


| Basic Information | |
|---|---|
| Family ID | F103323 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 101 |
| Average Sequence Length | 45 residues |
| Representative Sequence | SFHDHDTDGSARAFGGTETVDNLPANPPPFNPQGEKGEFGRPDA |
| Number of Associated Samples | 65 |
| Number of Associated Scaffolds | 101 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 91.09 % |
| Associated GOLD sequencing projects | 59 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.079 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Phototrophic Mat (51.485 % of family members) |
| Environment Ontology (ENVO) | Unclassified (99.010 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (51.485 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 101 Family Scaffolds |
|---|---|---|
| PF04851 | ResIII | 2.97 |
| PF01738 | DLH | 2.97 |
| PF12850 | Metallophos_2 | 2.97 |
| PF00496 | SBP_bac_5 | 1.98 |
| PF13366 | PDDEXK_3 | 1.98 |
| PF03787 | RAMPs | 1.98 |
| PF01370 | Epimerase | 1.98 |
| PF03466 | LysR_substrate | 0.99 |
| PF00300 | His_Phos_1 | 0.99 |
| PF00072 | Response_reg | 0.99 |
| PF13088 | BNR_2 | 0.99 |
| PF00149 | Metallophos | 0.99 |
| PF03681 | Obsolete Pfam Family | 0.99 |
| PF14344 | DUF4397 | 0.99 |
| PF04932 | Wzy_C | 0.99 |
| PF00005 | ABC_tran | 0.99 |
| PF02782 | FGGY_C | 0.99 |
| PF13304 | AAA_21 | 0.99 |
| PF07676 | PD40 | 0.99 |
| PF09455 | Cas_DxTHG | 0.99 |
| PF13242 | Hydrolase_like | 0.99 |
| PF00999 | Na_H_Exchanger | 0.99 |
| PF00465 | Fe-ADH | 0.99 |
| PF12697 | Abhydrolase_6 | 0.99 |
| PF07927 | HicA_toxin | 0.99 |
| PF04545 | Sigma70_r4 | 0.99 |
| PF02254 | TrkA_N | 0.99 |
| COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
|---|---|---|---|
| COG1332 | CRISPR-Cas system type III CSM-effector complex subunit Csm5, RAMP superfamily Cas7 group | Defense mechanisms [V] | 1.98 |
| COG1336 | CRISPR-Cas system type III CMR-effector complex subunit Cmr4, RAMP superfamily Cas7 group | Defense mechanisms [V] | 1.98 |
| COG1337 | CRISPR-Cas system type III CSM-effector complex subunit Csm3, RAMP superfamily Cas7 group | Defense mechanisms [V] | 1.98 |
| COG1367 | CRISPR-Cas system type III CMR-effector complex subunit Cmr1, RAMP superfamily Cas7 group | Defense mechanisms [V] | 1.98 |
| COG1567 | CRISPR-Cas system type III CSM-effector complex subunit Csm4, RAMP superfamily Cas5 group | Defense mechanisms [V] | 1.98 |
| COG1604 | CRISPR/Cas system CMR subunit Cmr6, Cas7 group, RAMP superfamily | Defense mechanisms [V] | 1.98 |
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 0.99 |
| COG0337 | 3-dehydroquinate synthetase | Amino acid transport and metabolism [E] | 0.99 |
| COG0371 | Glycerol dehydrogenase or related enzyme, iron-containing ADH family | Energy production and conversion [C] | 0.99 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 0.99 |
| COG1454 | Alcohol dehydrogenase, class IV | Energy production and conversion [C] | 0.99 |
| COG1724 | Predicted RNA binding protein YcfA, dsRBD-like fold, HicA-like mRNA interferase family | General function prediction only [R] | 0.99 |
| COG1979 | Alcohol dehydrogenase YqhD, Fe-dependent ADH family | Energy production and conversion [C] | 0.99 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 0.99 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 0.99 |
| COG3307 | O-antigen ligase | Cell wall/membrane/envelope biogenesis [M] | 0.99 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 0.99 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.08 % |
| Unclassified | root | N/A | 7.92 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002493|JGI24185J35167_1034919 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus | 1165 | Open in IMG/M |
| 3300005240|Ga0068641_129498 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1280 | Open in IMG/M |
| 3300005241|Ga0068642_110773 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300005242|Ga0068639_118177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 552 | Open in IMG/M |
| 3300005243|Ga0068643_1006368 | All Organisms → cellular organisms → Bacteria | 3135 | Open in IMG/M |
| 3300005243|Ga0068643_1014918 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300005245|Ga0068640_110268 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 815 | Open in IMG/M |
