


| Basic Information | |
|---|---|
| Family ID | F103109 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 101 |
| Average Sequence Length | 38 residues |
| Representative Sequence | TDGMRRPVSDGMLYAPKLSTRFEAQEIKETGNEEG |
| Number of Associated Samples | 94 |
| Number of Associated Scaffolds | 101 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 11.88 % |
| % of genes near scaffold ends (potentially truncated) | 91.09 % |
| % of genes from short scaffolds (< 2000 bps) | 85.15 % |
| Associated GOLD sequencing projects | 88 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (64.356 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland (12.871 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.663 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.554 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 28.57% β-sheet: 0.00% Coil/Unstructured: 71.43% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 101 Family Scaffolds |
|---|---|---|
| PF02371 | Transposase_20 | 43.56 |
| PF01548 | DEDD_Tnp_IS110 | 24.75 |
| PF00589 | Phage_integrase | 0.99 |
| PF05231 | MASE1 | 0.99 |
| PF01833 | TIG | 0.99 |
| PF07883 | Cupin_2 | 0.99 |
| PF13561 | adh_short_C2 | 0.99 |
| PF08281 | Sigma70_r4_2 | 0.99 |
| PF04185 | Phosphoesterase | 0.99 |
| PF00326 | Peptidase_S9 | 0.99 |
| PF04956 | TrbC | 0.99 |
| PF01022 | HTH_5 | 0.99 |
| PF12681 | Glyoxalase_2 | 0.99 |
| PF02518 | HATPase_c | 0.99 |
| PF07646 | Kelch_2 | 0.99 |
| PF16657 | Malt_amylase_C | 0.99 |
| PF00069 | Pkinase | 0.99 |
| COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
|---|---|---|---|
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 68.32 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.96 |
| COG0642 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.99 |
| COG3055 | N-acetylneuraminic acid mutarotase | Cell wall/membrane/envelope biogenesis [M] | 0.99 |
| COG3447 | Integral membrane sensor domain MASE1 | Signal transduction mechanisms [T] | 0.99 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.99 |
| COG3838 | Type IV secretory pathway, VirB2 component (pilin) | Intracellular trafficking, secretion, and vesicular transport [U] | 0.99 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.99 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 64.36 % |
| All Organisms | root | All Organisms | 35.64 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001305|C688J14111_10044060 | Not Available | 1344 | Open in IMG/M |
| 3300001661|JGI12053J15887_10563185 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 543 | Open in IMG/M |
| 3300005187|Ga0066675_10872221 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300005439|Ga0070711_100402349 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1111 | Open in IMG/M |
| 3300005568|Ga0066703_10844653 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 523 | Open in IMG/M |
| 3300005576|Ga0066708_11020694 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 513 | Open in IMG/M |
| 3300005587|Ga0066654_10004369 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4814 | Open in IMG/M |
| 3300005764|Ga0066903_108604754 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 520 | Open in IMG/M |
| 3300005834|Ga0068851_10429468 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300005921|Ga0070766_10261123 | Not Available | 1101 | Open in IMG/M |
