


| Basic Information | |
|---|---|
| Family ID | F103401 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 101 |
| Average Sequence Length | 40 residues |
| Representative Sequence | LKDLDLHLCRKRVGSLVVASLHLIINILDIKGVNKPKNY |
| Number of Associated Samples | 28 |
| Number of Associated Scaffolds | 101 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.01 % |
| % of genes from short scaffolds (< 2000 bps) | 91.09 % |
| Associated GOLD sequencing projects | 28 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.020 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine (79.208 % of family members) |
| Environment Ontology (ENVO) | Unclassified (98.020 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (99.010 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.76% β-sheet: 0.00% Coil/Unstructured: 52.24% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 101 Family Scaffolds |
|---|---|---|
| PF00574 | CLP_protease | 85.15 |
| PF01938 | TRAM | 6.93 |
| PF11264 | ThylakoidFormat | 0.99 |
| PF09493 | DUF2389 | 0.99 |
| PF01177 | Asp_Glu_race | 0.99 |
| PF13638 | PIN_4 | 0.99 |
| PF02769 | AIRS_C | 0.99 |
| PF05656 | DUF805 | 0.99 |
| PF02601 | Exonuc_VII_L | 0.99 |
| PF00999 | Na_H_Exchanger | 0.99 |
| COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
|---|---|---|---|
| COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 170.30 |
| COG0740 | ATP-dependent protease ClpP, protease subunit | Posttranslational modification, protein turnover, chaperones [O] | 170.30 |
| COG1030 | Membrane-bound serine protease NfeD, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 85.15 |
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 0.99 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 0.99 |
| COG1570 | Exonuclease VII, large subunit | Replication, recombination and repair [L] | 0.99 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 0.99 |
| COG3152 | Uncharacterized membrane protein YhaH, DUF805 family | Function unknown [S] | 0.99 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 0.99 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 0.99 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.02 % |
| Unclassified | root | N/A | 1.98 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001830|ACM40_1015370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus | 1528 | Open in IMG/M |
| 3300001945|GOS2241_1025673 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus | 1373 | Open in IMG/M |
| 3300001951|GOS2249_1042612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus | 879 | Open in IMG/M |
| 3300001961|GOS2240_1025720 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus | 1670 | Open in IMG/M |
| 3300001964|GOS2234_1016522 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus | 1258 | Open in IMG/M |
| 3300005593|Ga0066837_10277436 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300006329|Ga0068486_1206929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus | 2248 | Open in IMG/M |
| 3300006334|Ga0099675_1248437 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300006334|Ga0099675_1273392 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus | 959 | Open in IMG/M |
| 3300006334|Ga0099675_1304784 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300006334|Ga0099675_1420332 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus | 526 | Open in IMG/M |
| 3300006337|Ga0068495_1149459 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300006337|Ga0068495_1239589 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus | 1060 | Open in IMG/M |
