


| Basic Information | |
|---|---|
| Family ID | F103464 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 101 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MRVVPILSGAKVALCPYCSRTVGIMRQVRDGAAGLLQSHPYRQY |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 101 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 69.00 % |
| % of genes near scaffold ends (potentially truncated) | 42.57 % |
| % of genes from short scaffolds (< 2000 bps) | 79.21 % |
| Associated GOLD sequencing projects | 86 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (69.307 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (6.931 % of family members) |
| Environment Ontology (ENVO) | Unclassified (36.634 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (43.564 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 34.09% β-sheet: 0.00% Coil/Unstructured: 65.91% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 101 Family Scaffolds |
|---|---|---|
| PF02604 | PhdYeFM_antitox | 37.62 |
| PF02272 | DHHA1 | 6.93 |
| PF07676 | PD40 | 1.98 |
| PF00155 | Aminotran_1_2 | 1.98 |
| PF01368 | DHH | 1.98 |
| PF12248 | Methyltransf_FA | 0.99 |
| PF12910 | PHD_like | 0.99 |
| PF02541 | Ppx-GppA | 0.99 |
| PF01694 | Rhomboid | 0.99 |
| PF01618 | MotA_ExbB | 0.99 |
| PF00749 | tRNA-synt_1c | 0.99 |
| COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
|---|---|---|---|
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 37.62 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 37.62 |
| COG0248 | Exopolyphosphatase/pppGpp-phosphohydrolase | Signal transduction mechanisms [T] | 1.98 |
| COG0008 | Glutamyl- or glutaminyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.99 |
| COG0705 | Membrane-associated serine protease, rhomboid family | Posttranslational modification, protein turnover, chaperones [O] | 0.99 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 69.31 % |
| All Organisms | root | All Organisms | 30.69 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000956|JGI10216J12902_100094593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 910 | Open in IMG/M |
| 3300003324|soilH2_10387962 | Not Available | 1117 | Open in IMG/M |
| 3300004156|Ga0062589_102670202 | Not Available | 519 | Open in IMG/M |
| 3300004463|Ga0063356_100610702 | Not Available | 1477 | Open in IMG/M |
| 3300004479|Ga0062595_100465890 | Not Available | 934 | Open in IMG/M |
| 3300004633|Ga0066395_10000325 | All Organisms → cellular organisms → Bacteria | 17829 | Open in IMG/M |
| 3300005093|Ga0062594_100409318 | All Organisms → cellular organisms → Bacteria | 1100 | Open in IMG/M |
| 3300005213|Ga0068998_10167028 | Not Available | 534 | Open in IMG/M |
| 3300005218|Ga0068996_10083776 | Not Available | 692 | Open in IMG/M |
| 3300005328|Ga0070676_10153722 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. SM23_52 | 1475 | Open in IMG/M |
| 3300005329|Ga0070683_100258517 | Not Available | 1656 | Open in IMG/M |
| 3300005329|Ga0070683_100589928 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
| 3300005331|Ga0070670_100009560 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8275 | Open in IMG/M |
