


| Basic Information | |
|---|---|
| Family ID | F103257 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 101 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MKAIQNIHQLNLTAQRAISIWSDSLCGDVVLGFTYNNEPKQGGTEV |
| Number of Associated Samples | 72 |
| Number of Associated Scaffolds | 101 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 24.75 % |
| % of genes from short scaffolds (< 2000 bps) | 52.48 % |
| Associated GOLD sequencing projects | 61 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (46.535 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (16.832 % of family members) |
| Environment Ontology (ENVO) | Unclassified (49.505 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (60.396 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.30% β-sheet: 0.00% Coil/Unstructured: 52.70% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 101 Family Scaffolds |
|---|---|---|
| PF14279 | HNH_5 | 5.94 |
| PF06508 | QueC | 4.95 |
| PF14902 | DUF4494 | 4.95 |
| PF00963 | Cohesin | 3.96 |
| PF06210 | DUF1003 | 2.97 |
| PF01844 | HNH | 1.98 |
| PF01223 | Endonuclease_NS | 0.99 |
| PF12850 | Metallophos_2 | 0.99 |
| PF01541 | GIY-YIG | 0.99 |
| PF07460 | NUMOD3 | 0.99 |
| PF00188 | CAP | 0.99 |
| PF04434 | SWIM | 0.99 |
| PF04984 | Phage_sheath_1 | 0.99 |
| PF03237 | Terminase_6N | 0.99 |
| PF01832 | Glucosaminidase | 0.99 |
| PF00085 | Thioredoxin | 0.99 |
| PF02779 | Transket_pyr | 0.99 |
| PF05105 | Phage_holin_4_1 | 0.99 |
| COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
|---|---|---|---|
| COG0037 | tRNA(Ile)-lysidine synthase TilS/MesJ | Translation, ribosomal structure and biogenesis [J] | 4.95 |
| COG0137 | Argininosuccinate synthase | Amino acid transport and metabolism [E] | 4.95 |
| COG0171 | NH3-dependent NAD+ synthetase | Coenzyme transport and metabolism [H] | 4.95 |
| COG0301 | Adenylyl- and sulfurtransferase ThiI (thiamine and tRNA 4-thiouridine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 4.95 |
| COG0482 | tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domain | Translation, ribosomal structure and biogenesis [J] | 4.95 |
| COG0519 | GMP synthase, PP-ATPase domain/subunit | Nucleotide transport and metabolism [F] | 4.95 |
| COG0603 | 7-cyano-7-deazaguanine synthase (queuosine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 4.95 |
| COG0780 | NADPH-dependent 7-cyano-7-deazaguanine reductase QueF, C-terminal domain, T-fold superfamily | Translation, ribosomal structure and biogenesis [J] | 4.95 |
| COG1606 | ATP-utilizing enzyme, PP-loop superfamily | General function prediction only [R] | 4.95 |
| COG4420 | Uncharacterized membrane protein | Function unknown [S] | 2.97 |
| COG1864 | DNA/RNA endonuclease G, NUC1 | Nucleotide transport and metabolism [F] | 0.99 |
| COG2340 | Spore germination protein YkwD and related proteins with CAP (CSP/antigen 5/PR1) domain | Cell cycle control, cell division, chromosome partitioning [D] | 0.99 |
| COG3497 | Phage tail sheath protein FI | Mobilome: prophages, transposons [X] | 0.99 |
| COG4279 | Uncharacterized protein, contains SWIM-type Zn finger domain | Function unknown [S] | 0.99 |
| COG4715 | Uncharacterized protein, contains SWIM-type Zn finger domain | Function unknown [S] | 0.99 |
| COG4824 | Phage-related holin (Lysis protein) | Mobilome: prophages, transposons [X] | 0.99 |