| 3300006337|Ga0068495_1243612 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
| 3300006337|Ga0068495_1306502 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300006337|Ga0068495_1367488 | Not Available | 958 | Open in IMG/M |
| 3300006337|Ga0068495_1383314 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300006337|Ga0068495_1394912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus | 1013 | Open in IMG/M |
| 3300006337|Ga0068495_1412237 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300006337|Ga0068495_1454736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus | 1456 | Open in IMG/M |
| 3300006337|Ga0068495_1477546 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300006337|Ga0068495_1783552 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300006345|Ga0099693_1127839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus | 1368 | Open in IMG/M |
| 3300006345|Ga0099693_1131138 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus | 900 | Open in IMG/M |
| 3300006345|Ga0099693_1141711 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus | 3439 | Open in IMG/M |
| 3300006345|Ga0099693_1161795 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300006345|Ga0099693_1167020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → unclassified Prochlorococcus → Prochlorococcus sp. | 896 | Open in IMG/M |
| 3300006345|Ga0099693_1240097 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus | 1351 | Open in IMG/M |
| 3300006345|Ga0099693_1349083 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300006350|Ga0099954_1110954 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus | 3007 | Open in IMG/M |
| 3300006350|Ga0099954_1110978 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus | 1378 | Open in IMG/M |
| 3300006350|Ga0099954_1159826 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300006350|Ga0099954_1186764 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300006350|Ga0099954_1195683 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300006350|Ga0099954_1220295 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300006350|Ga0099954_1232844 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300006350|Ga0099954_1238126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus | 1766 | Open in IMG/M |
| 3300006350|Ga0099954_1259553 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300006351|Ga0099953_1118264 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus | 1503 | Open in IMG/M |
| 3300006351|Ga0099953_1129600 | All Organisms → cellular organisms → Bacteria | 1158 | Open in IMG/M |
| 3300006351|Ga0099953_1160139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus | 1326 | Open in IMG/M |
| 3300006351|Ga0099953_1200117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus | 994 | Open in IMG/M |
| 3300006351|Ga0099953_1309488 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300006351|Ga0099953_1339790 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300006351|Ga0099953_1346180 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300006351|Ga0099953_1430789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus | 1101 | Open in IMG/M |
| 3300006351|Ga0099953_1517971 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus | 920 | Open in IMG/M |
| 3300006413|Ga0099963_1100443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus | 2421 | Open in IMG/M |
| 3300006413|Ga0099963_1139359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus | 1390 | Open in IMG/M |