| 3300005331|Ga0070670_101798747 | Not Available | 564 | Open in IMG/M |
| 3300005333|Ga0070677_10266244 | Not Available | 857 | Open in IMG/M |
| 3300005336|Ga0070680_100359586 | Not Available | 1238 | Open in IMG/M |
| 3300005340|Ga0070689_100028858 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 4196 | Open in IMG/M |
| 3300005355|Ga0070671_101275156 | Not Available | 648 | Open in IMG/M |
| 3300005356|Ga0070674_101117754 | Not Available | 696 | Open in IMG/M |
| 3300005367|Ga0070667_101948077 | Not Available | 553 | Open in IMG/M |
| 3300005441|Ga0070700_100102205 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. SM23_52 | 1890 | Open in IMG/M |
| 3300005457|Ga0070662_101142995 | Not Available | 669 | Open in IMG/M |
| 3300005459|Ga0068867_100411864 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1143 | Open in IMG/M |
| 3300005535|Ga0070684_100002699 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 13108 | Open in IMG/M |
| 3300005535|Ga0070684_101144848 | Not Available | 731 | Open in IMG/M |
| 3300005563|Ga0068855_100190409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2314 | Open in IMG/M |
| 3300005564|Ga0070664_101201537 | Not Available | 715 | Open in IMG/M |
| 3300005566|Ga0066693_10273959 | Not Available | 671 | Open in IMG/M |
| 3300005614|Ga0068856_100144885 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2383 | Open in IMG/M |
| 3300005614|Ga0068856_100582671 | Not Available | 1140 | Open in IMG/M |
| 3300005616|Ga0068852_101938853 | Not Available | 611 | Open in IMG/M |
| 3300005719|Ga0068861_100032048 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3866 | Open in IMG/M |
| 3300005764|Ga0066903_101853123 | Not Available | 1154 | Open in IMG/M |
| 3300005836|Ga0074470_11619336 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. SM23_52 | 2615 | Open in IMG/M |
| 3300005993|Ga0080027_10000507 | All Organisms → cellular organisms → Bacteria | 16580 | Open in IMG/M |
| 3300006237|Ga0097621_100768074 | Not Available | 891 | Open in IMG/M |
| 3300006358|Ga0068871_100726842 | Not Available | 911 | Open in IMG/M |
| 3300006755|Ga0079222_12361350 | Not Available | 532 | Open in IMG/M |
| 3300007004|Ga0079218_11492609 | Not Available | 731 | Open in IMG/M |
| 3300009098|Ga0105245_11773927 | Not Available | 670 | Open in IMG/M |
| 3300010362|Ga0126377_11495547 | Not Available | 749 | Open in IMG/M |
| 3300010397|Ga0134124_11270259 | Not Available | 758 | Open in IMG/M |
| 3300010398|Ga0126383_12777077 | Not Available | 572 | Open in IMG/M |
| 3300010399|Ga0134127_11322263 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Phenylobacterium → unclassified Phenylobacterium → Phenylobacterium sp. J426 | 790 | Open in IMG/M |
| 3300010403|Ga0134123_10053130 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 3059 | Open in IMG/M |
| 3300010869|Ga0126359_1036102 | Not Available | 969 | Open in IMG/M |
| 3300011420|Ga0137314_1012409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2205 | Open in IMG/M |
| 3300011422|Ga0137425_1033787 | Not Available | 1114 | Open in IMG/M |
| 3300011429|Ga0137455_1195657 | Not Available | 603 | Open in IMG/M |