| 3300005245|Ga0068640_133574 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300005247|Ga0068637_1015166 | All Organisms → cellular organisms → Bacteria | 1226 | Open in IMG/M |
| 3300005247|Ga0068637_1015348 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 748 | Open in IMG/M |
| 3300005250|Ga0068635_1068360 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1020 | Open in IMG/M |
| 3300005251|Ga0068634_1061962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 979 | Open in IMG/M |
| 3300005411|Ga0068647_1027291 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300005413|Ga0068633_1047224 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300005452|Ga0068706_1096647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 516 | Open in IMG/M |
| 3300005453|Ga0068705_10090530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 840 | Open in IMG/M |
| 3300005490|Ga0068662_105771 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300005494|Ga0068668_1009187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 519 | Open in IMG/M |
| 3300005494|Ga0068668_1021758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 864 | Open in IMG/M |
| 3300005495|Ga0068666_1012467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 869 | Open in IMG/M |
| 3300005495|Ga0068666_1025114 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300005495|Ga0068666_1026807 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1172 | Open in IMG/M |
| 3300005499|Ga0068667_1027704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 934 | Open in IMG/M |
| 3300005499|Ga0068667_1042914 | All Organisms → cellular organisms → Bacteria | 1658 | Open in IMG/M |
| 3300005638|Ga0068669_1073921 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300006380|Ga0068664_1119559 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 595 | Open in IMG/M |
| 3300006848|Ga0101768_1023664 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 676 | Open in IMG/M |
| 3300006848|Ga0101768_1057370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 517 | Open in IMG/M |
| 3300006849|Ga0102029_1223846 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 745 | Open in IMG/M |
| 3300006849|Ga0102029_1229293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 567 | Open in IMG/M |
| 3300007000|Ga0102499_1147404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 531 | Open in IMG/M |
| 3300010176|Ga0124933_155720 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300010179|Ga0124936_1096654 | All Organisms → cellular organisms → Bacteria | 1298 | Open in IMG/M |
| 3300010181|Ga0124926_1078131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2577 | Open in IMG/M |
| 3300010183|Ga0124919_1143618 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 641 | Open in IMG/M |
| 3300010186|Ga0124916_1015669 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 502 | Open in IMG/M |
| 3300010191|Ga0124914_1197049 | Not Available | 752 | Open in IMG/M |
| 3300010193|Ga0124924_1114208 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 1641 | Open in IMG/M |
| 3300010246|Ga0124932_105912 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300010251|Ga0124940_1061987 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1595 | Open in IMG/M |
| 3300010256|Ga0124939_1187297 | Not Available | 582 | Open in IMG/M |
| 3300020153|Ga0197142_1037960 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 2054 | Open in IMG/M |
| 3300026237|Ga0209750_1038536 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| 3300026237|Ga0209750_1070974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 610 | Open in IMG/M |
| 3300026237|Ga0209750_1071631 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 606 | Open in IMG/M |
| 3300026509|Ga0209809_1031618 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 1869 | Open in IMG/M |
| 3300027279|Ga0209691_1010907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 2831 | Open in IMG/M |
| 3300027279|Ga0209691_1067277 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 641 | Open in IMG/M |
| 3300028761|Ga0272447_1063781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 530 | Open in IMG/M |
| 3300031245|Ga0308395_1010348 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 3689 | Open in IMG/M |