| 3300006413|Ga0099963_1143575 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300006413|Ga0099963_1150319 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus | 2932 | Open in IMG/M |
| 3300006413|Ga0099963_1165541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus | 1384 | Open in IMG/M |
| 3300006413|Ga0099963_1173255 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus | 1812 | Open in IMG/M |
| 3300006413|Ga0099963_1183149 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus | 1912 | Open in IMG/M |
| 3300006413|Ga0099963_1223451 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus | 1399 | Open in IMG/M |
| 3300006413|Ga0099963_1231837 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300006413|Ga0099963_1234461 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300006413|Ga0099963_1261660 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus | 945 | Open in IMG/M |
| 3300006413|Ga0099963_1325943 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300006413|Ga0099963_1330443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus | 977 | Open in IMG/M |
| 3300006413|Ga0099963_1380247 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus | 986 | Open in IMG/M |
| 3300006413|Ga0099963_1398964 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300006480|Ga0100226_1193493 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus | 980 | Open in IMG/M |
| 3300006480|Ga0100226_1197955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus | 2495 | Open in IMG/M |
| 3300006480|Ga0100226_1275276 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300006480|Ga0100226_1282541 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300006480|Ga0100226_1290895 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300006480|Ga0100226_1303242 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus | 1423 | Open in IMG/M |
| 3300006480|Ga0100226_1331395 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus | 1366 | Open in IMG/M |
| 3300006480|Ga0100226_1393799 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300006480|Ga0100226_1413207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus | 880 | Open in IMG/M |
| 3300006480|Ga0100226_1442873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 739 | Open in IMG/M |
| 3300006480|Ga0100226_1449976 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300006481|Ga0100229_1176759 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus | 1007 | Open in IMG/M |
| 3300006481|Ga0100229_1179124 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus | 2041 | Open in IMG/M |
| 3300006481|Ga0100229_1190771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus | 3602 | Open in IMG/M |
| 3300006481|Ga0100229_1194947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus | 1094 | Open in IMG/M |
| 3300006481|Ga0100229_1210085 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus | 1219 | Open in IMG/M |
| 3300006481|Ga0100229_1228596 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300006481|Ga0100229_1237573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus | 1057 | Open in IMG/M |
| 3300006481|Ga0100229_1251234 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300006481|Ga0100229_1369929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → unclassified Prochlorococcus → Prochlorococcus sp. | 1433 | Open in IMG/M |
| 3300006481|Ga0100229_1372059 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus | 940 | Open in IMG/M |
| 3300006481|Ga0100229_1396225 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300006481|Ga0100229_1460864 | Not Available | 584 | Open in IMG/M |