| COG5431 | Predicted nucleic acid-binding protein, contains SWIM-type Zn-finger domain | General function prediction only [R] | 0.99 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 53.47 % |
| Unclassified | root | N/A | 46.53 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000558|Draft_10208846 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3065 | Open in IMG/M |
| 3300000929|NpDRAFT_10001224 | Not Available | 13019 | Open in IMG/M |
| 3300002131|M2t2BS1_1296185 | Not Available | 11588 | Open in IMG/M |
| 3300002144|M2t2BS2_10743716 | Not Available | 729 | Open in IMG/M |
| 3300002144|M2t2BS2_10852219 | Not Available | 855 | Open in IMG/M |
| 3300002195|metazooDRAFT_1218507 | Not Available | 622 | Open in IMG/M |
| 3300002202|metazooDRAFT_1274510 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1154 | Open in IMG/M |
| 3300002408|B570J29032_109090428 | Not Available | 591 | Open in IMG/M |
| 3300002408|B570J29032_109091720 | Not Available | 591 | Open in IMG/M |
| 3300002835|B570J40625_100509687 | Not Available | 1127 | Open in IMG/M |
| 3300004128|Ga0066180_10441331 | Not Available | 518 | Open in IMG/M |
| 3300004461|Ga0066223_1334945 | Not Available | 956 | Open in IMG/M |
| 3300004481|Ga0069718_10053549 | Not Available | 992 | Open in IMG/M |
| 3300004481|Ga0069718_10088577 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1086 | Open in IMG/M |
| 3300004481|Ga0069718_16079930 | Not Available | 700 | Open in IMG/M |
| 3300005662|Ga0078894_10106124 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2485 | Open in IMG/M |
| 3300006484|Ga0070744_10004548 | Not Available | 4157 | Open in IMG/M |
| 3300006484|Ga0070744_10082624 | Not Available | 931 | Open in IMG/M |
| 3300006484|Ga0070744_10084070 | Not Available | 922 | Open in IMG/M |
| 3300006484|Ga0070744_10090675 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Daredevilvirus → Daredevilvirus daredevil | 885 | Open in IMG/M |
| 3300007276|Ga0070747_1024263 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2443 | Open in IMG/M |
| 3300007538|Ga0099851_1018916 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2788 | Open in IMG/M |
| 3300007542|Ga0099846_1187144 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 735 | Open in IMG/M |
| 3300007555|Ga0102817_1083962 | Not Available | 697 | Open in IMG/M |
| 3300007559|Ga0102828_1193495 | Not Available | 520 | Open in IMG/M |
| 3300007734|Ga0104986_1670 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 21952 | Open in IMG/M |
| 3300008113|Ga0114346_1288092 | Not Available | 576 | Open in IMG/M |
| 3300008116|Ga0114350_1006295 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7711 | Open in IMG/M |
| 3300008267|Ga0114364_1012328 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3842 | Open in IMG/M |
| 3300008267|Ga0114364_1016497 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3182 | Open in IMG/M |
| 3300008267|Ga0114364_1155587 | Not Available | 622 | Open in IMG/M |
| 3300008267|Ga0114364_1169903 | Not Available | 571 | Open in IMG/M |
| 3300008448|Ga0114876_1022354 | Not Available | 3250 | Open in IMG/M |
| 3300008448|Ga0114876_1036019 | Not Available | 2367 | Open in IMG/M |
| 3300008450|Ga0114880_1004697 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7295 | Open in IMG/M |
| 3300008450|Ga0114880_1208328 | Not Available | 648 | Open in IMG/M |
| 3300009026|Ga0102829_1103934 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 888 | Open in IMG/M |
| 3300009082|Ga0105099_10961170 | Not Available | 542 | Open in IMG/M |