| 3300011445|Ga0137427_10147773 | Not Available | 965 | Open in IMG/M |
| 3300012212|Ga0150985_100135070 | Not Available | 638 | Open in IMG/M |
| 3300012212|Ga0150985_100993962 | Not Available | 713 | Open in IMG/M |
| 3300012212|Ga0150985_106740801 | Not Available | 1022 | Open in IMG/M |
| 3300012469|Ga0150984_105315991 | Not Available | 700 | Open in IMG/M |
| 3300013296|Ga0157374_11255598 | Not Available | 762 | Open in IMG/M |
| 3300014166|Ga0134079_10659137 | Not Available | 528 | Open in IMG/M |
| 3300014969|Ga0157376_12296019 | Not Available | 579 | Open in IMG/M |
| 3300015371|Ga0132258_13480986 | Not Available | 1079 | Open in IMG/M |
| 3300015374|Ga0132255_105637799 | Not Available | 530 | Open in IMG/M |
| 3300018081|Ga0184625_10021873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3065 | Open in IMG/M |
| 3300018081|Ga0184625_10442820 | Not Available | 666 | Open in IMG/M |
| 3300019880|Ga0193712_1089069 | Not Available | 670 | Open in IMG/M |
| 3300020005|Ga0193697_1009639 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. SM23_52 | 2354 | Open in IMG/M |
| 3300020069|Ga0197907_10397585 | Not Available | 1356 | Open in IMG/M |
| 3300020082|Ga0206353_10555941 | Not Available | 758 | Open in IMG/M |
| 3300021082|Ga0210380_10062991 | Not Available | 1612 | Open in IMG/M |
| 3300021384|Ga0213876_10070154 | Not Available | 1851 | Open in IMG/M |
| 3300021415|Ga0193694_1017844 | Not Available | 975 | Open in IMG/M |
| 3300022756|Ga0222622_10176187 | All Organisms → cellular organisms → Bacteria | 1401 | Open in IMG/M |
| 3300024186|Ga0247688_1071808 | Not Available | 577 | Open in IMG/M |
| 3300025504|Ga0208356_1004467 | All Organisms → cellular organisms → Bacteria | 3325 | Open in IMG/M |
| 3300025908|Ga0207643_10205529 | Not Available | 1200 | Open in IMG/M |
| 3300025913|Ga0207695_11123479 | Not Available | 666 | Open in IMG/M |
| 3300025918|Ga0207662_10253441 | All Organisms → cellular organisms → Bacteria | 1156 | Open in IMG/M |
| 3300025930|Ga0207701_10017403 | All Organisms → cellular organisms → Bacteria | 6940 | Open in IMG/M |
| 3300025931|Ga0207644_11680966 | Not Available | 532 | Open in IMG/M |
| 3300025937|Ga0207669_11856824 | Not Available | 515 | Open in IMG/M |
| 3300026023|Ga0207677_12243683 | Not Available | 508 | Open in IMG/M |
| 3300026281|Ga0209863_10030371 | Not Available | 1638 | Open in IMG/M |
| 3300026294|Ga0209839_10109650 | Not Available | 936 | Open in IMG/M |
| 3300027483|Ga0207637_1010736 | Not Available | 507 | Open in IMG/M |
| 3300028145|Ga0247663_1025747 | Not Available | 911 | Open in IMG/M |
| 3300028380|Ga0268265_10936504 | Not Available | 852 | Open in IMG/M |
| 3300029984|Ga0311332_10234986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1389 | Open in IMG/M |
| 3300031058|Ga0308189_10399602 | Not Available | 567 | Open in IMG/M |
| 3300031241|Ga0265325_10018244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3891 | Open in IMG/M |
| 3300031247|Ga0265340_10066826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1710 | Open in IMG/M |
| 3300031544|Ga0318534_10013440 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 4184 | Open in IMG/M |