| 3300006481|Ga0100229_1552649 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300006565|Ga0100228_1473708 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300007591|Ga0102781_1173083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus | 1464 | Open in IMG/M |
| 3300009677|Ga0115104_10739773 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300011324|Ga0138385_1249536 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300012936|Ga0163109_10170400 | All Organisms → cellular organisms → Bacteria | 1599 | Open in IMG/M |
| 3300012936|Ga0163109_11202907 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300012936|Ga0163109_11413563 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300018671|Ga0193571_1018784 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300020404|Ga0211659_10295002 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300020406|Ga0211668_10245181 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300020429|Ga0211581_10262533 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300026077|Ga0208749_1060540 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300027774|Ga0209433_10007962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus | 3345 | Open in IMG/M |
| 3300027830|Ga0209359_10094963 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus | 1246 | Open in IMG/M |
| 3300031785|Ga0310343_11217006 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 79.21% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 7.92% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 4.95% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 2.97% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 1.98% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.99% |
| Marine Plankton | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton | 0.99% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 0.99% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001830 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM40, ROCA_DNA028_0.2um_3l | Environmental | Open in IMG/M |
| 3300001945 | Marine microbial communities from Galapagos, Equador - GS026 | Environmental | Open in IMG/M |
| 3300001951 | Marine microbial communities from North Seamore Island, Equador - GS034 | Environmental | Open in IMG/M |
| 3300001961 | Marine microbial communities from Dirty Rock, Cocos Island, Costa Rica - GS025 | Environmental | Open in IMG/M |
| 3300001964 | Marine microbial communities from Rosario Bank, Honduras - GS018 | Environmental | Open in IMG/M |
| 3300005593 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV86 | Environmental | Open in IMG/M |
| 3300006329 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT233_1_0500m | Environmental | Open in IMG/M |
| 3300006334 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_0025m | Environmental | Open in IMG/M |
| 3300006337 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT237_3_0025m | Environmental | Open in IMG/M |
| 3300006345 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_0075m | Environmental | Open in IMG/M |
| 3300006350 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_0075m | Environmental | Open in IMG/M |
| 3300006351 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_0045m | Environmental | Open in IMG/M |
| 3300006413 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_2_0025m | Environmental | Open in IMG/M |
| 3300006480 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_1_0075m | Environmental | Open in IMG/M |
| 3300006481 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_2_0025m | Environmental | Open in IMG/M |