| 3300009151|Ga0114962_10022625 | All Organisms → cellular organisms → Bacteria | 4415 | Open in IMG/M |
| 3300009154|Ga0114963_10022008 | All Organisms → cellular organisms → Bacteria | 4242 | Open in IMG/M |
| 3300009154|Ga0114963_10061452 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2370 | Open in IMG/M |
| 3300009155|Ga0114968_10157444 | Not Available | 1343 | Open in IMG/M |
| 3300009159|Ga0114978_10001408 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 20225 | Open in IMG/M |
| 3300009432|Ga0115005_10033411 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3966 | Open in IMG/M |
| 3300010157|Ga0114964_10028033 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3130 | Open in IMG/M |
| 3300010160|Ga0114967_10002945 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 14109 | Open in IMG/M |
| 3300010885|Ga0133913_10843998 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2383 | Open in IMG/M |
| 3300011115|Ga0151514_10002 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 161982 | Open in IMG/M |
| 3300012346|Ga0157141_1000005 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 156904 | Open in IMG/M |
| 3300012352|Ga0157138_1019526 | Not Available | 1091 | Open in IMG/M |
| 3300013004|Ga0164293_10109401 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2108 | Open in IMG/M |
| 3300013286|Ga0136641_1010535 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Eubacteriaceae → Eubacterium → Eubacterium callanderi | 3070 | Open in IMG/M |
| 3300014810|Ga0119896_1005190 | Not Available | 2341 | Open in IMG/M |
| 3300017761|Ga0181356_1004246 | Not Available | 5853 | Open in IMG/M |
| 3300017761|Ga0181356_1135942 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 772 | Open in IMG/M |
| 3300017761|Ga0181356_1228196 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 539 | Open in IMG/M |
| 3300017766|Ga0181343_1068207 | Not Available | 1029 | Open in IMG/M |
| 3300017774|Ga0181358_1051763 | Not Available | 1552 | Open in IMG/M |
| 3300017774|Ga0181358_1079034 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1204 | Open in IMG/M |
| 3300017778|Ga0181349_1054811 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1557 | Open in IMG/M |
| 3300017778|Ga0181349_1297629 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 524 | Open in IMG/M |
| 3300017785|Ga0181355_1023202 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Lactobacillaceae → Loigolactobacillus → Loigolactobacillus coryniformis | 2703 | Open in IMG/M |
| 3300017785|Ga0181355_1373118 | Not Available | 520 | Open in IMG/M |
| 3300019784|Ga0181359_1043948 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1730 | Open in IMG/M |
| 3300019784|Ga0181359_1084412 | Not Available | 1185 | Open in IMG/M |
| 3300020048|Ga0207193_1087498 | All Organisms → Viruses → Predicted Viral | 2923 | Open in IMG/M |
| 3300020160|Ga0211733_10641106 | Not Available | 110175 | Open in IMG/M |
| 3300020205|Ga0211731_10182418 | Not Available | 14263 | Open in IMG/M |
| 3300021961|Ga0222714_10024686 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4597 | Open in IMG/M |
| 3300021961|Ga0222714_10221582 | Not Available | 1078 | Open in IMG/M |
| 3300021961|Ga0222714_10501643 | Not Available | 623 | Open in IMG/M |
| 3300021961|Ga0222714_10665409 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 512 | Open in IMG/M |
