IMG/M |
| 3300012021 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T1 | Environmental | Open in IMG/M |
| 3300012022 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012371 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012372 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012375 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021286 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026494 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-A | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300030829 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_357 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030902 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030903 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1008682801 | 3300000364 | Soil | MEDARFFXQQANWCYQLAWQYFDLTIAHKLNAKGNQ |
| F14TC_1055162862 | 3300000559 | Soil | MEVTRFLQRQANWCYQLAWQCFDLTVAHELNAMGNELRARARKLR* |
| JGI1027J11758_129864361 | 3300000789 | Soil | MDVAESRMEDARFFHQQANWCYQLAWQCFDLTIAHKLNAKGNQQ* |
| JGI25405J52794_100012893 | 3300003911 | Tabebuia Heterophylla Rhizosphere | MEVARFLYRQANWCYQLAWQCFDLTVAHELNAMGNELRARARELC* |
| Ga0066397_101056562 | 3300004281 | Tropical Forest Soil | MPRRSGGIEDARFFHQQANWCYQLAWQCFDLAVAHELNLMGNKLTANARELWSQERKAR* |
| Ga0066680_109672631 | 3300005174 | Soil | MEDARFFNQQANWCYQLALQCFDLATAHKLNLMGNELTAKVRELRSQEF* |
| Ga0066690_102925332 | 3300005177 | Soil | MEDIRFFHQQANWCYQLAWQSFDLAIAHKLNIMGNAHTAKARELRSAQEPKKRDAG* |
| Ga0066671_104002991 | 3300005184 | Soil | MEDVRFFHQQANWCYQLAWQSFDLAIAHKLNIMGNAHTAKARELRSAQEPKKRDAGSETRRS* |
| Ga0066675_103519211 | 3300005187 | Soil | MEEVRFFHQQANWCYQLAWQSFDLAIAHKLNIMGNAHTAKARELRSAQEPKKRDAG* |
| Ga0066388_1006597722 | 3300005332 | Tropical Forest Soil | MSIAESRMEAARFLHWQANCCYQLAWQCFDLTVAHELNAMGNELRARAQKLR* |
| Ga0066388_1009651594 | 3300005332 | Tropical Forest Soil | MDARFVQRQANWCYQLAWQCFDLAVAHELNLMGNELTAKGREL |
| Ga0008090_158346162 | 3300005363 | Tropical Rainforest Soil | MPRRSGGIIEDARFFHQQANWCYQLAWQCFDLAVAHELNLMGNKLTA |
| Ga0070713_1020686933 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | HQQANWCYQLAWQCFDLAIAHKLNAMANEHAAKARELRSQER* |
| Ga0070706_1004843733 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MEDARFFHQQANWCYQLAWQCFDLAIAHKLNAMANEHAAKARE |
| Ga0070698_1001765643 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MEDARFFHQQANWCYQLAWQCFDLAIAHKLNAMANEHAAKARELRSQER* |
| Ga0066700_101781571 | 3300005559 | Soil | AGPTEDARFFHQQANWCYQLAWQSFDLAVAHKLNIMGNEHTAKAHELRQER* |
| Ga0066693_100605643 | 3300005566 | Soil | MEDVRFFHQQANWCYQLAWQSFDLAIAHKLNIMGNAHTAKAREL |
| Ga0066705_102555561 | 3300005569 | Soil | MEDVRFFHQQANWCYQLAWQSFDLAIAHKLNVMGNAHTAKARELRSAQEPKKRDAGSETRRS* |
| Ga0066702_101170623 | 3300005575 | Soil | MEDVRFFHQQANWCYQLAWQSFDLAIAHKLNVMGNAHTAKARELRSAQEPKESDAGSETRRS* |