| 3300006565 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_2_0125m | Environmental | Open in IMG/M |
| 3300007591 | Marine microbial communities from the Southern Atlantic ocean - KN S15 DCM_B metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009677 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011324 | Marine microbial communities from the Southern Atlantic ocean - KN S17 DCM_A metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300012936 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaG | Environmental | Open in IMG/M |
| 3300018671 | Metatranscriptome of marine prokaryotic communities collected during Tara Oceans survey from station TARA_078 - TARA_B100000524 | Environmental | Open in IMG/M |
| 3300020404 | Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX555954-ERR598978) | Environmental | Open in IMG/M |
| 3300020406 | Marine microbial communities from Tara Oceans - TARA_B100000886 (ERX555926-ERR599024) | Environmental | Open in IMG/M |
| 3300020429 | Marine microbial communities from Tara Oceans - TARA_B100000614 (ERX556134-ERR599032) | Environmental | Open in IMG/M |
| 3300026077 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_DCM_ad_63m_LV_B (SPAdes) | Environmental | Open in IMG/M |
| 3300027774 | Marine microbial communities from oxygen minimum zone in mesopelagic equatorial Pacific - METZYME_5_50m (SPAdes) | Environmental | Open in IMG/M |
| 3300027830 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - Surface_A/KNORR_S2/LV (SPAdes) | Environmental | Open in IMG/M |
| 3300031785 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-25_MG | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ACM40_10153702 | 3300001830 | Marine Plankton | FYYLKDLDQHLCRKRVGSLVVASLLLIINILDIKGVNKTKNY* |
| GOS2241_10256731 | 3300001945 | Marine | LFYYLKDLDLHLCRKRVGSLVLASLLLVIYILDIKRVNKPIIY* |
| GOS2249_10426123 | 3300001951 | Marine | LKDLDRHLCRKRVGSLVVASLHLIINILDIKVTINQKNY* |
| GOS2240_10257203 | 3300001961 | Marine | SQLFYYLKDLDLHLCRKRVGSLVVASLQLIINILDIKGVNKPKNY* |
| GOS2234_10165223 | 3300001964 | Marine | LDLHLCRKRVGSLVVASLHLILNILDIKGVNKLQNY* |
| Ga0066837_102774361 | 3300005593 | Marine | KDLDLHLCRKRVGSLVVASLLLIVIILDIKVAINQKNY* |
| Ga0068486_12069291 | 3300006329 | Marine | LHLCRKRVGSLVQASLHLIINILDIKRVNKPIIYQFKNEN* |
| Ga0099675_12484371 | 3300006334 | Marine | YLKDLDLHLCRKRVGSLVVASLHLIINILDIKVTINQKNY* |
| Ga0099675_12733923 | 3300006334 | Marine | LRDLDLHLCRKRVGSLVVASLRLIVIILDIKVAINQKNY* |
| Ga0099675_13047841 | 3300006334 | Marine | YLRDLDLHLCRKRVGSLVVASLRLIVIILDIKVAINQKNY* |
| Ga0099675_14203321 | 3300006334 | Marine | YLKDLDLHLCRKRVGSLVVASLHLIINILDIKVAIKQKN* |
| Ga0068495_11494592 | 3300006337 | Marine | LHLSRKRVGSLVVASLHLIINILDIKGVNKPKNY* |
| Ga0068495_12395891 | 3300006337 | Marine | GLDLHLCRKRVGSLVVASLHLLINILDIKGVNKPKNY* |
| Ga0068495_12436121 | 3300006337 | Marine | IEFILFYYLKDLDLHLCRKRVGSLVVASLHLIINILDIKVAINQKNY* |
| Ga0068495_13065022 | 3300006337 | Marine | TIIVLLFYYLKDLDLHLCRKRVGSLVVASLHLIINILDIKGVNKPKNY* |
| Ga0068495_13674881 | 3300006337 | Marine | NNLKDLDLHLCRKRVGSLVVASLHKIINILDIKGVNNPKNY* |
| Ga0068495_13833142 | 3300006337 | Marine | KGLDLHLCRKRVVSLVVTSLHFIINILDIKGVNKLKNY* |
| Ga0068495_13949123 | 3300006337 | Marine | IYEKILFYYLKDLDLHLCRKRVGSLVVASLHMIINILDIKVAINQKNY* |
| Ga0068495_14122372 | 3300006337 | Marine | FCYLKGLDLHLCRKRVVSLVVTSLHLIIIILDIKGVNKSKNYKFKN* |
| Ga0068495_14547361 | 3300006337 | Marine | GLDLHLCRKRAGSLVVASWHLIINILDIKGVNKPINY* |
| Ga0068495_14775462 | 3300006337 | Marine | LKDLDLHLCRKRVGSLVVASLRLIVIILDIKVAINQKNY* |