| 3300005994|Ga0066789_10127867 | Not Available | 1084 | Open in IMG/M |
| 3300006052|Ga0075029_100084497 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1884 | Open in IMG/M |
| 3300006642|Ga0075521_10567828 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 558 | Open in IMG/M |
| 3300006794|Ga0066658_10333333 | Not Available | 810 | Open in IMG/M |
| 3300006797|Ga0066659_10624947 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 876 | Open in IMG/M |
| 3300006881|Ga0068865_101925554 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 536 | Open in IMG/M |
| 3300009093|Ga0105240_10003752 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 23470 | Open in IMG/M |
| 3300009093|Ga0105240_10084907 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3880 | Open in IMG/M |
| 3300009093|Ga0105240_11339198 | Not Available | 754 | Open in IMG/M |
| 3300009520|Ga0116214_1276644 | Not Available | 641 | Open in IMG/M |
| 3300009523|Ga0116221_1167185 | Not Available | 956 | Open in IMG/M |
| 3300009524|Ga0116225_1067174 | Not Available | 1695 | Open in IMG/M |
| 3300009545|Ga0105237_10051164 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4150 | Open in IMG/M |
| 3300009547|Ga0116136_1026155 | Not Available | 1834 | Open in IMG/M |
| 3300009630|Ga0116114_1026853 | Not Available | 1706 | Open in IMG/M |
| 3300009635|Ga0116117_1052490 | Not Available | 1003 | Open in IMG/M |
| 3300009636|Ga0116112_1014386 | Not Available | 2908 | Open in IMG/M |
| 3300009636|Ga0116112_1032524 | Not Available | 1642 | Open in IMG/M |
| 3300009643|Ga0116110_1029578 | Not Available | 2059 | Open in IMG/M |
| 3300009643|Ga0116110_1142107 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 796 | Open in IMG/M |
| 3300009645|Ga0116106_1025194 | All Organisms → cellular organisms → Bacteria | 2067 | Open in IMG/M |
| 3300009683|Ga0116224_10151741 | Not Available | 1115 | Open in IMG/M |
| 3300009839|Ga0116223_10453684 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300010043|Ga0126380_10138191 | Not Available | 1538 | Open in IMG/M |
| 3300010358|Ga0126370_12192291 | Not Available | 544 | Open in IMG/M |
| 3300010361|Ga0126378_10480269 | All Organisms → cellular organisms → Bacteria | 1358 | Open in IMG/M |
| 3300010366|Ga0126379_10331014 | Not Available | 1544 | Open in IMG/M |
| 3300011089|Ga0138573_1144135 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 503 | Open in IMG/M |
| 3300011270|Ga0137391_10394229 | All Organisms → cellular organisms → Bacteria | 1184 | Open in IMG/M |
| 3300012363|Ga0137390_10817133 | Not Available | 889 | Open in IMG/M |
| 3300012677|Ga0153928_1038963 | Not Available | 965 | Open in IMG/M |
| 3300012927|Ga0137416_11614090 | Not Available | 590 | Open in IMG/M |
| 3300012948|Ga0126375_11614746 | Not Available | 559 | Open in IMG/M |
| 3300012971|Ga0126369_11138438 | Not Available | 870 | Open in IMG/M |
| 3300013307|Ga0157372_10245439 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 2078 | Open in IMG/M |
| 3300016319|Ga0182033_11280360 | Not Available | 658 | Open in IMG/M |
| 3300016357|Ga0182032_10125537 | Not Available | 1859 | Open in IMG/M |
| 3300017931|Ga0187877_1037745 | Not Available | 2324 | Open in IMG/M |
| 3300017933|Ga0187801_10294342 | Not Available | 659 | Open in IMG/M |
| 3300017955|Ga0187817_10094901 | Not Available | 1873 | Open in IMG/M |