| 3300031544|Ga0318534_10051459 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2306 | Open in IMG/M |
| 3300031668|Ga0318542_10498501 | Not Available | 633 | Open in IMG/M |
| 3300031680|Ga0318574_10584340 | Not Available | 655 | Open in IMG/M |
| 3300031781|Ga0318547_10062452 | All Organisms → cellular organisms → Bacteria | 2041 | Open in IMG/M |
| 3300031939|Ga0308174_10759720 | Not Available | 812 | Open in IMG/M |
| 3300031940|Ga0310901_10267617 | Not Available | 707 | Open in IMG/M |
| 3300031954|Ga0306926_11105441 | Not Available | 937 | Open in IMG/M |
| 3300032955|Ga0335076_10086229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3076 | Open in IMG/M |
| 3300034147|Ga0364925_0319888 | Not Available | 582 | Open in IMG/M |
| 3300034659|Ga0314780_094747 | Not Available | 672 | Open in IMG/M |
| 3300034659|Ga0314780_102654 | Not Available | 654 | Open in IMG/M |
| 3300034690|Ga0364923_0216395 | Not Available | 518 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.93% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 4.95% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 4.95% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 3.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 3.96% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.97% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.97% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 2.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.97% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.98% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.98% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.98% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.98% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.98% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 1.98% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.98% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.98% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.98% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.98% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.98% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.99% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.99% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.99% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.99% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.99% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.99% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.99% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.99% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.99% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.99% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.99% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.99% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.99% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.99% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.99% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005213 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D2 | Environmental | Open in IMG/M |