| 3300021963|Ga0222712_10002604 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 20441 | Open in IMG/M |
| 3300021963|Ga0222712_10335804 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 936 | Open in IMG/M |
| 3300021963|Ga0222712_10421191 | Not Available | 807 | Open in IMG/M |
| 3300022190|Ga0181354_1000463 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7154 | Open in IMG/M |
| 3300022407|Ga0181351_1031957 | Not Available | 2238 | Open in IMG/M |
| 3300022407|Ga0181351_1168285 | Not Available | 769 | Open in IMG/M |
| 3300023174|Ga0214921_10582043 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 506 | Open in IMG/M |
| 3300024346|Ga0244775_10000725 | Not Available | 39978 | Open in IMG/M |
| 3300024346|Ga0244775_10131662 | Not Available | 2116 | Open in IMG/M |
| 3300024549|Ga0256308_1000023 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 18595 | Open in IMG/M |
| 3300025647|Ga0208160_1006771 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4103 | Open in IMG/M |
| 3300025652|Ga0208134_1176932 | Not Available | 515 | Open in IMG/M |
| 3300027631|Ga0208133_1022513 | Not Available | 1619 | Open in IMG/M |
| 3300027741|Ga0209085_1054820 | All Organisms → cellular organisms → Bacteria | 1836 | Open in IMG/M |
| 3300027741|Ga0209085_1088455 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1379 | Open in IMG/M |
| 3300027749|Ga0209084_1038507 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2391 | Open in IMG/M |
| 3300027749|Ga0209084_1273037 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 648 | Open in IMG/M |
| 3300027782|Ga0209500_10020337 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 3878 | Open in IMG/M |
| 3300027792|Ga0209287_10373784 | All Organisms → Viruses | 548 | Open in IMG/M |
| 3300027849|Ga0209712_10021016 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4401 | Open in IMG/M |
| 3300027963|Ga0209400_1006649 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7769 | Open in IMG/M |
| 3300028392|Ga0304729_1009480 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4655 | Open in IMG/M |
| 3300028392|Ga0304729_1217075 | Not Available | 586 | Open in IMG/M |
| 3300028394|Ga0304730_1003354 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 10848 | Open in IMG/M |
| 3300031787|Ga0315900_10373930 | Not Available | 1138 | Open in IMG/M |
| 3300034064|Ga0335001_0008556 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6085 | Open in IMG/M |
| 3300034066|Ga0335019_0062908 | All Organisms → Viruses → Predicted Viral | 2524 | Open in IMG/M |
| 3300034104|Ga0335031_0327604 | Not Available | 987 | Open in IMG/M |
| 3300034106|Ga0335036_0858686 | Not Available | 519 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 16.83% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 16.83% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 6.93% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 6.93% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.94% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 5.94% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.95% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 4.95% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.96% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 2.97% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.97% |
| Marine | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine | 2.97% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.98% |
| Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 1.98% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.98% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.98% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 1.98% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.99% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.99% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.99% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.99% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.99% |
| Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 0.99% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 0.99% |
| Wastewater | Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Wastewater | 0.99% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000558 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011 | Engineered | Open in IMG/M |
| 3300000929 | Marine plume microbial communities from the Columbia River - 15 PSU | Environmental | Open in IMG/M |
| 3300002131 | Marine microbial communities from the Baltic Sea, analyzing arctic terrigenous carbon compounds - M2t2BS1 (111f) | Environmental | Open in IMG/M |
| 3300002144 | Marine microbial communities from the Baltic Sea, analyzing arctic terrigenous carbon compounds - M2t2BS2 (113f) | Environmental | Open in IMG/M |
| 3300002195 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - AUG 2013 | Environmental | Open in IMG/M |
| 3300002202 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - SEP 2012 | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300004128 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (version 2) | Environmental | Open in IMG/M |
| 3300004461 | Marine viral communities from Newfoundland, Canada BC-2 | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007555 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300007734 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Jan | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
| 3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009432 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome | Environmental | Open in IMG/M |
| 3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011115 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2016May | Environmental | Open in IMG/M |
| 3300012346 | Freshwater microbial communities from Emily Creek, Ontario, Canada - S29 | Environmental | Open in IMG/M |
| 3300012352 | Freshwater microbial communities from Baxter Creek, Ontario, Canada - S37 | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013286 | Freshwater microbial communities from Elizabeth Lake, Yosemite National Park, California, USA - 13020-23Y | Environmental | Open in IMG/M |
| 3300014810 | Wastewater microbial communities from municipal sewage treatment plant in Nanjing, China - WX_IW_meta | Engineered | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024549 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025652 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes) | Environmental | Open in IMG/M |
| 3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
| 3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027792 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027849 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028392 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300034064 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME14Nov2013-rr0054 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Draft_102088469 | 3300000558 | Hydrocarbon Resource Environments | MKAIQNIHQQFNTASRALKTWSDSLCGDVILGFSYNNQEPKQGGTEV* |