| Ga0066654_101268103 | 3300005587 | Soil | MEDVRFFHQQANWCYQLAWQSFDLAIAHKLNIMGNAHTAKARELRSAQEPKKRDAG |
| Ga0066905_1002031565 | 3300005713 | Tropical Forest Soil | MEVTRFLQWQANWCYQLAWQCFDLTVAHELNAMGNELRARARELR |
| Ga0066905_1007459371 | 3300005713 | Tropical Forest Soil | MEDARFLRRQANRCYQLAWQSFDLRVAQKLNLLGNEHIAKARKLRSQ |
| Ga0066903_1025548062 | 3300005764 | Tropical Forest Soil | MEAARFLHWQADCCYQLAWQCFDLTVAHELNAMGNELRARAQKLR* |
| Ga0066903_1029358731 | 3300005764 | Tropical Forest Soil | MEDARFLHRQANRCYQLAWHSFDLRVAQKLNLLGNEHTAKAREL |
| Ga0066903_1042453012 | 3300005764 | Tropical Forest Soil | MEDARFLHRQANRCYQLAWQSFDLRVAQKLNLLGNEARKLQLKLMA* |
| Ga0066903_1071851521 | 3300005764 | Tropical Forest Soil | MKGVSFFHQQANRCYQLAWQSFDLRVAQKVNLLGNEHTAKAREL |
| Ga0081455_100829442 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MSIAEAGMEVARFLHRQADWCYQLAWQCFDLTVAHELNAMGNELRARARQVR* |
| Ga0075365_100027612 | 3300006038 | Populus Endosphere | MEVTRFLQRQANWCYQLAWQCVDLIVAHELNAMGNELRARARELR* |
| Ga0075362_104280152 | 3300006177 | Populus Endosphere | MEVTRFLQRQANWCYQLAWQCFDLTVAHEVNAMGNELRARA |
| Ga0066653_104135292 | 3300006791 | Soil | MEEVRFFHQQANWCYQLAWQSFDLAIAHKLNIMGNAHTAKARELRSAQEPKKRDAGSETRRS* |
| Ga0099791_106112462 | 3300007255 | Vadose Zone Soil | MGGRESGKDACFFHQQANSCYQLAWQCFDLTVAHKLNEMGNELTAKAGELRSPERK |
| Ga0099829_113103181 | 3300009038 | Vadose Zone Soil | MEDARFFHKQANWCYQLAWQCFDLPIAHKLNVMGNELKARELRSQERKGRDVLAG |
| Ga0111538_105499504 | 3300009156 | Populus Rhizosphere | MDVSRFIQQQANWCYQLAWQCFDLTVAHELNAMGN |
| Ga0126374_115627672 | 3300009792 | Tropical Forest Soil | MEDVRFFYQQANRCYQLAWQSFDLRVAHKLNRLGNEHIAKARERRFSRAVGAV* |
| Ga0126380_105977701 | 3300010043 | Tropical Forest Soil | MEDTRFFYQQANRCYQLAWQSFDLWVAHKLNRLGNEHIAKARE |
| Ga0126380_106473173 | 3300010043 | Tropical Forest Soil | WMPRRSGGIEDARFFHQQANWCYQLAWQCFDLAVAHELNLMGNKLTANARELWSQERKAR |
| Ga0126382_106682051 | 3300010047 | Tropical Forest Soil | MEDARFFHQQANWYYQLAWQCFDLAVAHELNLMGNELTAKG |
| Ga0126382_116200041 | 3300010047 | Tropical Forest Soil | QLAWQCFDLAVAHELNLMGNKLTANARELWSQERKAR* |
| Ga0127462_1171383 | 3300010061 | Grasslands Soil | MEDARFLHRQANRCYQLAWQSFDLRVAQKLNLAGNEHT |
| Ga0127435_1405952 | 3300010065 | Grasslands Soil | MEDIRFFHQQANWCYQLAWQSFDLAIAHKLNIMGNAHTAKARELRSAQEPKKRDAGSETRRS* |
| Ga0127435_1425902 | 3300010065 | Grasslands Soil | MEDVRFFYQQANRCYRLAWQSFDLQVAQKLNLLGNE |
| Ga0127477_1571431 | 3300010071 | Grasslands Soil | MEDIRFFHQQANWCYQLAWQSFDLAIAHKLNIMGNAHTAKARELRSAQEPKKRDAAG* |
| Ga0127472_11309481 | 3300010106 | Grasslands Soil | MEDVRFFHQQANWCYQLAWQSFDLAIAHKLNVMGNAHTAKARELRSAQEPKKRDAG* |
| Ga0127503_102082042 | 3300010154 | Soil | MADARFFRQQANRCYQLAWQSFDLAVANKLNAMGNKHTAKAR |
| Ga0134067_101850432 | 3300010321 | Grasslands Soil | MEDVRFFHQQANWCYQLAWQSFDLAIAHKLNIMGNAHTAKARELRSAQEPKKRDAG* |
| Ga0134084_101846561 | 3300010322 | Grasslands Soil | MEDVRFFHQQVNWCYQLAWQSFDLAIAHKLNIMGNAHTAKARELRSAQEPKKRDAG* |