| 3300031245|Ga0308395_1056326 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 1006 | Open in IMG/M |
| 3300031245|Ga0308395_1087693 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 729 | Open in IMG/M |
| 3300031245|Ga0308395_1100453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 662 | Open in IMG/M |
| 3300031508|Ga0308394_1079983 | Not Available | 692 | Open in IMG/M |
| 3300031508|Ga0308394_1083940 | Not Available | 668 | Open in IMG/M |
| 3300031508|Ga0308394_1088623 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 643 | Open in IMG/M |
| 3300031508|Ga0308394_1089947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 636 | Open in IMG/M |
| 3300031509|Ga0308399_1023555 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales | 1535 | Open in IMG/M |
| 3300031509|Ga0308399_1081236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 663 | Open in IMG/M |
| 3300031512|Ga0308397_1031884 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 1415 | Open in IMG/M |
| 3300031512|Ga0308397_1065318 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 843 | Open in IMG/M |
| 3300031512|Ga0308397_1093176 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 654 | Open in IMG/M |
| 3300031512|Ga0308397_1100598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 620 | Open in IMG/M |
| 3300031512|Ga0308397_1126208 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 530 | Open in IMG/M |
| 3300031513|Ga0308412_1111728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 805 | Open in IMG/M |
| 3300031513|Ga0308412_1121015 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 761 | Open in IMG/M |
| 3300031513|Ga0308412_1134137 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 708 | Open in IMG/M |
| 3300031513|Ga0308412_1176789 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300031513|Ga0308412_1205497 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 530 | Open in IMG/M |
| 3300031514|Ga0308390_1016299 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 2655 | Open in IMG/M |
| 3300031516|Ga0308398_1057209 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 941 | Open in IMG/M |
| 3300031517|Ga0308392_1001730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 8643 | Open in IMG/M |
| 3300031767|Ga0308401_1074069 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 666 | Open in IMG/M |
| 3300031776|Ga0308415_1015173 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 2369 | Open in IMG/M |
| 3300031776|Ga0308415_1082104 | Not Available | 681 | Open in IMG/M |
| 3300031776|Ga0308415_1095672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 605 | Open in IMG/M |
| 3300031783|Ga0308418_1045513 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 1097 | Open in IMG/M |
| 3300031812|Ga0308411_10019353 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 3822 | Open in IMG/M |
| 3300031865|Ga0308408_1068165 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 831 | Open in IMG/M |
| 3300031948|Ga0308406_1031216 | All Organisms → cellular organisms → Bacteria | 1295 | Open in IMG/M |
| 3300031948|Ga0308406_1083578 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300031950|Ga0308417_1112459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 949 | Open in IMG/M |
| 3300031950|Ga0308417_1197697 | Not Available | 630 | Open in IMG/M |
| 3300031966|Ga0308420_1071902 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1181 | Open in IMG/M |
| 3300031966|Ga0308420_1228381 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 521 | Open in IMG/M |
| 3300032033|Ga0308402_1042260 | Not Available | 923 | Open in IMG/M |
| 3300032034|Ga0308407_1055377 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
| 3300032034|Ga0308407_1112488 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 546 | Open in IMG/M |
| 3300032045|Ga0308400_1098559 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300032049|Ga0308416_1030371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1223 | Open in IMG/M |
| 3300032056|Ga0308310_1092699 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 734 | Open in IMG/M |
| 3300032057|Ga0308421_1117102 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 625 | Open in IMG/M |
| 3300032058|Ga0308419_1097697 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 849 | Open in IMG/M |