| NpDRAFT_1000122416 | 3300000929 | Freshwater And Marine | MTTIQNIHQFSSTTLRPTSQMWSDSLCGDVILGFAAYNNEPIKGGTEV* |
| M2t2BS1_129618521 | 3300002131 | Marine | MTTIQNIHQQLTQAFRAISIWSDSLCGDVIMGFSYNNEPKTNQIWE* |
| M2t2BS2_107437163 | 3300002144 | Marine | NIHQQLTQAFRAISIWSDSLCGDVIMGFSYNNEPKTNQIWE* |
| M2t2BS2_108522191 | 3300002144 | Marine | MKTIKNIHQQLTQAFRAISIWSDSLCGDVIMGFSYNNEPKTNQIWE* |
| metazooDRAFT_12185071 | 3300002195 | Lake | IQNIHQDIIAMRPAISIWSDSLCGDIVLGFTYNNEPKQGHSWEG* |
| metazooDRAFT_12745103 | 3300002202 | Lake | MKAIQNIHKLTSTQQRAINIWSDSLCGDVVLGFTYNNEPKQDTDLG* |
| B570J29032_1090904281 | 3300002408 | Freshwater | MITKFKMTQIQHIQQNITMASRALNTWSDSLCGDVILGFIAYNNEPKHGGTEV* |
| B570J29032_1090917202 | 3300002408 | Freshwater | MTQIQNIHQQLSTATRALNTWSDSLCGDVILGFIAYNNEPKQGGTEV* |
| B570J40625_1005096871 | 3300002835 | Freshwater | MTTIQNIHQFSSATLRPTQIWSDSLCGDVILGFAAYNNQEPKQGGTEV* |
| Ga0066180_104413311 | 3300004128 | Freshwater Lake | MKAQQNIHQQLSAASRAINTWSDSLCGDVIVGFTYNNEPKQTRTGI* |
| Ga0066223_13349452 | 3300004461 | Marine | MKAQQNIHQLNLTAQRAISIWSDSLCGDIVFGFTYSNEPKQGGTEV* |
| Ga0069718_100535491 | 3300004481 | Sediment | MKALQNIHQLNSTQQRAISIWSDSLCGDVLVGFTYNNEPKQDTDLG* |
| Ga0069718_100885771 | 3300004481 | Sediment | MKAVQNIQQLNNTAQRAISIWSDSLCGDVLVGFTYNNEPK |
| Ga0069718_160799302 | 3300004481 | Sediment | MKAQQNIHQLNLTAQRAISIWSDSLCGDVVLGFTYNNEPKQGGTEV* |
| Ga0078894_1010612413 | 3300005662 | Freshwater Lake | MKAIQNIHQLNLTAQRAISIWSDSLCGDVVLGFTYNNEPKQGGTEV* |
| Ga0070744_100045486 | 3300006484 | Estuarine | MQALQNIHQQLSTASRAISQWSDSLCGDVIVGFTYNNEPKTTKTGI* |
| Ga0070744_100826241 | 3300006484 | Estuarine | MTTIQNIHQFSSTALRPTSQMWSDSLCGDVILGFAAYNNEPKKGGTEV* |
| Ga0070744_100840705 | 3300006484 | Estuarine | MTTIQNIHQFSNTTLRPTSQMWSDSLCGDVILGFAAYNNEPIKGGTEV* |
| Ga0070744_100906751 | 3300006484 | Estuarine | MIQAQNIHQQLSTATRARNTWSDSLCGDVILGFSAYNNEPKQGKTGV* |
| Ga0070747_10242636 | 3300007276 | Aqueous | MKTIQNIHQQLTQAFKAISKWSDLLCSDVILGFMYNNEPKQGHSWSGYNIS* |
| Ga0099851_10189167 | 3300007538 | Aqueous | MTTIQNIHQFSSATLRPTSQMWSDSLCGDVILGFIAYNNEPKQGGTEV* |
| Ga0099846_11871442 | 3300007542 | Aqueous | MKAIQNIHQQLSTASRANNIWSDSLCGDVIVGFTYNNEPKQGGTEV* |
| Ga0102817_10839623 | 3300007555 | Estuarine | MTQIQNINQQLSTATRALNTWSDSLCGDVILGFSAYNNEPKQGKTGV* |
| Ga0102828_11934952 | 3300007559 | Estuarine | MKAQQNIHQLNLTAQRAISIWSDSLCGDVIVGFTYNNEPKKGKTGV* |
| Ga0104986_167027 | 3300007734 | Freshwater | MKAIQNIHQLNNLAQRAISIWSDSLCGDVVFGFTYNNEPKQGGTEV* |
| Ga0114346_12880921 | 3300008113 | Freshwater, Plankton | MTTIQNIHQFSSATLRPTQIWSDSLCGDVILGFAAY |
| Ga0114350_10062952 | 3300008116 | Freshwater, Plankton | MKAQQNVHQLNLTAQRAISIWSDSLCGDVIVGFTYNNEPKKTKTGI* |
| Ga0114364_101232812 | 3300008267 | Freshwater, Plankton | MKAQQNIHQLNRTAQRAISQWSDSLCGDVIFGFTYNNEPKTTKTGI* |
| Ga0114364_10164977 | 3300008267 | Freshwater, Plankton | MKALQNIHQFNNVAQRAISIWSDSLCGDVLVGFTYNNEPKQDTDLG* |
| Ga0114364_11555871 | 3300008267 | Freshwater, Plankton | MKAIQNIHQLNLTAQRAISIWSDSLCGDVIVGFTYNN |
| Ga0114364_11699033 | 3300008267 | Freshwater, Plankton | MKAQQNIHQLNLTAQRAISIWSDSLCGDVIVGFTYNNEPKKGKTGI* |
| Ga0114876_10223549 | 3300008448 | Freshwater Lake | MTTIQNIHQFSSATLRPTQIWSDSLCGDVILGFAAYNNQEPKQG |
| Ga0114876_10360194 | 3300008448 | Freshwater Lake | MIQVQNIHQLNSTAQRAISIWSDSLCGDVLVGFTYNNEPKKTRTGI* |