| 3300005218 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300010869 | Boreal forest soil eukaryotic communities from Alaska, USA - W4-4 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011420 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT199_2 | Environmental | Open in IMG/M |
| 3300011422 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT640_2 | Environmental | Open in IMG/M |
| 3300011429 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT600_2 | Environmental | Open in IMG/M |
| 3300011445 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2 | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300019880 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a1 | Environmental | Open in IMG/M |
| 3300020005 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2 | Environmental | Open in IMG/M |
| 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
| 3300021415 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s1 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300024186 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK29 | Environmental | Open in IMG/M |
| 3300025504 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026281 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes) | Environmental | Open in IMG/M |
| 3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
| 3300027483 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05.2A1-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300028145 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK04 | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300029984 | I_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300031058 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Host-Associated | Open in IMG/M |
| 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Host-Associated | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031940 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300034147 | Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17 | Environmental | Open in IMG/M |
| 3300034659 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034690 | Sediment microbial communities from East River floodplain, Colorado, United States - 60_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10216J12902_1000945932 | 3300000956 | Soil | MRIVPVPPGAKVALCPYCHRSVGIMRSVHEGEAGTLKSHPERRFVRVPTR* |
| soilH2_103879622 | 3300003324 | Sugarcane Root And Bulk Soil | MRVVPILAGAKVALCPYCSRPVGIMRAVRDGAAGLLQSHPYREY* |
| Ga0062589_1026702021 | 3300004156 | Soil | MRVVPILSGAKVALCPYCSRTVGIMRAVRDGAAGLLQSHPYRQY* |
| Ga0063356_1006107023 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MRVVPILSGAKVALCPYCSRTVGIMRRVRDGAAGLLQSHPYRQY* |
| Ga0062595_1004658903 | 3300004479 | Soil | MRVVPILPGAKVALCPYCSRPIGIMRMVRDGAAGLLQSHPYRQY |
| Ga0066395_1000032524 | 3300004633 | Tropical Forest Soil | LRVVPILSGAKVALCPYCSRPVGIMRRVRDGAAGLLQSHPYRQY* |
| Ga0062594_1004093181 | 3300005093 | Soil | MRVVPILPGAKVALCPYCSRPVGIMRKVRDGSAGMLQSHPYRQY* |
| Ga0068998_101670281 | 3300005213 | Natural And Restored Wetlands | ILSGAKVALCPYCSRTVGIMRTVRDGAAGLLQSHPYREY* |
| Ga0068996_100837762 | 3300005218 | Natural And Restored Wetlands | MRVVPILPGAKVALCPYCSRPIGIMRMVRDGAAGLLQSHPYRRY* |