| 3300018004|Ga0187865_1048097 | Not Available | 1728 | Open in IMG/M |
| 3300018008|Ga0187888_1069496 | Not Available | 1562 | Open in IMG/M |
| 3300018017|Ga0187872_10090108 | Not Available | 1552 | Open in IMG/M |
| 3300018022|Ga0187864_10082121 | Not Available | 1713 | Open in IMG/M |
| 3300018040|Ga0187862_10101414 | Not Available | 1994 | Open in IMG/M |
| 3300018042|Ga0187871_10671786 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300018043|Ga0187887_10040146 | Not Available | 2908 | Open in IMG/M |
| 3300018046|Ga0187851_10147380 | Not Available | 1426 | Open in IMG/M |
| 3300020580|Ga0210403_11188934 | Not Available | 588 | Open in IMG/M |
| 3300021170|Ga0210400_10208264 | Not Available | 1591 | Open in IMG/M |
| 3300021171|Ga0210405_10568903 | Not Available | 884 | Open in IMG/M |
| 3300021180|Ga0210396_10266278 | Not Available | 1521 | Open in IMG/M |
| 3300021181|Ga0210388_10235022 | Not Available | 1607 | Open in IMG/M |
| 3300021405|Ga0210387_10263328 | Not Available | 1510 | Open in IMG/M |
| 3300021445|Ga0182009_10316007 | Not Available | 790 | Open in IMG/M |
| 3300021474|Ga0210390_10383453 | Not Available | 1188 | Open in IMG/M |
| 3300025432|Ga0208821_1001933 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 9811 | Open in IMG/M |
| 3300025460|Ga0208562_1015397 | Not Available | 1889 | Open in IMG/M |
| 3300025500|Ga0208686_1018907 | Not Available | 1799 | Open in IMG/M |
| 3300025501|Ga0208563_1025337 | Not Available | 1500 | Open in IMG/M |
| 3300025507|Ga0208188_1072231 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 819 | Open in IMG/M |
| 3300025898|Ga0207692_10181842 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 1225 | Open in IMG/M |
| 3300025913|Ga0207695_10012133 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 10356 | Open in IMG/M |
| 3300025913|Ga0207695_10109643 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter riparius | 2742 | Open in IMG/M |
| 3300025919|Ga0207657_11129445 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300025920|Ga0207649_10906399 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 691 | Open in IMG/M |
| 3300026547|Ga0209156_10426548 | Not Available | 550 | Open in IMG/M |
| 3300027854|Ga0209517_10064114 | All Organisms → cellular organisms → Bacteria | 2656 | Open in IMG/M |
| 3300027854|Ga0209517_10200234 | Not Available | 1233 | Open in IMG/M |
| 3300027854|Ga0209517_10337595 | Not Available | 867 | Open in IMG/M |
| 3300028762|Ga0302202_10158635 | Not Available | 1204 | Open in IMG/M |
| 3300028866|Ga0302278_10147709 | Not Available | 1230 | Open in IMG/M |
| 3300028874|Ga0302155_10142473 | Not Available | 1057 | Open in IMG/M |
| 3300030045|Ga0302282_1095170 | Not Available | 1242 | Open in IMG/M |
| 3300030494|Ga0310037_10090730 | Not Available | 1423 | Open in IMG/M |
| 3300030991|Ga0073994_12331816 | Not Available | 701 | Open in IMG/M |
| 3300031018|Ga0265773_1018741 | Not Available | 665 | Open in IMG/M |
| 3300031057|Ga0170834_107791067 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2015 | Open in IMG/M |
| 3300031259|Ga0302187_10561262 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 515 | Open in IMG/M |
| 3300031524|Ga0302320_10483305 | Not Available | 1509 | Open in IMG/M |
| 3300031708|Ga0310686_116623982 | Not Available | 670 | Open in IMG/M |
| 3300031715|Ga0307476_10279918 | Not Available | 1221 | Open in IMG/M |