| Ga0114880_10046977 | 3300008450 | Freshwater Lake | MTTIQNIHQFNSTALRPTQIWSDSLCNDVIVGFTYNNEPKTTKTGI* |
| Ga0114880_12083284 | 3300008450 | Freshwater Lake | FIVTNNKMIQVQNIHQLNSTAQRAISIWSDSLCGDVLVGFTYNNEPKQDTDLG* |
| Ga0102829_11039341 | 3300009026 | Estuarine | QALQNIHQQLSTASRAISQWSDSLCGDVIVGFTYNNEPKTTKTGI* |
| Ga0105099_109611701 | 3300009082 | Freshwater Sediment | AIKMKAIQNIHQQLSTATRALNTWSDSLCGDVILGFAGYNNEPKQGGTEV* |
| Ga0114962_100226256 | 3300009151 | Freshwater Lake | MKAQQNIHQLNNTAQRAISTWSDSLCGDVVMGFTYNNEPKTTKTGI* |
| Ga0114963_100220082 | 3300009154 | Freshwater Lake | MIQVQNIQQTSLNHRAISIWSDSLCQNVVGFTYNNEPKQDTDLG* |
| Ga0114963_100614526 | 3300009154 | Freshwater Lake | MKAQQNIQQLNHTQQRAISIWSDSLCGNVVLGFIYNNEPKQGGTEV* |
| Ga0114968_101574441 | 3300009155 | Freshwater Lake | MKAQQNIHQLNLTAQRAISIWSDSLCGDVIVGFTYNNEPKTTKTGI* |
| Ga0114978_100014088 | 3300009159 | Freshwater Lake | MKAQQNIHQLNIVAERAISQWSDSLCGDIVFGFTYNNEPKTTKTGI* |
| Ga0115005_100334111 | 3300009432 | Marine | MKTVKNIHQQLTQAFRAISIWSNSLCGDVIMGFSYNNEPKTNHIWE* |
| Ga0114964_100280332 | 3300010157 | Freshwater Lake | MIQVQNIHQQLSTATRARNTWSDSLCGDVILGFSAYNNEPKTTKTGI* |
| Ga0114967_1000294524 | 3300010160 | Freshwater Lake | MIQAQNIHQQLSTASRANNIWSDSLCGDIVFGFTYNNEPKTTKTGI* |
| Ga0133913_108439985 | 3300010885 | Freshwater Lake | MKAQQNIHQLNLTAQRAISIWSDSLCGDVIVGFTYNNEPK |
| Ga0151514_10002109 | 3300011115 | Freshwater | MKAQQNIHQLNNVAQRAISIWSDSLCNDIIFEGSVLGFTYNNEPKQTKTGI* |
| Ga0157141_100000510 | 3300012346 | Freshwater | MKAVQNIQQLNHTAQRAISIWSDSLCGDVVLGFTYNNEPKQGGTEV* |
| Ga0157138_10195264 | 3300012352 | Freshwater | MKAQQNIHQFNLTAQRAISIWSDLLCGSDTVIGFTYNNEPKQGGTEV* |
| Ga0164293_101094016 | 3300013004 | Freshwater | MKAQQNIHQQLSTASRAINTWSDSLCGDVIVGFTYNNEP |
| Ga0136641_10105352 | 3300013286 | Freshwater | MKAQQNIHQLNLIAQRAISQWSDSLCGDVVLGFTYNNEPKQGGTEV* |
| Ga0119896_10051902 | 3300014810 | Wastewater | MTTIQNIHQDLTTIMSRALNTWSQLLCGDVILGFSAYNNEPKQGGTEV* |
| Ga0181356_100424611 | 3300017761 | Freshwater Lake | MTTIQNIHQQLSTATRALNTWSDSLCGDVILGFSAYNNEPKKGKTGV |
| Ga0181356_11359422 | 3300017761 | Freshwater Lake | MKAQQNIHQLNNTAQRAISIWSDSLCGDVIVGFTYNNEPKTTKTGI |
| Ga0181356_12281961 | 3300017761 | Freshwater Lake | MITIQNIHQDLTTIMSRALNTWSDSLCGDVILGFSAYNNEPKKGKT |
| Ga0181343_10682073 | 3300017766 | Freshwater Lake | MTTIQNIHQFSSATLRPTQMWSDSLCGDVILGFAAYNNEPKQGGTEV |
| Ga0181358_10517633 | 3300017774 | Freshwater Lake | MIQAQNIHQQLSTATRALNTWSDSLCGDVILGFIAYNNEPKQTKTGI |
| Ga0181358_10790341 | 3300017774 | Freshwater Lake | MKAQQNIHQLDNTAQRAISIWSDSLCGDVIVGFTYNNEPKQDTDLG |
| Ga0181349_10548111 | 3300017778 | Freshwater Lake | MKAQQNIHQQLSAASRANNIWSDSLCGDVIVGFTYNNEPKQTRTGI |
| Ga0181349_12976292 | 3300017778 | Freshwater Lake | MTTIQNIHQFSSATLRPTSQMWSNSLCGDVILGFAA |
| Ga0181355_102320213 | 3300017785 | Freshwater Lake | MKAQQNIHQLNRTAQRAISQWSDSLCGDVIFGFTYNNEPKTTKTGI |
| Ga0181355_13731183 | 3300017785 | Freshwater Lake | MKAQQNIHQLNLTAQRAISTWSDSLCGDVIVGFTYNN |
| Ga0181359_10439482 | 3300019784 | Freshwater Lake | MITIQNIHQDLTTIMSRALNTWSDSLCGDVILGFSAYNNEPKTTKTGI |
| Ga0181359_10844124 | 3300019784 | Freshwater Lake | MKAQQNIHQLNLTAQRAISIWSDSLCGDVIVGFTYNNEPKTTKTGI |
| Ga0207193_10874982 | 3300020048 | Freshwater Lake Sediment | MTQIQNIHQQLSTATRALNTWSDSLCGDIILYGDVILGFSAYNNEPKHGGTEV |
| Ga0211733_1064110637 | 3300020160 | Freshwater | MTTIQNIHQDLTTIMSRALNTWSQLLCGDVILGFSAYNNEPKQGGIGV |