| Ga0070676_101537221 | 3300005328 | Miscanthus Rhizosphere | RRRCRGTMRVVPILPGAKVALCPYCSRPIGIMRMVRDGAAGLLQSHPYRQY* |
| Ga0070683_1002585171 | 3300005329 | Corn Rhizosphere | MRVVPILSGAKVALCPYCSRPVGIMRQVRDGAAGLLQSHPYREY* |
| Ga0070683_1005899283 | 3300005329 | Corn Rhizosphere | MRVVPILSGAKVALCPYCSRTVGIMRQVRDGAAGLLQSHPYR |
| Ga0070670_1000095604 | 3300005331 | Switchgrass Rhizosphere | MSVVPILSGAKVALCPYCSRTVGIMRAVRDGAAGLLQSHPYRQY* |
| Ga0070670_1017987472 | 3300005331 | Switchgrass Rhizosphere | MRVVPILPGAKVALCPYCSRPIGIMRMVRDGAAGLLQSHPYRQY* |
| Ga0070677_102662441 | 3300005333 | Miscanthus Rhizosphere | MRVVPILPGAKVALCPFCSRPVGIMRMVRDGAAGLLQSHSYRQY* |
| Ga0070680_1003595863 | 3300005336 | Corn Rhizosphere | MRVVPILSGAKVALCPYCSRTVGIMRQVRDGAAGLLQSHPYRPY* |
| Ga0070689_1000288581 | 3300005340 | Switchgrass Rhizosphere | LRRRCRGTMRVVPILPGAKVALCPFCSRPVGIMRMVRDGAAGLLQSHSYRQY* |
| Ga0070671_1012751562 | 3300005355 | Switchgrass Rhizosphere | RCSGTMRVVPILPGAKVALCPYCSRPVGIMRKVRDGAAGMLQSHPYRQY* |
| Ga0070674_1011177541 | 3300005356 | Miscanthus Rhizosphere | VPVLSGAKVALCPYCHRTVEIMRSVRGGEAGMLKSHPFRAY |
| Ga0070667_1019480771 | 3300005367 | Switchgrass Rhizosphere | RTVPVLSGAKVALCPYCHRTVEIMRSVRGGEAGMLKSHPFRAY* |
| Ga0070700_1001022051 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | TMRVVPILPGAKVALCPFCSRPVGIMRMVRDGAAGLLQSHSYRQY* |
| Ga0070662_1011429953 | 3300005457 | Corn Rhizosphere | ILPGAKVALCPFCSRPVGIMRMVRDGAAGLLQSHSYRQY* |
| Ga0068867_1004118643 | 3300005459 | Miscanthus Rhizosphere | CRGTMRVVPILPGAKVALCPFCSRPVGIMRMVRDGAAGLLQSHSYRQY* |
| Ga0070684_10000269912 | 3300005535 | Corn Rhizosphere | MRVVPILPGAKVALCPYCSRPVGIMRKVRDGAAGMLQSHPYRQY* |
| Ga0070684_1011448481 | 3300005535 | Corn Rhizosphere | TVPVLSGAKVALCPYCHRTVEIMRSVRDGEAGTLKSHPFRGY* |
| Ga0068855_1001904093 | 3300005563 | Corn Rhizosphere | LRVVPHVAGAKVAVCPYCHRAVEIMREVRHGEAAMLKSHPSRRY* |
| Ga0070664_1012015373 | 3300005564 | Corn Rhizosphere | KVALCPYCSRPVGIMRKVRDGAAGMLQSHPYRQY* |
| Ga0066693_102739592 | 3300005566 | Soil | MQVVPILSGAKVALCPYCSRPVGIMRRVRDGAAGLLQSHPYRQY* |
| Ga0068856_1001448853 | 3300005614 | Corn Rhizosphere | VVPLVSGAKVALCPYCLRTVEIMRQVRDGEAAMLKSHPARRY* |
| Ga0068856_1005826714 | 3300005614 | Corn Rhizosphere | VVPLVSGAKVALCPYCLRTVEIMRQVRDGEAAMLKSHPGRRY* |
| Ga0068852_1019388531 | 3300005616 | Corn Rhizosphere | GAKVALCPYCHRAVEIMREVRHGEAAMLKSHPSRRY* |
| Ga0068861_1000320487 | 3300005719 | Switchgrass Rhizosphere | RCRGTMRVVPILPGAKVALCPFCSRPVGIMRMVRDGAAGLLQSHSYRQY* |
| Ga0066903_1018531232 | 3300005764 | Tropical Forest Soil | MRVVPILSGAKVALCPYCSRTVGIMRQVRDGAAGLLQSHPYREY* |
| Ga0066903_1051866363 | 3300005764 | Tropical Forest Soil | STLRRRCRGTLRVVPILSGAKVALCPYCSRTVGIMRTVRDGAAGLLQSHPYREY* |
| Ga0074470_116193363 | 3300005836 | Sediment (Intertidal) | MRVVPILPGAKVALCPFCSRPVGIMRKVRDGAAGMLQSHPFRQY* |
| Ga0080027_1000050715 | 3300005993 | Prmafrost Soil | MRVVPILAGAKVALCPYCHRTVEIMRQVRDGAAGTLKSHPSRRY* |
| Ga0097621_1007680742 | 3300006237 | Miscanthus Rhizosphere | LRVVPILAGAKVALCPDGSRPVGSMRKVRDGAAGLLQSHPYRQY* |
| Ga0068871_1007268421 | 3300006358 | Miscanthus Rhizosphere | CKGSLRTVPVLSGAKVALCPYCHRTVEIMRSVRGGEAGMLKSHPFRAY* |