| 3300031719|Ga0306917_10145116 | Not Available | 1755 | Open in IMG/M |
| 3300031959|Ga0318530_10163172 | Not Available | 908 | Open in IMG/M |
| 3300031996|Ga0308176_11067145 | Not Available | 854 | Open in IMG/M |
| 3300032001|Ga0306922_10530815 | Not Available | 1252 | Open in IMG/M |
| 3300032261|Ga0306920_101432845 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 989 | Open in IMG/M |
| 3300032770|Ga0335085_10401585 | Not Available | 1590 | Open in IMG/M |
| 3300032783|Ga0335079_10841595 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
| 3300032954|Ga0335083_11536951 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 504 | Open in IMG/M |
| 3300033887|Ga0334790_047042 | Not Available | 1638 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 12.87% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 9.90% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 8.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.93% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 5.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.95% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 4.95% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.97% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.97% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.98% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.98% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.98% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.99% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.99% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.99% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.99% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.99% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.99% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.99% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.99% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.99% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.99% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.99% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.99% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009547 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 | Environmental | Open in IMG/M |
| 3300009630 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 | Environmental | Open in IMG/M |
| 3300009635 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 | Environmental | Open in IMG/M |
| 3300009636 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 | Environmental | Open in IMG/M |
| 3300009643 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 | Environmental | Open in IMG/M |
| 3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300011089 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 58 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012677 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ012 MetaG | Host-Associated | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300017931 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300018004 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100 | Environmental | Open in IMG/M |
| 3300018008 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40 | Environmental | Open in IMG/M |
| 3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