| Ga0126378_103025002 | 3300010361 | Tropical Forest Soil | MEEVRFFYQQANRCYQLAWQSFDLRVAQRLNLLGNEHTAKARELRSQETVER* |
| Ga0126379_129122711 | 3300010366 | Tropical Forest Soil | MEDMRFLYEQANRCYQLAWQSFDLRVAQRLNVLGNEHTAKARQLR |
| Ga0126379_135825012 | 3300010366 | Tropical Forest Soil | MPRRSGAIEDARFFHQQANWCYQFAWQRFDLAVAHELNLVANKLTAKARELWS* |
| Ga0126383_118031201 | 3300010398 | Tropical Forest Soil | MEDVRFFYQQANRCYQLAWQSFDLRVAQRLNLLGNEHTAKAREL |
| Ga0126383_133528311 | 3300010398 | Tropical Forest Soil | QQANWCYQLAWQCFDLAVAHELNLMGNKLTAKASELWSQERKARQTQKAT* |
| Ga0138505_1000079722 | 3300010999 | Soil | MVDARFFHQQANWCYQLAWKCFDLAIAHKLNAMANEHGAKGRELCSQER* |
| Ga0120192_100293102 | 3300012021 | Terrestrial | MEDARFFHQQANRCYQLAWQCFDLTIAHKLNAIGNAHTAKAREFRQERR* |
| Ga0120191_100113042 | 3300012022 | Terrestrial | MEVTRFLYRQANWCYQLAWQCFDLTVAHELNAMGNELRARARELR* |
| Ga0137389_112308501 | 3300012096 | Vadose Zone Soil | MEDARFFHQQANWCYQLAWQCFDLAVAHQLNTMGNEHTAKARELRS |
| Ga0137382_110653591 | 3300012200 | Vadose Zone Soil | MEDARFLHRQANRCYQLAWQSFDLRVAQKLNLAGNEHTAKARELRSQESN |
| Ga0137365_101115932 | 3300012201 | Vadose Zone Soil | MEDARFFHQQANWCYQLAWQCFDLAIAHKLNAMANEHAAKARELRLQER* |
| Ga0137374_106670742 | 3300012204 | Vadose Zone Soil | MEGARFFHQQANWCYQLAWQCFELAIAHKLNAMANEHTAKGRELCSQEQ* |
| Ga0137380_103332791 | 3300012206 | Vadose Zone Soil | QQANWCYQLAWQSFDLAVAHKLNVMGNEHTAKAHELRQER* |
| Ga0150985_1199175762 | 3300012212 | Avena Fatua Rhizosphere | MENPHFFYKQASWCYQLAWQCFDLTVAHKLNVIGNELTAKARELQSAEH* |
| Ga0137370_100917483 | 3300012285 | Vadose Zone Soil | MEEVRFFHQQANWCYQLAWQSFDLAIAHKLNVMGNAHTAK |
| Ga0137372_104485043 | 3300012350 | Vadose Zone Soil | MEGARFFHQQANWCYQLAWQCFDLAIAHKLNAMANEHAAKGRELCSQER* |
| Ga0137367_106254862 | 3300012353 | Vadose Zone Soil | MEGARFFHQQANWCYQLAWQCFELAIAHKLNAMANEHAAKGRELCSQER* |
| Ga0137385_102923581 | 3300012359 | Vadose Zone Soil | QQANWCYQLAWQCFDLAIAHKLNAMANEHAAKARELRLQER* |
| Ga0137360_100816494 | 3300012361 | Vadose Zone Soil | MEDARFFHQQANWCYQLAWQCFDLAVAHQLNTMGNEHTAKA |
| Ga0137360_105167773 | 3300012361 | Vadose Zone Soil | MEDVRFFYQQANRCYQLAWQSFDLRVAQKLNLLGNEHTAKARE |
| Ga0137361_101507784 | 3300012362 | Vadose Zone Soil | MEDARFFHQQANRCYQLAWQSFDLRAAHKLNLLGNEHIKKARELRSQET |
| Ga0134022_11763773 | 3300012371 | Grasslands Soil | MEDLRFFYQQANRCYQLAWQSFDLRVAQRLNLLGNEHTAKARELRSQET |
| Ga0134037_11782431 | 3300012372 | Grasslands Soil | MEDVRFFYQQANRCYRLAWQSFDLQVAQKLNLLGNEHTAKARE |
| Ga0134037_11836972 | 3300012372 | Grasslands Soil | MEDIRFFHQQANWCYQLAWQSFDLAIAHKLNIMGNAHTAKARELRSAQEPKESDAGSETRRS* |
| Ga0134034_11385372 | 3300012375 | Grasslands Soil | MEDVRFFHQQANWCYQLAWQSFDLAIAHKLNIMGNAHTAKARELRS |
| Ga0137358_100815725 | 3300012582 | Vadose Zone Soil | MVDARFFHQQANWCYQLAWQCFDLAIAHKLNAMANEHAAKGRELCSQER* |
| Ga0137407_102803903 | 3300012930 | Vadose Zone Soil | MEDACFFHQQANRCYQLAWQCFDLTIAHKLNAIGNAHTAKAREFRQERR* |