| Ga0079222_123613501 | 3300006755 | Agricultural Soil | MRVVPILSGAKVALCPYCSRTVGIMRQVRDGAAGLLQSHPYRQY* |
| Ga0079218_114926092 | 3300007004 | Agricultural Soil | MRVVPVLSGAKVALCPYCNRTVAIMRPVRDGAAGLLK |
| Ga0105245_117739272 | 3300009098 | Miscanthus Rhizosphere | MRVVPILPGAKVALCPYCSRPVGIMRKVRDGAAGMLQSHPYRQ |
| Ga0126377_114955472 | 3300010362 | Tropical Forest Soil | MRVVPILSGAKVALCPYCSRPVGIMRRVRDGSAGLLQSHPYRQY* |
| Ga0134124_112702591 | 3300010397 | Terrestrial Soil | MRVVPILPGAKVALCPFCSRPVGIMRKVRDGAAGMLQSHPYRQY* |
| Ga0126383_127770771 | 3300010398 | Tropical Forest Soil | MRVVPILAGAKVALCPYCARTVGIMRTVRDGAAGLLQSHPYREY* |
| Ga0134127_113222632 | 3300010399 | Terrestrial Soil | MRVVPILSGAKVALCPFCSRTVGIMRRVRDGAAGLLQSHPYRQY* |
| Ga0134123_100531307 | 3300010403 | Terrestrial Soil | MRVVPILPGAKVALCPFCSRPVGIMRMVRDGAAGLLQSHSYRQ |
| Ga0126359_10361022 | 3300010869 | Boreal Forest Soil | MRVVPILAGAKVALCPYCHRTVEIMRQVRDGAAGTLKSHPGRRY* |
| Ga0137314_10124095 | 3300011420 | Soil | MRVVPILSGAKVALCPYCNRTVGIMRAVRDGAAGLLQSHPYRQY* |
| Ga0137425_10337872 | 3300011422 | Soil | MRVVPILSGAKVALCPYCSRTVGIMRAVRDGVAGLLQSHPYRQY* |
| Ga0137455_11956572 | 3300011429 | Soil | MSVVPILSGAKVALCPYCSRTVGIMRAVRDGAAGLLQS |
| Ga0137427_101477732 | 3300011445 | Soil | MRVVPILSGAKVALCPYCSRTVGIMRAVRDGAAGMLQSHPYRQY* |
| Ga0150985_1001350702 | 3300012212 | Avena Fatua Rhizosphere | MRVVPILPGAKVALCPYCSRPVGIMRKVRDGAEGMLQSHPYRQY* |
| Ga0150985_1009939622 | 3300012212 | Avena Fatua Rhizosphere | MRVVPILPGAKVALCPYCSRPIGIMRKVRDGAAGMLQSHPYRQY* |
| Ga0150985_1067408012 | 3300012212 | Avena Fatua Rhizosphere | MRGVPLLPGAKVALCPYCRRPIGIMRKVRDGAAGMLQSHPYRQY* |
| Ga0150984_1053159912 | 3300012469 | Avena Fatua Rhizosphere | VVPILAGAKVALCPYCARTVGIMRQVRDGAAGLLQSHPYRLY* |
| Ga0157374_112555983 | 3300013296 | Miscanthus Rhizosphere | RRCRGTMRVVPILSGAKVALCPYCSRTVGIMRQVRDGAAGLLQSHPYRPY* |
| Ga0134079_106591371 | 3300014166 | Grasslands Soil | ILPGAKVALCPYCSRPIGIMRKVRDGAAGMLQSHPYRQY* |
| Ga0157376_122960191 | 3300014969 | Miscanthus Rhizosphere | MRVVPILSGAKVALCPYCSRTVGIMRRVRDGAAGLLQSHPYREY* |
| Ga0132258_134809862 | 3300015371 | Arabidopsis Rhizosphere | MSVVPILSGAKVALCPYCSRTVGIMRRVRDGAAGLLQSHPYRQY* |
| Ga0132255_1056377992 | 3300015374 | Arabidopsis Rhizosphere | VPILSGAKVALCPYCSRTVGIMRTVRDGAAGLLQSHPYRE |
| Ga0184625_100218732 | 3300018081 | Groundwater Sediment | MRVVPVLSGAKVALCPYCNRTVAIMRPVRDGAAALLKSHPFREYPENT |
| Ga0184625_104428201 | 3300018081 | Groundwater Sediment | MRVVPILSGAKVALCPYCSRTVGIMRAVRDGAAGLLQSHPYRQY |
| Ga0193712_10890692 | 3300019880 | Soil | MRVVPILSGAKVALCPYCSRTVGIMRRVRDGAAGLLQSHPYRQY |
| Ga0193697_10096392 | 3300020005 | Soil | MRVVPVLSGAKVAMCPYCNRTVAIMRPVRDGAAALLKSHPFREYPENT |
| Ga0197907_103975851 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | VAGAKVAVCPYCHRAVEIMREVRHGEAAMLKSHPSRRY |
| Ga0206353_105559413 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | AGAKVAVCPYGHRAVEIMREVRHGEAAMLKSHPSRRY |
| Ga0210380_100629913 | 3300021082 | Groundwater Sediment | MSVVPILSGAKVALCPYCSRTVGIMRAVRDGAAGLLQSHPYRQY |
| Ga0213876_100701544 | 3300021384 | Plant Roots | VVPILAGAKVALCPYCSRPVGIMRKVRDGAAGLLQSHPYRQY |
| Ga0193694_10178441 | 3300021415 | Soil | MRVVPILPGAKVALCPYCSRPVGIMRKVRDGAAGMLQSHPYRQY |