| 3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300025432 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025460 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025500 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025501 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025507 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300028762 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_3 | Environmental | Open in IMG/M |
| 3300028866 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300028874 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_1 | Environmental | Open in IMG/M |
| 3300030045 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_3 | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031259 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E1_3 | Environmental | Open in IMG/M |
| 3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033887 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| C688J14111_100440602 | 3300001305 | Soil | KSDGMRRPVSDGMLYAPKLSTRFEAQEIKETGNEEG* |
| JGI12053J15887_105631851 | 3300001661 | Forest Soil | TDGMRRPVSGGMRYAPKLSTRSKAQEIKETGNEED* |
| Ga0066675_108722211 | 3300005187 | Soil | MRRPVSDGMLYAPKLSTCSEAQEIKETGNEKAYHRCGKLDGTTR |
| Ga0070711_1004023491 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRPVSDGMLYAPKLSTCCEAQEIKETGNEEAYQRCDKLDWKARKT |
| Ga0066703_108446532 | 3300005568 | Soil | DGMRRPVSDGMLYAPKLSTRFEAQEIKETGNEEG* |
| Ga0066708_110206942 | 3300005576 | Soil | SDGMRRPVSDGMLYAPKLSTCFEAQEIKETGNEEG* |
| Ga0066654_100043691 | 3300005587 | Soil | PDGMRRPVSDGMLYAPKLSTRFEAQEIKETGNEEG* |
| Ga0066903_1086047541 | 3300005764 | Tropical Forest Soil | SDGMRRPVSGRDAVYAPKLSTCSKAQEIKETGNEKG* |
| Ga0068851_104294681 | 3300005834 | Corn Rhizosphere | MRRPVSDGMLYAPKLSTCSEAQEIKETGNEEAYHRCD |
| Ga0070766_102611231 | 3300005921 | Soil | DGMRRPVSDGMLYAPKLSTCSKAQEIKETGNEEG* |
| Ga0066789_101278671 | 3300005994 | Soil | DGMRRPVSDGMLYAPKLSTRSKAQEIKKTGNEED* |
| Ga0075029_1000844973 | 3300006052 | Watersheds | MLKSDGMRRPVSDGMLYAPKLSTRFEAQEIKETGNEE |
| Ga0075521_105678282 | 3300006642 | Arctic Peat Soil | LAKPDGMRMPVSGGMRYAPKLSTRSKRKEIKETGHEED* |
| Ga0066658_103333331 | 3300006794 | Soil | KSDGMRRPVSDGMLYAPKLSTCFEAQEIKETGNEEG* |
| Ga0066659_106249472 | 3300006797 | Soil | MRRPVSDGMLCAPKLSTCSEAQEIKETGNEKAYHHCGKLDGT |
| Ga0068865_1019255541 | 3300006881 | Miscanthus Rhizosphere | DGMRRPVSDGMLYAPKLSTCFEAQEIKETGNEEG* |
| Ga0105240_100037522 | 3300009093 | Corn Rhizosphere | MLSGQLLLTDEMRRPVCGRDAVYAAKLSTCSKAQEIKETGNEEG* |
| Ga0105240_100849072 | 3300009093 | Corn Rhizosphere | MKQTDEMRRPVSGRDAVYAPKLSTCSEAQEIKETGNEEG* |
| Ga0105240_113391982 | 3300009093 | Corn Rhizosphere | MKSDGMRRPVSDGMLYASQVIDVLEAQEIKETGNEKG* |
| Ga0116214_12766441 | 3300009520 | Peatlands Soil | PDGMRMPVSGGMRYAPKLSTRSKRKEIKETGNEED* |
| Ga0116221_11671851 | 3300009523 | Peatlands Soil | FTKPDGMRRPVSDGMLYAPKLSTRFEAQEIKETGNEEG* |
| Ga0116225_10671741 | 3300009524 | Peatlands Soil | LSDGMRRPVSGGMLYAPKLSTRSKRKQIKETGNEKG* |
| Ga0105237_100511647 | 3300009545 | Corn Rhizosphere | MKQTDEMRRPVSGRDAVHAPKLSTCSEAQEIKETGNEEG* |
| Ga0116136_10261551 | 3300009547 | Peatland | DGMRMPVSGGMRYAPKLSTRSKRKEIKETGNEED* |
| Ga0116114_10268531 | 3300009630 | Peatland | PDGMRRPVSDGMLYAPKLSTRFEAQEIKETGNEED* |
| Ga0116117_10524901 | 3300009635 | Peatland | TDGMRRPVSDGMLYAPKLSTRSKAQEIKETGNEED* |
| Ga0116112_10143866 | 3300009636 | Peatland | MLSDGMRRPVSDGMLYAPKLSTRFEAQEIKETGNEED* |