| 3300032058|Ga0308419_1101085 | Not Available | 826 | Open in IMG/M |
| 3300032356|Ga0308414_1198980 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1 | 580 | Open in IMG/M |
| 3300033886|Ga0308413_025638 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1962 | Open in IMG/M |
| 3300034647|Ga0372968_008638 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1670 | Open in IMG/M |
| 3300034649|Ga0372972_009594 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1779 | Open in IMG/M |
| 3300034649|Ga0372972_013749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1391 | Open in IMG/M |
| 3300034649|Ga0372972_020181 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1061 | Open in IMG/M |
| 3300034650|Ga0372973_009574 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1935 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Hot Spring Phototrophic Mat | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Phototrophic Mat | 51.49% |
| Anoxygenic And Chlorotrophic Microbial Mat | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic Microbial Mat | 41.58% |
| Anoxygenic And Chlorotrophic | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic | 4.95% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.99% |
| Microbial Mat | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Microbial Mat | 0.99% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002493 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP Bryant MS undermat 2012 | Environmental | Open in IMG/M |
| 3300005240 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_0700_T MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005241 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_0800_T MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005242 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_0300_T MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005243 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_0900_T MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005245 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_0600_T MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005247 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_2000_T MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005250 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1800_T MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005251 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1700_T MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005411 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1400(2)_T MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005413 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1500_T MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005452 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS-B MetaG | Environmental | Open in IMG/M |
| 3300005453 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS-T MetaG | Environmental | Open in IMG/M |
| 3300005490 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_0900_B MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005494 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1600(2)_B MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005495 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1400(2)_B MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005499 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1500(2)_B MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005638 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1700(2)_B MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006380 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1200_B MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006848 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1500(2)_T MetaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300006849 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1600(2)_T MetaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300007000 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1700(2)_T MetaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300010176 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_0300_B MetaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300010179 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_0900_B MetaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300010181 