| Ga0222622_101761874 | 3300022756 | Groundwater Sediment | RRRCRGTMRVVPILSGAKVALCPYCSRTVGIMRAVRDGAAGLLQSHPYRQY |
| Ga0247688_10718081 | 3300024186 | Soil | RRCRGTMRVVPILPGAKVALCPFCSRPIGIMRKVRDGAEGLLQSHPYRQY |
| Ga0208356_10044674 | 3300025504 | Arctic Peat Soil | MRVVPILAGAKVALCPYCHRTVEIMRQVRDGAAGTLKSHPSRKY |
| Ga0207643_102055292 | 3300025908 | Miscanthus Rhizosphere | MRVVPILPGAKVALCPFCSRPVGIMRMVRDGAAGLLQSHSYRQY |
| Ga0207695_111234791 | 3300025913 | Corn Rhizosphere | VVPLVSGAKVALCPYCLRTVEIMRQVRDGEAAMLKSHPARRY |
| Ga0207662_102534413 | 3300025918 | Switchgrass Rhizosphere | VPILSGAKVALCPYCSRTVGIMRTVRDGAAGLLQSHPYREY |
| Ga0207701_100174031 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MRVVPILPGAKVALCPYCSRPVGIMRKVRDGSAGMLQSHPYRQY |
| Ga0207644_116809661 | 3300025931 | Switchgrass Rhizosphere | RCSGTMRVVPILPGAKVALCPYCSRPVGIMRKVRDGAAGMLQSHPYRQY |
| Ga0207669_118568241 | 3300025937 | Miscanthus Rhizosphere | MRVVPVLSGAKVALCPYCNRTVAIMRPVRDGAAGLLKSHPYREYPENT |
| Ga0207677_122436832 | 3300026023 | Miscanthus Rhizosphere | GTMRVVPILPGAKVALCPYCSRPVGIMRKVRDGAAGMLQSHPYRQY |
| Ga0209863_100303713 | 3300026281 | Prmafrost Soil | MRVVPILAGAKVALCPYCHRTVEIMRQVRDGAAGTLKSHPSRRY |
| Ga0209839_101096502 | 3300026294 | Soil | MRVVPILAGAKVAICPYCHRTVEIMRQVRDGAAGTLKSHPSRRY |
| Ga0207637_10107361 | 3300027483 | Soil | MRVVPILSGAKVALCPYCSRTVGIMRAVRDGAAGLLQ |
| Ga0247663_10257473 | 3300028145 | Soil | MRVVPILPGAKVALCPFCSRPIGIMRKVRDGAEGLLQSHPYRQY |
| Ga0268265_109365041 | 3300028380 | Switchgrass Rhizosphere | MRVVPILPGAKVALCPFCSRPVGIMRMVRDGAAGL |
| Ga0311332_102349864 | 3300029984 | Fen | TLRVVPLMSGAKVALCPYCQRTVEIMRQVRDGEAAMLKSHPGRRY |
| Ga0308189_103996022 | 3300031058 | Soil | MQVVPILSGAKVALCPYCSRTVGIMRRVRDGAAGLLQSHPYRQY |
| Ga0265325_100182444 | 3300031241 | Rhizosphere | MSGAKVALCPYCQRTVEIMRQVRDGEAAMLKSHPSRRY |
| Ga0265340_100668264 | 3300031247 | Rhizosphere | VPLMSGAKVALCPYCQRTVEIMRQVRDGEAAMLKSHPSRRY |
| Ga0318534_100134405 | 3300031544 | Soil | MRVVPVLPGAKVALCPYCLRTVEIMRSVRDGEAGSLKSHPERRFG |
| Ga0318534_100514595 | 3300031544 | Soil | LRVVPVLAGAKVALCPYCHRTVEIMRSVKDGEAGTLKSHPDRFRY |
| Ga0318542_104985013 | 3300031668 | Soil | LPGAKVALCPYCLRTVEIMRSVRDGEAGSLKSHPERRFG |
| Ga0318574_105843403 | 3300031680 | Soil | KGTLRVVPVLAGAKVALCPYCHRTVEIMRSVKDGEAGTLKSHPDRFRY |
| Ga0318547_100624522 | 3300031781 | Soil | MVPVLPGAKVALCPYCLRTVEIMRSVRDGEAGSLKSHPERRFG |
| Ga0308174_107597202 | 3300031939 | Soil | TLRVVPLVAGAKVALCPYCLRTVEIMRQVRDGEAAMLKSHPSRRY |
| Ga0310901_102676171 | 3300031940 | Soil | TLRRRCRGTMRVVPILPGAKVALCPFCSRPVGIMRMVRDGAAGLLQSHSYRQY |
| Ga0306926_111054413 | 3300031954 | Soil | VPVLAGAKVALCPYCHRTVEIMRSVKDGEAGTLKSHP |
| Ga0335076_100862292 | 3300032955 | Soil | MRVVPIVPGAKVALCPYCHRTVEIMRAVRDGEAGSLKSHPERR |
| Ga0364925_0319888_471_581 | 3300034147 | Sediment | MSGAKVALCPYCQRTVGIMRSVRNGEAGTLKSHPSRR |
| Ga0314780_094747_1_120 | 3300034659 | Soil | MRVVPILPGAKVALCPYCSRPVGIMRKVRDGAAGMLQSHP |
| Ga0314780_102654_540_653 | 3300034659 | Soil | MRVVPILAGAKVALCPYCSRPVGIMRAVRDGAAGLLQS |
| Ga0364923_0216395_390_518 | 3300034690 | Sediment | MRVVPILSGAKVALCPYCSRTVGIMRAVRDGAAGLLQSHPYRQ |
| ⦗Top⦘ |