| Ga0126375_108329871 | 3300012948 | Tropical Forest Soil | MEDARFFHQQANWCYQLAWQCFDLAVAHELNLMGNKLTANAREL |
| Ga0134076_106378291 | 3300012976 | Grasslands Soil | MEDARSLHRQANRCYQLAWQSFDLRVAQKLNLAGNEHTAKARELRSQESNV |
| Ga0134072_100481582 | 3300015357 | Grasslands Soil | MEDVRFFHQQANWCYQLAWQSFDLAIAHKLNIMGNAHTAKARELRSAQEPKESDAGSETRRS* |
| Ga0132258_105564134 | 3300015371 | Arabidopsis Rhizosphere | MEVTRFLQRQANWCYQLAWQCFDLTVAHELNAMGNELRARARELR* |
| Ga0182041_119700572 | 3300016294 | Soil | MPRTGTEDERFFHQQANWCYQLAWQCFDLAVAHELNL |
| Ga0182032_115913662 | 3300016357 | Soil | MPRTGMEDERFFHQQANWCYQLAWQCFDLAVAHELNLMGNELRAKARELW |
| Ga0182037_101668541 | 3300016404 | Soil | MEDVRFFHQQAKRCYQLAWQSFDLRVAQKLNLLGNEHTAKARELRLREAK |
| Ga0066655_107254433 | 3300018431 | Grasslands Soil | FHQQANWCYNLAWQSFDLAIGHKLNIMGNAHTAKARELRSAQEPKKRDAGSETRRS |
| Ga0066667_120200931 | 3300018433 | Grasslands Soil | MEDARFFNQQANWCYQLALQCFDLATAHKLNLMGN |
| Ga0179592_103316681 | 3300020199 | Vadose Zone Soil | MEDARFFHQQANWCYQLAWQCFDLAVAHQLNTMGNEHTAKARELRSQE |
| Ga0179583_11239382 | 3300021286 | Vadose Zone Soil | MEDVRFFYQQANRCYQLAWQSFDLRVAQRLNVLGNEHTAKARELRSQ |
| Ga0207684_104782631 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MEDARFFHQQANWCYQLAWQCFDLAIAHKLNAMANEHAAKAREL |
| Ga0207700_101515623 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MEDVRFFYQQANRCYQLAWQSFDLRVAQRLNVLGNEHTAKARDLR |
| Ga0257159_10396571 | 3300026494 | Soil | MVDARFFHQQANWCYQLAWQCFDLAIAHKLNAMANEHAAKGRELCSQER |
| Ga0179587_106643591 | 3300026557 | Vadose Zone Soil | MEDARFFHQQANWCYQLAWQCFDLPIAHKLNVMGNELKARELRSQERKGRQTQ |
| Ga0209689_12208311 | 3300027748 | Soil | WMPRRAGPTEDARFFHQQANWCYQLAWQSFDLAVAHKLNIMGNEHTAKAHELRQER |
| Ga0209465_103795453 | 3300027874 | Tropical Forest Soil | MEDVRFFYQQANRCYQLAWQSFDLRVAQRLNLLGN |
| Ga0209382_100338205 | 3300027909 | Populus Rhizosphere | MEVTRFLQRQANWCYQLAWQCVDLIVAHELNAMGNELRARARELR |
| Ga0209382_111181922 | 3300027909 | Populus Rhizosphere | YRQANWCYQLAWQCFDLTVAHELNAMGNELRARARKLR |
| Ga0308203_10270812 | 3300030829 | Soil | MEDVRFFYQQANRCYQLAWQSFDLRVTQKLNLLGNEHTANARERSQETAER |
| Ga0308202_10368311 | 3300030902 | Soil | MEDVRFFYQQANRCYQLAWQSFDLRVAQKLNLLGNEHTANARERSQETAER |
| Ga0308206_11318021 | 3300030903 | Soil | MEDARFFHQQANWCYQLAWQCFDLAIAHKLNVMGNEHTAKARERSQERKDGVARRRNSS |
| Ga0318541_101092054 | 3300031545 | Soil | MEDERFFHQQANWCYQLAWQCFDLAVAHELNLMGNEL |
| Ga0318547_101336511 | 3300031781 | Soil | MEDARFFHQQANWCYQLAWQCFDLAVAHELNLMGNEL |
| Ga0318548_105374781 | 3300031793 | Soil | MPRTGMEDERFFHQQANWCYQLAWQCFDLAVAHELNLMGNELT |
| Ga0318520_104621021 | 3300031897 | Soil | MEDARFLYQQANRCYQLAWQCFDLRVAHKLNSLGN |
| Ga0310909_105582841 | 3300031947 | Soil | MEDERFFHQQANWCYQLAWQCFDLAVAHELNLMGNELRAKAR |
| Ga0318513_103599101 | 3300032065 | Soil | MPRKPAGTEDPRFFRQQANWCYQLAWQSFDLAVAHKLNLMG |
| ⦗Top⦘ |