| Ga0116112_10325241 | 3300009636 | Peatland | DGMRRPVSDGMLYAPKLSTRFEAQEIKETGNEED* |
| Ga0116110_10295781 | 3300009643 | Peatland | DGMRRPVSDGMLYAPKLSTRFEAQEIKETGNEKD* |
| Ga0116110_11421073 | 3300009643 | Peatland | MKLDGMRMPVSGGMRYAPKLSTRSKRKEIKETGNEED* |
| Ga0116106_10251941 | 3300009645 | Peatland | SDGMRRPVSDGMLYAPKLSTRFEAQEIKETGNEED* |
| Ga0116224_101517411 | 3300009683 | Peatlands Soil | TDGMRRPVSDGMRYAPKLSTRFEAQEIKETGNEED* |
| Ga0116223_104536841 | 3300009839 | Peatlands Soil | DGMRRPVSDGMRYAPKLSTRFEAQEIKETGNEED* |
| Ga0126380_101381911 | 3300010043 | Tropical Forest Soil | DEMRRPVSDGMLYAPKLSTCSEAQEIKETGNEKD* |
| Ga0126370_121922912 | 3300010358 | Tropical Forest Soil | MGRSYLLLTDEMRRPVSDGMLYAPKLSTCSEAQEIKETGNEKD* |
| Ga0126378_104802692 | 3300010361 | Tropical Forest Soil | VGHARNPLLTKPDGMRRPVSDGMLYAPRYPRARGTEKKETGNEE |
| Ga0126379_103310141 | 3300010366 | Tropical Forest Soil | QSDEMRRPVSDGMLYAPKLSTCSEAQEIKETGNEKD* |
| Ga0138573_11441351 | 3300011089 | Peatlands Soil | SDGMRRPVSDGMLYAPKLSTRFEAQEIKETGNEEG* |
| Ga0137391_103942291 | 3300011270 | Vadose Zone Soil | SDGMRRPVSGGMRYALKLSTRSKAQEIKETANEGD* |
| Ga0137390_108171331 | 3300012363 | Vadose Zone Soil | TDGMRRPVSDGMLYAPKLSTRSKAQEIKETGNEEG* |
| Ga0153928_10389631 | 3300012677 | Attine Ant Fungus Gardens | ITDGMRRPVSGGMLYAPKLSTRSTRKQIKETGNEKG* |
| Ga0137416_116140901 | 3300012927 | Vadose Zone Soil | SDGMRRPVSDGMLYAPKLSTRFEAQKIKETGNEED* |
| Ga0126375_116147461 | 3300012948 | Tropical Forest Soil | MGQLAKPDGMRRPVSDGMLYAPKLSTCSEAQEIKETGNEEGWHRDGQ |
| Ga0126369_111384381 | 3300012971 | Tropical Forest Soil | TDGMRRPVSGRDAVYAPKLSTCSEAQEIKETGNEEG* |
| Ga0157372_102454392 | 3300013307 | Corn Rhizosphere | MKQTDEMRRPVSGRDAVYAPKLSTCSKAQEIKETGNEEG* |
| Ga0182033_112803601 | 3300016319 | Soil | DGMRRPVSGRDAVYAPKLSTCSKAQEIKETGNEKG |
| Ga0182032_101255371 | 3300016357 | Soil | KSDGMRRPVSGRDAVYAPKLSTCSKAQEIKETGNEKG |
| Ga0187877_10377451 | 3300017931 | Peatland | SDGMRRPVSDGMLYAPKLSTRFEAQEIKETGNEED |
| Ga0187801_102943421 | 3300017933 | Freshwater Sediment | SDGMRMPVSGGMRYAPKLSTRSRRKEIKETGNEKD |
| Ga0187817_100949012 | 3300017955 | Freshwater Sediment | VNPAISQVTKSDGMRRPVSGGMRYAPKLSTRSKAQEIKETGNEED |
| Ga0187865_10480971 | 3300018004 | Peatland | PDGMRRPVSDGMLYAPKLSTRFEAQEIKETGNEED |
| Ga0187888_10694963 | 3300018008 | Peatland | MLSDGMRRPVSDGMLYAPKLSTRFEAQEIKETGNEE |
| Ga0187872_100901081 | 3300018017 | Peatland | SDGMRRPVSDGMLYAPKLSTRFEAQEIKETGNEKD |
| Ga0187864_100821211 | 3300018022 | Peatland | PDGMRRPVSDGMLYAPKLSTRFEAQEIKETGNEKD |
| Ga0187862_101014142 | 3300018040 | Peatland | LSQPDGMRRPVSDGMLYAPKLSTRFEAQEIKETGNEKD |
| Ga0187871_106717862 | 3300018042 | Peatland | MQTDGMRRPVSDGMLYAPKLSTRFEAQEIKETGNE |
| Ga0187887_100401467 | 3300018043 | Peatland | MLSDGMRRPVSDGMLYAPKLSTRFEAQEIKETGNEED |
| Ga0187851_101473801 | 3300018046 | Peatland | PDGMRRPVSDGMLYAPKLSTRSKAQEIKETGNEED |
| Ga0210403_111889341 | 3300020580 | Soil | LMKSDGMRRPVSDGMLYAPKLSTRFEAQEIKETGNEEG |
| Ga0210400_102082642 | 3300021170 | Soil | VLLGLTDGMRRPVSDGMLYAPKLSTCFEAQEIKETGNEEG |
| Ga0210405_105689032 | 3300021171 | Soil | KPDGMRRPVSGRDAVYAPKLSTCSEAQEIKETGNEKG |
| Ga0210396_102662781 | 3300021180 | Soil | ELFQTEGMRRPVSGRDAVYAPKLSTCSEAQEIKETGNEEG |
| Ga0210388_102350221 | 3300021181 | Soil | VISLAITDGMRRPVSDGMLYAPKLWTRSKRKQIKETGNEKG |
| Ga0210387_102633281 | 3300021405 | Soil | FCSKLAITDGMRRPVSDGMLYAPKLWTRSKRKQIKETGNEKG |