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1300_B MetaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300010183 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_0700_T MetaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300010186 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_2300_T MetaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300010191 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1900_T MetaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300010193 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1300(2)_T MetaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300010246 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_2300_B MetaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300010251 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1600(2)_B MetaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300010256 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1500(2)_B MetaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300020153 | Sediment microbial communities from Great Boiling Springs, Gerlach, Nevada, United States - GBS 60_MetaG | Environmental | Open in IMG/M |
| 3300026237 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP Bryant MS upper layer 2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300026509 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS-T MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027279 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS-B MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028761 | Hot spring microbial mat communities from Yellowstone National Park, WY, United States - YNP-CB-013-3 | Environmental | Open in IMG/M |
| 3300031245 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050930_P4 | Environmental | Open in IMG/M |
| 3300031508 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050701_me2 | Environmental | Open in IMG/M |
| 3300031509 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060914_OS12-60 | Environmental | Open in IMG/M |
| 3300031512 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20051001_T8 | Environmental | Open in IMG/M |
| 3300031513 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20070728_OST1-BottomLayer | Environmental | Open in IMG/M |
| 3300031514 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20040719_149 | Environmental | Open in IMG/M |
| 3300031516 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20051001_T9 | Environmental | Open in IMG/M |
| 3300031517 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20050624_m2 | Environmental | Open in IMG/M |
| 3300031767 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060913_OS-M1 | Environmental | Open in IMG/M |
| 3300031776 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20090730_OS55 | Environmental | Open in IMG/M |
| 3300031783 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20090729_R4cd | Environmental | Open in IMG/M |
| 3300031812 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20070728_OST2-BottomLayer | Environmental | Open in IMG/M |
| 3300031865 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20060912_MSe3 | Environmental | Open in IMG/M |
| 3300031948 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20060911_MSe1 | Environmental | Open in IMG/M |
| 3300031950 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20090730_OS65 | Environmental | Open in IMG/M |
| 3300031966 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20090730_MS55 | Environmental | Open in IMG/M |
| 3300032033 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060913_OS-M2 | Environmental | Open in IMG/M |
| 3300032034 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20060911_MSe2 | Environmental | Open in IMG/M |
| 3300032045 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060914_OS12-65 | Environmental | Open in IMG/M |
| 3300032049 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20090730_OS60 | Environmental | Open in IMG/M |
| 3300032056 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20090730_MS65 | Environmental | Open in IMG/M |
| 3300032057 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20090730_MS60 | Environmental | Open in IMG/M |
| 3300032058 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20090730_MS50 | Environmental | Open in IMG/M |