| Ga0068495_17835522 | 3300006337 | Marine | LDLHLCRKRVGSLVVASLHLLINIIDIKGVNKPKNY* |
| Ga0099693_11278391 | 3300006345 | Marine | EDLNLHLCRKRVGSLVVASLHLIINILDIKGVNKPKNY* |
| Ga0099693_11311381 | 3300006345 | Marine | DLDLHLCRRRVGSLVVASLQLIINILDIKEAINQKNY* |
| Ga0099693_11417115 | 3300006345 | Marine | YYLKDLDLHLCRKRVGSLVVASLHLIINILDIKVEINQKNY* |
| Ga0099693_11617951 | 3300006345 | Marine | SLLFYYLKDLDLHLCRKRVGSLVVASLHLIVIILDIKVAINQKNY* |
| Ga0099693_11670203 | 3300006345 | Marine | YLKDLDLHLCRKRVESLVLASLLLIINILDIKRVNKPILY* |
| Ga0099693_12400973 | 3300006345 | Marine | KDLDLHLCRKRVGSLVVASLHLIINILDIKVAINQKNY* |
| Ga0099693_13490831 | 3300006345 | Marine | LKDLDLHLCRKRVGSLVVASLRLIVIILDIKVTINQKNY* |
| Ga0099954_11109541 | 3300006350 | Marine | YLKELDLHLCRKRVGSLVVASLRLIVIILDIKVVINQKNY* |
| Ga0099954_11109781 | 3300006350 | Marine | LHLCRKRVGSLVVASVRLIINILDIKGVNKPKNY* |
| Ga0099954_11598262 | 3300006350 | Marine | LHLCRKRVGSLVVASLRLIINILDIKGVNKPKNY* |
| Ga0099954_11867641 | 3300006350 | Marine | LHLCRKRVGSLVVASLHLIINILDIKGVNKPKNY* |
| Ga0099954_11956831 | 3300006350 | Marine | LKDLDLHLRRKRVESLVVASLHLIINILDIKGVNKPKNY* |
| Ga0099954_12202952 | 3300006350 | Marine | YYLKYLDLHLCRKRVGSLVVASLRLIVIILDIKVVINHKNY* |
| Ga0099954_12328442 | 3300006350 | Marine | LHLCRKRVVSLVVASLHLIINILDIKGVNKPINY* |
| Ga0099954_12381264 | 3300006350 | Marine | DQHLCRKRVGSLVVASLHFIVIILDIKVTINQKNY* |
| Ga0099954_12595532 | 3300006350 | Marine | QHLCRKRVGSLVVASLHLIINILDIKGVNKPKNY* |
| Ga0099953_11182643 | 3300006351 | Marine | HIQLSQLFYYSRDLDLHLCRKRVESLVVASFHLIINILDIKGVNKPKNY* |
| Ga0099953_11296001 | 3300006351 | Marine | IQLSQSFYYLKGLDLHLCRKRVGSLVVASWHLIINILDIKRVNKPINY* |
| Ga0099953_11601391 | 3300006351 | Marine | SLLFYYLKDLDLHLCRKRVGSLVVASLHLIIIILDIKV* |
| Ga0099953_12001171 | 3300006351 | Marine | LDLHLCRKRVGSLVVASLQLIINILDIKVVINQKNY* |
| Ga0099953_13094882 | 3300006351 | Marine | YLKDLDLHLCRKRVGSLVLASLHLIINILDIKVAINQKNY* |
| Ga0099953_13397901 | 3300006351 | Marine | LKDLDLHLCRKRVGSLVVASLHLIIIILDIKVAINQKNY* |
| Ga0099953_13461801 | 3300006351 | Marine | DLRLCRKRVGSLVVASLHFIVIILDIKVTINQKNY* |
| Ga0099953_14307893 | 3300006351 | Marine | KDLDLHLCRKRVGSLVLASLLLIINILDIKRVNKPIIYLFKNEN* |
| Ga0099953_15179713 | 3300006351 | Marine | SLLFYYLKDLDLHLCRKRVGSLVVASLHLINNILDIKGVNKPKNY* |
| Ga0099963_11004431 | 3300006413 | Marine | DLHLCRKRVGSLVGTSLHWIINILDIKGVNKPKNY* |
| Ga0099963_11393593 | 3300006413 | Marine | KGLDLHQCRKRVGSLVVASLQLIINILDIKSVNKPNNY* |
| Ga0099963_11435752 | 3300006413 | Marine | YLKDLDLHLCRKRVGSLVVASLHKIINILDIKGVNKPKNN* |
| Ga0099963_11503191 | 3300006413 | Marine | KDLDLHLCRRRVGSLVVVTLHLIINILGIKGVNKPKNY* |
| Ga0099963_11655414 | 3300006413 | Marine | DLHLCRKRVGSLVVASLHLIIIILDIKGVNKSKNY* |
| Ga0099963_11732551 | 3300006413 | Marine | SLLFYFLKDLDLHQCRRRVGSLVVASLHFIINILDIKGVNKPKNY* |
| Ga0099963_11831491 | 3300006413 | Marine | YLRDLDLHLCRKRVGSLVVASLHLIINILDIKGVNKPRCY* |
| Ga0099963_12234514 | 3300006413 | Marine | LKGLGLHLCRKRVGSLVVASLHLIINILGIKGVNKPKNY* |
| Ga0099963_12318371 | 3300006413 | Marine | LKDLDLHLCRKRVGSLVVASLHLIINILDIKGVNKPKNY* |
| Ga0099963_12344612 | 3300006413 | Marine | DLDLHLCRKRVGSLVVASLHLIINILDIKGVNKPKNY* |
| Ga0099963_12616603 | 3300006413 | Marine | LKGLDLHLCRKRVGSLVVASLHLIINILDIKCVNKPINY* |
| Ga0099963_13259432 | 3300006413 | Marine | LHQCRKRVESLVVASLHLIINNIDIKGVNKPINY* |
| Ga0099963_13304431 | 3300006413 | Marine | FYYLKDLDLHLCRKRVGSLVVASLHFIVIILDIKVAINQKNC* |
| Ga0099963_13802471 | 3300006413 | Marine | KDLDLHLCRKRVGSLVVASLRLIVIILDIKVVINQKNY* |