| Ga0211731_101824189 | 3300020205 | Freshwater | MIQAQNIHQQLSTASRANNIWSDSLCGDVVVGFTYNNEPKTTKTGI |
| Ga0222714_100246865 | 3300021961 | Estuarine Water | MKAIQNIHQQLTQAFRAISIWSDSLCGDVVLGFAGYNNEPKQGGTEV |
| Ga0222714_102215822 | 3300021961 | Estuarine Water | MKAQQNIHQLNLTAQRAISIWSDSLCGDVVLGFTYNNEPKQGGTEV |
| Ga0222714_105016431 | 3300021961 | Estuarine Water | IQNIHQLNSTAQRAISIWSDSLCGDVVLGFTYNNEPKQGGTEV |
| Ga0222714_106654092 | 3300021961 | Estuarine Water | MTTIQNIHQQFSTATRALNTWSDSLCGDVILGFIAYNNE |
| Ga0222712_1000260424 | 3300021963 | Estuarine Water | MTQIQNIHQQLSTATRALNTWSDSLCGDVILGFSAYNNEPKQGKTGV |
| Ga0222712_103358043 | 3300021963 | Estuarine Water | MKAIQNIHQDLTTIMSRAIQLVSDSLCGDFSWDVILGSSYNN |
| Ga0222712_104211911 | 3300021963 | Estuarine Water | NIHQLNSTAQRAISIWSDSLCGDVVLGFTYNNEPKQGGTEV |
| Ga0181354_100046319 | 3300022190 | Freshwater Lake | MTTIQNIHQFSSTALRSTQMWSDSLCGDVIVGFTYNNEPKTTKTGI |
| Ga0181351_10319573 | 3300022407 | Freshwater Lake | MQALQNIHQQLNTASRAISQWSDSLCGDVIVGFTYNNEPKTTKTGI |
| Ga0181351_11682851 | 3300022407 | Freshwater Lake | MTTIQNIHQFSSATLRPTQMWSDSLCGDVILGFAAYNNEPKQGDRDLV |
| Ga0214921_105820432 | 3300023174 | Freshwater | MQALQNIHQQLSIASRAISQWSDSLCGDVIVGFTYNNEPKTTKTGI |
| Ga0244775_1000072528 | 3300024346 | Estuarine | MQALQNIHQQLSTASRAISQWSDSLCGDVIVGFTYNNEPKTTKTGI |
| Ga0244775_101316626 | 3300024346 | Estuarine | MTTIQNIHQFSSTALRPTSQMWSDSLCGDVILGFAAYNNEPKKGGTEV |
| Ga0256308_100002325 | 3300024549 | Freshwater | MKTIQNIHQDLTTIMSRALNTWSQILCGDVIMGFSAYNNEPKTTKTGI |
| Ga0208160_10067712 | 3300025647 | Aqueous | MTTIQNIHQFSSATLRPTSQMWSDSLCGDVILGFIAYNNEPKQGGTEV |
| Ga0208134_11769322 | 3300025652 | Aqueous | MKTIQNIHQQLTQAFKAISKWSDLLCSDVILGFMYNNEPKQGHSWSGYNIS |
| Ga0208133_10225132 | 3300027631 | Estuarine | MIQVQNIHQLNSTAQRAISIWSDSLCGDVLVGFTYNNEPKQDTDLG |
| Ga0209085_10548202 | 3300027741 | Freshwater Lake | MIQVQNIQQTSLNHRAISIWSDSLCQNVVGFTYNNEPKQDTDLG |
| Ga0209085_10884555 | 3300027741 | Freshwater Lake | MKAQQNIQQLNHTQQRAISIWSDSLCGNVVLGFIYNNEPKQGGTEV |
| Ga0209084_103850710 | 3300027749 | Freshwater Lake | KSKMKAQQNIHQLNNTAQRAISIWSDSLCGDVILGFTYNNEPKTTKTGI |
| Ga0209084_12730372 | 3300027749 | Freshwater Lake | MKAQQNIHQLNNTAQRAISTWSDSLCGDVVMGFTYNNEPKTT |
| Ga0209500_100203373 | 3300027782 | Freshwater Lake | MKAQQNIHQLNIVAERAISQWSDSLCGDIVFGFTYNNEPKTTKTGI |
| Ga0209287_103737842 | 3300027792 | Freshwater Sediment | MKAVQNIQQLNHTAQRAISIWSDSLCGDVVLGFTYNNEPKQTKTGI |
| Ga0209712_1002101621 | 3300027849 | Marine | MKTVKNIHQQLTQAFRAISIWSNSLCGDVIMGFSYNNEPKTNHIWE |
| Ga0209400_10066496 | 3300027963 | Freshwater Lake | MKAQQNIHQLNLTAQRAISIWSDSLCGDVIVGFTYNNEPKKGKTGI |
| Ga0304729_10094802 | 3300028392 | Freshwater Lake | MIQVQNIHQQLSTATRARNTWSDSLCGDVILGFSAYNNEPKTTKTGI |
| Ga0304729_12170752 | 3300028392 | Freshwater Lake | MKAQQNIHQLNMIAERAISQWSDSLCGDIVFGFTYNNEPKTTKTGR |
| Ga0304730_10033549 | 3300028394 | Freshwater Lake | MIQAQNIHQQLSTASRANNIWSDSLCGDIVFGFTYNNEPKTTKTGI |
| Ga0315900_103739301 | 3300031787 | Freshwater | NIHQFSSATLRPTQIWSDSLCGDVILGFAAYNNQEPKQGGTEV |
| Ga0335001_0008556_3969_4109 | 3300034064 | Freshwater | MTTIQNIHQLNTIATRAISQWSDSLCGDVVMGFTYNNEPKQGGTEV |
| Ga0335019_0062908_248_391 | 3300034066 | Freshwater | MKAIQNIHQLNLTAQRAISIWSDSLCGDVVLGFTYNNEPKQGDRDLV |
| Ga0335031_0327604_71_214 | 3300034104 | Freshwater | MKAIQNIHQQLSTATRALNTWSDSLCGDVILGFAGYNNEPKQGGTEV |
| Ga0335036_0858686_413_517 | 3300034106 | Freshwater | MKAQQNIHQLNLTAQRAISIWSDSLCGDVIVGFTY |
| ⦗Top⦘ |