| 3300032356 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20090730_OS50 | Environmental | Open in IMG/M |
| 3300033886 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20090729_t10cd | Environmental | Open in IMG/M |
| 3300034647 | Metatranscriptome of hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050701_0600_MSt7 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034649 | Metatranscriptome of hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050701_1400_MSt11 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034650 | Metatranscriptome of hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050701_1600_MSt12 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI24185J35167_10349191 | 3300002493 | Anoxygenic And Chlorotrophic Microbial Mat | VSRSFHDHDTDGSARAFGGTETVDNLPANPPPFNPQGEKGEF* |
| Ga0068641_1294982 | 3300005240 | Anoxygenic And Chlorotrophic Microbial Mat | VSRSFHDHDTDGSARAFGGTETVDNLPANPPPFNPQGEKGEFGRPDA* |
| Ga0068642_1107731 | 3300005241 | Anoxygenic And Chlorotrophic Microbial Mat | RSFHDHDTDGSARAFGGTETVDNLPANPPPFNPHGEKGECGCPDD* |
| Ga0068639_1181771 | 3300005242 | Anoxygenic And Chlorotrophic Microbial Mat | ILRVSRSFHDHDTDGSARAFGGTETVDNLPANPPPFNPHGEKGESGRPDA* |
| Ga0068643_10063681 | 3300005243 | Anoxygenic And Chlorotrophic Microbial Mat | HDTDGSARAFGGTETVDNLPANPPPFNPHGEKGEVGRPDA* |
| Ga0068643_10149181 | 3300005243 | Anoxygenic And Chlorotrophic Microbial Mat | HDTDGSARAFGGTETVDNLPANPPPFNPHGEKGECGCPDD* |
| Ga0068640_1102681 | 3300005245 | Anoxygenic And Chlorotrophic Microbial Mat | SSDFLQRTHDHDTDGSARAFGGTETVDNLPANPPPFNPHGEKGEVGRPDA* |
| Ga0068640_1335742 | 3300005245 | Anoxygenic And Chlorotrophic Microbial Mat | SFHDHDTDGSARAFGGTETVDNLPANPPPFNPQGEKGEFGRPDA* |
| Ga0068637_10151663 | 3300005247 | Anoxygenic And Chlorotrophic Microbial Mat | HDHDTDGSARAFGGTETVDNLPANPPPFNPHGEKGEVGRPDA* |
| Ga0068637_10153482 | 3300005247 | Anoxygenic And Chlorotrophic Microbial Mat | SFHDHDTDGSARAFGGTETVDNLPANPPPFNPQGEKGEPGRPDA* |
| Ga0068635_10683603 | 3300005250 | Anoxygenic And Chlorotrophic Microbial Mat | SFHDHDTDGSARAFGGTETVDNLPANPPPFNPQGEKGEFGCPDA* |
| Ga0068634_10619622 | 3300005251 | Anoxygenic And Chlorotrophic Microbial Mat | HDHDTDGSARAFGGTETVDNLPANPPPFNPLWEKGEFGHPDS* |
| Ga0068647_10272912 | 3300005411 | Anoxygenic And Chlorotrophic Microbial Mat | SRSFHDHDTDGSARAFGGTETVDNLPANPPPFNPHGEKGECGCPDD* |
| Ga0068633_10472242 | 3300005413 | Anoxygenic And Chlorotrophic Microbial Mat | FHDHDTDGSARAFGGTETVDNLPANPPPFNPQGEKGECGCPDD* |
| Ga0068706_10966472 | 3300005452 | Anoxygenic And Chlorotrophic | HDTDGSARAFGGTETVDNLPANPPPFNPHGEKGEFGRSDG* |
| Ga0068705_100905301 | 3300005453 | Anoxygenic And Chlorotrophic | LRVSRSFHDHDTDGSARAFGGTETVDNLPANPPPFNPQGEQGESGRPDA* |
| Ga0068662_1057711 | 3300005490 | Anoxygenic And Chlorotrophic Microbial Mat | HDHDTDGSARAFGGTETVDNLPANPPPFNPQGEKGECGCPDD* |
| Ga0068668_10091871 | 3300005494 | Anoxygenic And Chlorotrophic Microbial Mat | HDTDGSARAFGGTETVDNLPANPPPFNPHGEKGAFGRPDA* |
| Ga0068668_10217581 | 3300005494 | Anoxygenic And Chlorotrophic Microbial Mat | ILRVSRSFHDHDTDGSARAFGGTETVDNLPANPPPFNPQGEQGESGRPDA* |
| Ga0068666_10124672 | 3300005495 | Anoxygenic And Chlorotrophic Microbial Mat | DHDTDGSARAFGGTETVDNLPANPPPFNPQGEKGEFGRSDA* |
| Ga0068666_10251143 | 3300005495 | Anoxygenic And Chlorotrophic Microbial Mat | SRSFHDHDTDGSARAFGGTETVDNLPANPPPFNPQGEKGECGCPDD* |
| Ga0068666_10268073 | 3300005495 | Anoxygenic And Chlorotrophic Microbial Mat | RSFHDHDTDGSARAFGGTETVDNLPANPPPFNPQGEKGEPGRPDA* |
| Ga0068667_10277042 | 3300005499 | Anoxygenic And Chlorotrophic Microbial Mat | SRSFHDHDTDGSARAFGGTETVDNLPANPPPFNPHGEKGEVGRPDA* |
| Ga0068667_10429141 | 3300005499 | Anoxygenic And Chlorotrophic Microbial Mat | ILRVSRSFHDHDTDGSARAFGGTETVDNLPANPPPFNPQGEKGGVRRPDG* |
| Ga0068669_10739211 | 3300005638 | Anoxygenic And Chlorotrophic Microbial Mat | FHDHDTDGSARAFGGTETVDNLPANPPPFNPQGEKGEFGRPDA* |
| Ga0068664_11195591 | 3300006380 | Anoxygenic And Chlorotrophic Microbial Mat | HDTDGSARAFGGTETVDNLPANPPPFNPQGEKGEFGRSDA* |
| Ga0101768_10236642 | 3300006848 | Anoxygenic And Chlorotrophic Microbial Mat | SARAFGGTETVDNLPANPPPFNPQGEKGDFGRPDA* |
| Ga0101768_10573701 | 3300006848 | Anoxygenic And Chlorotrophic Microbial Mat | SRSFHDHDTDGSARAFGGTETVDNLPANPPPFNPHGEKGESGRPDA* |