| Ga0182009_103160072 | 3300021445 | Soil | ITDEMRRPVSGPDAVYAPKLSMCSRHEIKEIGNEEG |
| Ga0210390_103834532 | 3300021474 | Soil | LSKTDGMRRPVSDGMLYAPKLSTCSKAQEIKETGNEEG |
| Ga0208821_10019336 | 3300025432 | Peatland | HETHQLHIPDGMRMPVSGGMRYAPKLSTRSKRKEIKETGNEED |
| Ga0208562_10153971 | 3300025460 | Peatland | VSKTDGMRMPVSGGMRYAPKLSTRSKRKEIKETGNEED |
| Ga0208686_10189071 | 3300025500 | Peatland | YRSDGMRMPVSGGMRYAPKLSTRSKRKEIKETGNEED |
| Ga0208563_10253372 | 3300025501 | Peatland | DTDGMRRPVSDGMLYAPKLSTRFEAQEIKETGNEKD |
| Ga0208188_10722311 | 3300025507 | Peatland | MKLDGMRMPVSGGMRYAPKLSTRSKRKEIKETGNEED |
| Ga0207692_101818422 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | VKKTDGMRRPVSDGMLYAPKLSTCCEAQEIKETGNEEAYHRCDK |
| Ga0207695_100121332 | 3300025913 | Corn Rhizosphere | MLSGQLLLTDEMRRPVCGRDAVYAAKLSTCSKAQEIKETGNEEG |
| Ga0207695_101096434 | 3300025913 | Corn Rhizosphere | MKQTDEMRRPVSGRDAVYAPKLSTCSEAQEIKETGNEEG |
| Ga0207657_111294451 | 3300025919 | Corn Rhizosphere | MRRPVSDGRLYAPKLSTCSEAQEIKETGNEEAYHR |
| Ga0207649_109063991 | 3300025920 | Corn Rhizosphere | MRRPVSDGMLYAPKLSTCSEAQEIKETGNEEAYHRCDK |
| Ga0209156_104265482 | 3300026547 | Soil | KSDGMRRPVSDGMLYAPKLSTRFEAQEIKETGNEEG |
| Ga0209517_100641144 | 3300027854 | Peatlands Soil | TDGMRRPVSDGMRYAPKLSTRFEAQEIKETGNEED |
| Ga0209517_102002342 | 3300027854 | Peatlands Soil | QSDGMRRPVSDGMLYAPKLSTRFEAQEIKETGNEEG |
| Ga0209517_103375952 | 3300027854 | Peatlands Soil | LMLPDGMRRPVSDGMLYAPKLSTRFEAQEIKETGNEEG |
| Ga0302202_101586351 | 3300028762 | Bog | GSFSTDGMRRPVSDGMLYAPKLSTRFEAQEIKETGNEEG |
| Ga0302278_101477092 | 3300028866 | Bog | LLLTDGMRRPVSDGMLYAPKLSTRFEAQEIKETGNEEG |
| Ga0302155_101424732 | 3300028874 | Bog | YSQLLLTDGMRRPVSDGMLYAPKLSTRFEAQEIKETGNEEG |
| Ga0302282_10951701 | 3300030045 | Fen | SQLLLTDGMRRPVSDGMLYAPKLSTRFEAQEIKETGNEEG |
| Ga0310037_100907301 | 3300030494 | Peatlands Soil | HQLYPLSDLLTQTDGMRRPVSDGMRYAPKLSTRFEAQEIKETGNEED |
| Ga0073994_123318161 | 3300030991 | Soil | SDGMRRPVSDGMLYAPKLSTRFEAQKIKETGNEED |
| Ga0265773_10187411 | 3300031018 | Soil | TDGMRRPVSGGMRYAPKLSTRSKAQEIKETGNEED |
| Ga0170834_1077910671 | 3300031057 | Forest Soil | TDGMRRPVSDGMLYAPKLSTCFEAQEIKETGNEEG |
| Ga0302187_105612622 | 3300031259 | Bog | VYSQLLLTDGMRRPVSDGMLYAPKLSTRFEAQEIKETGNEEG |
| Ga0302320_104833051 | 3300031524 | Bog | TDGMRRPVSDGMLYAPKLSTRFEAQEIKETGNEEG |
| Ga0310686_1166239821 | 3300031708 | Soil | MVKPQYTLVQLTRTDGMRRPVSDGMRYAPKLSTCFEAQEIKETGNE |
| Ga0307476_102799181 | 3300031715 | Hardwood Forest Soil | MSRDYAPDQLSKPDGMRRPVSGRDAVYAPKLSTCSEAQEIKETGN |
| Ga0306917_101451161 | 3300031719 | Soil | SDGMRRPVSGRDAVYAPKLSTCSKAQEIKETGNEKG |
| Ga0318530_101631721 | 3300031959 | Soil | MLQSDGMRRPVSGRDAVYAPKLSTCSKAQEIKETGNEKG |
| Ga0308176_110671452 | 3300031996 | Soil | KSDGMRRPVSDGMLYAPKLSTCFEAQEIKETGNEEG |
| Ga0306922_105308152 | 3300032001 | Soil | TDGMRRPVSEGMLYAPKLSTCSEAQEIKETGNEEG |
| Ga0306920_1014328452 | 3300032261 | Soil | MGWLSKSDGMRRPVSGRDAVYAPKLSTCSKAQEIKETGNEKG |
| Ga0335085_104015851 | 3300032770 | Soil | KTDEMRRPVSGRDAVYAPKLSTCSEAQEIKETGNEEG |
| Ga0335079_108415952 | 3300032783 | Soil | MFSQLSLTDGMRRPVSGRDAVYAPKLSTCSEAQEIKETGN |
| Ga0335083_115369511 | 3300032954 | Soil | LSDGMRRPVSDGMLYAPKLSTCSRAQEIKETGNEEG |
| Ga0334790_047042_1510_1638 | 3300033887 | Soil | DAAQLAKTDGMRRPVSDGMLYAPKLSTRFEAQEIKETGNEKD |
| ⦗Top⦘ |