| Ga0099963_13989642 | 3300006413 | Marine | YLKDLDLHLCRKRVGSLVVASLRLIINILDIKGVNKPKNY* |
| Ga0100226_11934931 | 3300006480 | Marine | DLHLCRKRVGSLVVASLHLIINILDFKGVNKPKNYKFKN* |
| Ga0100226_11979556 | 3300006480 | Marine | DLDLHLCRKRVGSLVVASLHLIINIFDIKGVNKPKNY* |
| Ga0100226_12752761 | 3300006480 | Marine | LDLHLCRKRVGSLVVASLRLIVIILDIKVVINQKNY* |
| Ga0100226_12825411 | 3300006480 | Marine | DLHLCRKRVGSLVVASLHLIINILDIKGVNKPKNY* |
| Ga0100226_12908952 | 3300006480 | Marine | DLDLHLCRKRVGALVVFALHLIINILDFKGVNNPRNY* |
| Ga0100226_13032421 | 3300006480 | Marine | LFYYLKDLDLHLCRKRVGSLVLTSLLLIINILDIKRVNKPNNY* |
| Ga0100226_13313951 | 3300006480 | Marine | LDLHLCRKRVGSLVVASLHLIINILDIKEAINQKNY* |
| Ga0100226_13937991 | 3300006480 | Marine | FYYLKDLDLHLCRKRVGSLVVASLHLIINILDIKVTINQKNY* |
| Ga0100226_14132071 | 3300006480 | Marine | HLYRKRVGSLVVASLHLIIIILDNKGVNKPKNCKFKN* |
| Ga0100226_14428731 | 3300006480 | Marine | YLKDLDLHLCLKRVWSLVVASLHLIVNILDNKGVNKPKN* |
| Ga0100226_14499762 | 3300006480 | Marine | LKGLDLHLCRKRVVSLVVASLHLIINILDIKGVNKPINYYFKN* |
| Ga0100229_11767591 | 3300006481 | Marine | YLKDLDLHLCRKRVGALVVASLRLIVIILDIKVAINQTNY* |
| Ga0100229_11791241 | 3300006481 | Marine | LHLCRKRVGSLVVATLHLIINILDIKEAINQKNY* |
| Ga0100229_11907711 | 3300006481 | Marine | IHIQLSLLFYFFKDLDLHLCRKRVGSLVVASLQLIIIILDIKV* |
| Ga0100229_11949471 | 3300006481 | Marine | LHLCRKRVVSLDVASLHLIINILDIKGVNKPINY* |
| Ga0100229_12100853 | 3300006481 | Marine | WLLFYYLKDLDLHLCHKRVGSLVVASLHLIIDILDIKGVNILKNY* |
| Ga0100229_12285962 | 3300006481 | Marine | FYYLKDLDLHLCRKRVGSLVVASLHLIINILDIKGVNKPINY* |
| Ga0100229_12375733 | 3300006481 | Marine | YLKDLDLHLCRKRVGSLVVATLHLIINILDIKGVN* |
| Ga0100229_12512342 | 3300006481 | Marine | DLDLHLCRKRVGSLVVASLHLIINILDIKGVNKSKNY* |
| Ga0100229_13699293 | 3300006481 | Marine | LQLFYYLRDLDLHLCRKRVESLVVASLHLIINILDIKGINKPKNY* |
| Ga0100229_13720591 | 3300006481 | Marine | LDLHLCRKRVGSLEVASLHLIINILDIKGVNKPKNY* |
| Ga0100229_13962252 | 3300006481 | Marine | YLKDLDLHLCRKRVGSLVVASLRLIVIILDIKVSINQKNY* |
| Ga0100229_14608642 | 3300006481 | Marine | FYYLKDLDLHLCRKRVGSLVVASLHLIINILDIKGVNKPINYKFKN* |
| Ga0100229_15526491 | 3300006481 | Marine | DLDLHLCRKRVWALVVASLRLIINILDIKGVNTPKNY* |
| Ga0100228_14737081 | 3300006565 | Marine | GKGTFYFLRDLDQHLCHKRVLSLVVVSILLIIHILDIKSVNKTINTLFKI* |
| Ga0102781_11730831 | 3300007591 | Marine | LRDLDQHLCHKRVVSLVVVSILLITHILDIKSVNKTINTLFKN* |
| Ga0115104_107397731 | 3300009677 | Marine | LCHKRVVSLVVTSKLLIVNILDIKGVNKPYNCSFKN* |
| Ga0138385_12495362 | 3300011324 | Marine | YYLRDLDQHLCHKRVLSLVVVSKLLIIHILDIKRVNKTKNTFFKN* |
| Ga0163109_101704004 | 3300012936 | Surface Seawater | LFYCLKDLDLHLCRNRVGSLVVASLRLIINILDIKGVNKTKNY* |
| Ga0163109_112029072 | 3300012936 | Surface Seawater | YYLKDLDLHLCRKRVGSLVVASLHLIINILDIKGVHKTKNY* |
| Ga0163109_114135632 | 3300012936 | Surface Seawater | LKDLDLHLCRKRVGSLVVASLHLIINILDIKGVNKTKNY* |
| Ga0193571_10187841 | 3300018671 | Marine | LDLHLCRKRVGSLVVASLHLIINILDIKGVNKPKNY |
| Ga0211659_102950021 | 3300020404 | Marine | LLLSFFYLKDLGQHPCHKRVESLVVVSKLLIVNILDIKCVNKPINYLFKN |
| Ga0211668_102451811 | 3300020406 | Marine | LFYYLKGLDLHLSRKRVGSLVVTTLQLIISILDVKRVNKPIN |
| Ga0211581_102625332 | 3300020429 | Marine | DLHLCRNRVGSLVVASLRLIINILDIKGVNKTKNY |
| Ga0208749_10605402 | 3300026077 | Marine | LKDLDLHLCRKRVGSLVVTSLHLIINILDIKRVNKPINY |
| Ga0209433_100079625 | 3300027774 | Marine | FYCLKDLDLHLCRNRVGSLVVASLRLIINILDIKGVNKTKNY |
| Ga0209359_100949633 | 3300027830 | Marine | GLDLHLCRKRVVSLVVASLHLIINILDIKGVNKPINY |
| Ga0310343_112170061 | 3300031785 | Seawater | LGLHLRRKRVGSLVVASLHLIINILDNKGLNKPKNY |
| ⦗Top⦘ |