| Ga0102029_12238463 | 3300006849 | Anoxygenic And Chlorotrophic Microbial Mat | RVSRSFHDHDTDGSARAFGGTETVDNLPANPPPFNPQGEQGESGRPDA* |
| Ga0102029_12292931 | 3300006849 | Anoxygenic And Chlorotrophic Microbial Mat | RQLAIKDHDTDGSARAFGGTETVDNLPANPPPFNPHGEKGAFGRPDA* |
| Ga0102499_11474041 | 3300007000 | Anoxygenic And Chlorotrophic Microbial Mat | DHDTDGSARAFGGTETVDNLPANPPPFNPQGEKGEFGCPDA* |
| Ga0124933_1557201 | 3300010176 | Anoxygenic And Chlorotrophic Microbial Mat | FHDHDTDGSARAFGGTETVDNLPANPPPFNPHGEKGECGCPDD* |
| Ga0124936_10966541 | 3300010179 | Anoxygenic And Chlorotrophic Microbial Mat | ARAFGGTETVDNLPANPPPFNPHGEKGEFGCPDA* |
| Ga0124926_10781313 | 3300010181 | Anoxygenic And Chlorotrophic Microbial Mat | DHDTDGSARAFGGTETVDNLPANPPPFNPQGEKGEFGRPDGWNER* |
| Ga0124919_11436181 | 3300010183 | Anoxygenic And Chlorotrophic Microbial Mat | SARAFGGTETVDNLPANPPPFNPLWEKGEFGHPDS* |
| Ga0124916_10156691 | 3300010186 | Anoxygenic And Chlorotrophic Microbial Mat | FHDHDTDGSARAFGGTETVDNLPANPPPFNPQGEKGEFGRPDGWNER* |
| Ga0124914_11970491 | 3300010191 | Anoxygenic And Chlorotrophic Microbial Mat | SARAFGGTETVDNLPANPPPFNPQGEKGEFGRPDA* |
| Ga0124924_11142082 | 3300010193 | Anoxygenic And Chlorotrophic Microbial Mat | SRSFHDHDTDGSARAFGGTETVDNLPANPPPFNPLWEKGEFGRPDG* |
| Ga0124932_1059121 | 3300010246 | Anoxygenic And Chlorotrophic Microbial Mat | ILRVSRSFHDHDTDGSARAFGGTETVDNLPANPPPFNPQGEKGECGCPDD* |
| Ga0124940_10619871 | 3300010251 | Anoxygenic And Chlorotrophic Microbial Mat | RSFHDHDTDGSARAFGGTETVDNLPANPPPFNPQGEKGEFGCPDA* |
| Ga0124939_11872972 | 3300010256 | Anoxygenic And Chlorotrophic Microbial Mat | ARAFGGTETVDNLPANPPPFNPVWEKGEFGRPDG* |
| Ga0197142_10379601 | 3300020153 | Sediment | HDHDTDGSARAFGGTETVDNLPASPPPFNPQGEKGELGRPDV |
| Ga0209750_10385361 | 3300026237 | Anoxygenic And Chlorotrophic Microbial Mat | ILRVSRSFHDHDTDGSARAFGGTETVDNLPANPPPFNPHGEKGESGRPDA |
| Ga0209750_10709742 | 3300026237 | Anoxygenic And Chlorotrophic Microbial Mat | AGHTILRVSRSFHDHDTDGSARAFGGTETVDNLPANPPPFNPQGEKGEFGRPDA |
| Ga0209750_10716311 | 3300026237 | Anoxygenic And Chlorotrophic Microbial Mat | AGHTILRVSRSFHDHDTDGSARAFGGTETVDNLPANPPPFNPHGEKGAFGRPDA |
| Ga0209809_10316182 | 3300026509 | Anoxygenic And Chlorotrophic | RAGHTILRVSRSFHDHDTDGSARAFGGTETVDNLPANPPPFNPLWEKGEFGHPDS |
| Ga0209691_10109073 | 3300027279 | Anoxygenic And Chlorotrophic | AGHTILRVSRSFHDHDTDGSARAFGGTETVDNLPANPPPFNPLWEKGEFGHPDS |
| Ga0209691_10672772 | 3300027279 | Anoxygenic And Chlorotrophic | TILRVSRSFHDHDTDGSARAFGGTETVDNLPANPPPFNPQGEQGESGRPDA |
| Ga0272447_10637811 | 3300028761 | Microbial Mat | AGHTILRVSRSFHDHDTDGSARAFGGTETVDNLPANPPPFNPQGEKGEFGRADG |
| Ga0308395_10103483 | 3300031245 | Hot Spring Phototrophic Mat | GHTILRVSRSFHDHDTDGSARAFGGTETVDNLPANPPPFNHTGEKGESGRSDG |
| Ga0308395_10563261 | 3300031245 | Hot Spring Phototrophic Mat | DGSARAFGGTETVDNLPANPPPFNPQGEKGEFGCPDA |
| Ga0308395_10876931 | 3300031245 | Hot Spring Phototrophic Mat | FHDHDTDGSARAFGGTETVDNLPANPPPFNPQGEKGEFGRPDD |
| Ga0308395_11004532 | 3300031245 | Hot Spring Phototrophic Mat | RSFHDHDTDGSARAFGGTETVDNLPANPPPFNPQGEKGAFGRADG |
| Ga0308394_10799832 | 3300031508 | Hot Spring Phototrophic Mat | AGHTILRVSRSFHDHDTDGSARAFGGTETVDNLPANPPPFKEKGEVGRPDG |
| Ga0308394_10839401 | 3300031508 | Hot Spring Phototrophic Mat | DGSARAFGGTETVDNLPANPPPFNPQGEKGEFGRSDA |
| Ga0308394_10886231 | 3300031508 | Hot Spring Phototrophic Mat | DTDGSARAFGGTETVDNLPANPPPFNPHGEKGEFERPDA |
| Ga0308394_10899472 | 3300031508 | Hot Spring Phototrophic Mat | LRVSRSFHDHDTDGSARAFGGTETVDNLPANPPPFNPHGEKGAFGRPDA |
| Ga0308399_10235551 | 3300031509 | Hot Spring Phototrophic Mat | SRSFHDHDTDGSARAFGGTETVDNLPANPPPFNPQGEKGESGRPDA |
| Ga0308399_10812361 | 3300031509 | Hot Spring Phototrophic Mat | SRSFHDHDTDGSARAFGGTETVDNLPANPPPFNPLWEKGEFERPDA |
| Ga0308397_10318841 | 3300031512 | Hot Spring Phototrophic Mat | SRSFHDHDTDGSARAFGGTETVDNLPANPPPFNPLWEKGEFGHPDS |
| Ga0308397_10653182 | 3300031512 | Hot Spring Phototrophic Mat | FHDHDTDGSARAFGGTETVDNLPANPPPFNPQGEKGEFGCPES |
| Ga0308397_10931762 | 3300031512 | Hot Spring Phototrophic Mat | AGHTILRVSRSFHDHDTDGSARAFGGTETVDNLPANPPPFNLHGEKGVSGRPDAWKGR |
| Ga0308397_11005981 | 3300031512 | Hot Spring Phototrophic Mat | RVSRSFHDHDTDGSARAFGGTETVDNLPANPPPFNPQGEKGDLGRSDA |
| Ga0308397_11262081 | 3300031512 | Hot Spring Phototrophic Mat | FHDHDTDGSARAFGGTETVDNLPANPPPFNPHGEKGEVGRPDG |
| Ga0308412_11117282 | 3300031513 | Hot Spring Phototrophic Mat | FHDHDTDGSARAFGGTETVDNLPANPPPFNPHGEKGEVGRPDA |
| Ga0308412_11210151 | 3300031513 | Hot Spring Phototrophic Mat | HDTDGSARAFGGTETVDNLPANPPPFNPLWEKGEFGRPDG |
| Ga0308412_11341371 | 3300031513 | Hot Spring Phototrophic Mat | AGHTILRVSRSFHDHDTDGSARAFGGTETVDNLPANPPPFNSHGEKGEFGRPDT |
| Ga0308412_11767891 | 3300031513 | Hot Spring Phototrophic Mat | RSFHDHDTDGSARAFGGTETVDNLPANPPPFNPQGEKGECGCPDD |
| Ga0308412_12054972 | 3300031513 | Hot Spring Phototrophic Mat | HDTDGSARAFGGTETVDNLPANPPPFNPHGEKGEFGRPDA |
| Ga0308390_10162993 | 3300031514 | Hot Spring Phototrophic Mat | AGHTILRVSRSFHDHDTDGSARAFGGTETVDNLPANPPPFNHTGEKGESGRSDG |
| Ga0308398_10572092 | 3300031516 | Hot Spring Phototrophic Mat | RVSRSFHDHDTDGSARAFGGTETVDNLPANPPPFNPQGEKGEPGRPDA |
| Ga0308392_10017301 | 3300031517 | Hot Spring Phototrophic Mat | VSRSFHDHDTDGSARAFGGTETVDNLPANPPPFNPQGEKGEFGRSDT |
| Ga0308401_10740692 | 3300031767 | Hot Spring Phototrophic Mat | DHDTDGSARAFGGTETVDNLPANPPPFNPHGEKGEVGRPDG |
| Ga0308415_10151732 | 3300031776 | Hot Spring Phototrophic Mat | SFHDHDTDGSARAFGGTETVDNLPANPPPFNPHGEKGEFGRPHT |
| Ga0308415_10821041 | 3300031776 | Hot Spring Phototrophic Mat | SRSFHDHDTDGSARAFGGTETVDNLPANPPPFNPLWEKGEFGRPDG |
| Ga0308415_10956721 | 3300031776 | Hot Spring Phototrophic Mat | GHTILRVSRSFHDHDTDGSARAFGGTETVDNLPANPPPFNPHGEKGEFGRPDA |
| Ga0308418_10455131 | 3300031783 | Hot Spring Phototrophic Mat | SRSFHDHDTDGSARAFGGTETVDNLPANPPPFNPHGEKGECGRPDA |
| Ga0308411_100193531 | 3300031812 | Hot Spring Phototrophic Mat | DHDTDGSARAFGGTETVDNLPANPPPFNPHGEKGEFGRPDGWNER |
| Ga0308408_10681651 | 3300031865 | Hot Spring Phototrophic Mat | FHDHDTDGSARAFGGTETVDNLPANPPPFNPQGEKGESGRPDA |
| Ga0308406_10312161 | 3300031948 | Hot Spring Phototrophic Mat | DGSARAFGGTETVDNLPANPPPFNPQGEKGEFGRPDG |
| Ga0308406_10835781 | 3300031948 | Hot Spring Phototrophic Mat | TDGSARAFGGTETVDNLPANPPPFNLHGEKGVSGRPDAWKGR |
| Ga0308417_11124591 | 3300031950 | Hot Spring Phototrophic Mat | RVSRSFHDHDTDGSARAFGGTETVDNLPANPPPFNPLWEKGESGRPDG |
| Ga0308417_11976971 | 3300031950 | Hot Spring Phototrophic Mat | SARAFGGTETVDNLPANPPPFNPHGEKGEFERPDA |
| Ga0308420_10719021 | 3300031966 | Hot Spring Phototrophic Mat | RVSRSFHDHDTDGSARAFGGTETVDNLPANPPPFNPHGEKGAFGRPDA |
| Ga0308420_12283811 | 3300031966 | Hot Spring Phototrophic Mat | HDTDGSARAFGGTETVDNLPANPPPFNPHGEKGEVGRPDG |
| Ga0308402_10422601 | 3300032033 | Hot Spring Phototrophic Mat | GSARAFGGTETVDNLPANPPPFNPQGEKGELGRPDA |
| Ga0308407_10553772 | 3300032034 | Hot Spring Phototrophic Mat | RVSRSFHDHDTDGSARAFGGTETVDNLPANPPPFNPHGEKGESGRPDA |
| Ga0308407_11124881 | 3300032034 | Hot Spring Phototrophic Mat | RVSRSFHDHDTDGSARAFGGTETVDNLPANPPPFNPHGEKGEVGRPDG |
| Ga0308400_10985591 | 3300032045 | Hot Spring Phototrophic Mat | RVSRSFHDHDTDGSARAFGGTETVDNLPANPPPFNPQGEKGECGCPDD |
| Ga0308416_10303711 | 3300032049 | Hot Spring Phototrophic Mat | RSFHDHDTDGSARAFGGTETVDNLPANPPPFNPQGEKGEFGRSDT |
| Ga0308310_10926992 | 3300032056 | Hot Spring Phototrophic Mat | HDTDGSARAFGGTETVDNLPANPPPFNPQGEKGESGRPDA |
| Ga0308421_11171022 | 3300032057 | Hot Spring Phototrophic Mat | RSFHDHDTDGSARAFGGTETVDNLPANPPPFNPHGEKGAFGRPDA |
| Ga0308419_10976972 | 3300032058 | Hot Spring Phototrophic Mat | HDTDGSARAFGGTETVDNLPANPPPFNPHGERGEFGRPDD |
| Ga0308419_11010851 | 3300032058 | Hot Spring Phototrophic Mat | DTDGSARAFGGTETVDNLPANPPPFNPHGEKGVFGRPDA |
| Ga0308414_11989801 | 3300032356 | Hot Spring Phototrophic Mat | RVSRSFHDHDTDGSARAFGGTETVDNLPANPPPFNPHGEKGVSGRPDA |
| Ga0308413_025638_1_132 | 3300033886 | Hot Spring Phototrophic Mat | FHDHDTDGSARAFGGTETVDNLPANPPPFNPQGEKGEFGHPDG |
| Ga0372968_008638_3_134 | 3300034647 | Hot Spring Phototrophic Mat | FHDHDTDGSARAFGGTETVDNLPANPPPFNPQGEKGEFGRADG |
| Ga0372972_009594_1_117 | 3300034649 | Hot Spring Phototrophic Mat | TDGSARAFGGTETVDNLPANPPPFNPQGEKGEFGRPDG |
| Ga0372972_013749_1255_1389 | 3300034649 | Hot Spring Phototrophic Mat | SFHDHDTDGSARAFGGTETVDNLPANPPPFNPQGEKGEFGCPDA |
| Ga0372972_020181_1_138 | 3300034649 | Hot Spring Phototrophic Mat | RSFHDHDTDGSARAFGGTETVDNLPANPPPFNPQGEKGEFGRSDG |
| Ga0372973_009574_3_125 | 3300034650 | Hot Spring Phototrophic Mat | HDTDGSARAFGGTETVDNLPANPPPFNPHGEKGAFGRPDA |
| ⦗Top⦘ |