


| Basic Information | |
|---|---|
| Family ID | F102912 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 101 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MKALIAALALVTLIASPTFAQSYPGEHQEQTNVSPASPNFGDNGY |
| Number of Associated Samples | 87 |
| Number of Associated Scaffolds | 101 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 75.25 % |
| % of genes near scaffold ends (potentially truncated) | 40.59 % |
| % of genes from short scaffolds (< 2000 bps) | 84.16 % |
| Associated GOLD sequencing projects | 84 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.26 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (73.267 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (15.842 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.733 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (65.347 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 16.44% β-sheet: 0.00% Coil/Unstructured: 83.56% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.26 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 101 Family Scaffolds |
|---|---|---|
| PF00196 | GerE | 6.93 |
| PF00072 | Response_reg | 3.96 |
| PF12697 | Abhydrolase_6 | 2.97 |
| PF02738 | MoCoBD_1 | 2.97 |
| PF07690 | MFS_1 | 1.98 |
| PF00111 | Fer2 | 1.98 |
| PF01799 | Fer2_2 | 1.98 |
| PF03401 | TctC | 0.99 |
| PF13676 | TIR_2 | 0.99 |
| PF02627 | CMD | 0.99 |
| PF00873 | ACR_tran | 0.99 |
| PF09694 | Gcw_chp | 0.99 |
| PF04545 | Sigma70_r4 | 0.99 |
| PF13533 | Biotin_lipoyl_2 | 0.99 |
| PF00529 | CusB_dom_1 | 0.99 |
| COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
|---|---|---|---|
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.99 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.99 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.99 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 73.27 % |
| Unclassified | root | N/A | 26.73 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908045|KansclcFeb2_ConsensusfromContig69788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 721 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c0483487 | Not Available | 665 | Open in IMG/M |
| 3300000156|NODE_c0526990 | Not Available | 1136 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10022564 | All Organisms → cellular organisms → Bacteria | 1721 | Open in IMG/M |
| 3300001661|JGI12053J15887_10127307 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1357 | Open in IMG/M |
| 3300001661|JGI12053J15887_10288905 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| 3300005166|Ga0066674_10308164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 744 | Open in IMG/M |
| 3300005167|Ga0066672_10308796 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1029 | Open in IMG/M |
| 3300005171|Ga0066677_10501047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 698 | Open in IMG/M |
| 3300005174|Ga0066680_10548983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 726 | Open in IMG/M |
| 3300005179|Ga0066684_10531300 | Not Available | 789 | Open in IMG/M |
| 3300005180|Ga0066685_10413070 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 937 | Open in IMG/M |
| 3300005180|Ga0066685_10935046 | Not Available | 577 | Open in IMG/M |
| 3300005332|Ga0066388_100008641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 7663 | Open in IMG/M |
| 3300005332|Ga0066388_100179739 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2723 | Open in IMG/M |
| 3300005332|Ga0066388_101006327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1397 | Open in IMG/M |
| 3300005363|Ga0008090_13484760 | Not Available | 981 | Open in IMG/M |
| 3300005454|Ga0066687_10580009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 666 | Open in IMG/M |
| 3300005471|Ga0070698_100326591 | All Organisms → cellular organisms → Bacteria | 1465 | Open in IMG/M |
| 3300005518|Ga0070699_100012348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 7369 | Open in IMG/M |
| 3300005549|Ga0070704_101688691 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 585 | Open in IMG/M |
| 3300005559|Ga0066700_10311962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1110 | Open in IMG/M |
| 3300005560|Ga0066670_10189586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1229 | Open in IMG/M |
| 3300005561|Ga0066699_11139711 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 537 | Open in IMG/M |
| 3300005713|Ga0066905_100050681 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2538 | Open in IMG/M |
| 3300005764|Ga0066903_100229135 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2830 | Open in IMG/M |
| 3300005764|Ga0066903_101096398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1467 | Open in IMG/M |
| 3300005764|Ga0066903_102244698 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1053 | Open in IMG/M |
| 3300005764|Ga0066903_106279983 | Not Available | 621 | Open in IMG/M |
| 3300005937|Ga0081455_10038607 | All Organisms → cellular organisms → Bacteria | 4227 | Open in IMG/M |
| 3300005937|Ga0081455_10425402 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
| 3300005985|Ga0081539_10462426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium | 525 | Open in IMG/M |
| 3300006796|Ga0066665_11057662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 620 | Open in IMG/M |
| 3300006844|Ga0075428_102247037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 562 | Open in IMG/M |
| 3300009100|Ga0075418_13052923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 510 | Open in IMG/M |
| 3300009792|Ga0126374_10406723 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 953 | Open in IMG/M |
| 3300009792|Ga0126374_10851229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 702 | Open in IMG/M |
| 3300010043|Ga0126380_10071840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1967 | Open in IMG/M |
| 3300010043|Ga0126380_10567645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 886 | Open in IMG/M |
| 3300010046|Ga0126384_10601435 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 963 | Open in IMG/M |
| 3300010046|Ga0126384_11116108 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 724 | Open in IMG/M |
| 3300010117|Ga0127449_1081009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 857 | Open in IMG/M |
| 3300010127|Ga0127489_1133699 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 515 | Open in IMG/M |
| 3300010358|Ga0126370_10859032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 815 | Open in IMG/M |
| 3300010362|Ga0126377_12749658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 567 | Open in IMG/M |
| 3300010366|Ga0126379_13503871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 526 | Open in IMG/M |
| 3300010376|Ga0126381_102444464 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 749 | Open in IMG/M |
| 3300010398|Ga0126383_10735907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1066 | Open in IMG/M |
| 3300012201|Ga0137365_10505118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 888 | Open in IMG/M |
| 3300012204|Ga0137374_10305137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1304 | Open in IMG/M |
| 3300012208|Ga0137376_10460405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1104 | Open in IMG/M |
| 3300012349|Ga0137387_10818344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 674 | Open in IMG/M |
| 3300012350|Ga0137372_10495228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 910 | Open in IMG/M |
| 3300012356|Ga0137371_11060333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 611 | Open in IMG/M |
| 3300012360|Ga0137375_10823816 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 744 | Open in IMG/M |
| 3300012362|Ga0137361_10089026 | All Organisms → cellular organisms → Bacteria | 2658 | Open in IMG/M |
| 3300012377|Ga0134029_1124484 | Not Available | 513 | Open in IMG/M |
| 3300012924|Ga0137413_11619982 | Not Available | 530 | Open in IMG/M |
| 3300012948|Ga0126375_10441120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 954 | Open in IMG/M |
| 3300014157|Ga0134078_10644474 | Not Available | 513 | Open in IMG/M |
| 3300015359|Ga0134085_10336392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 669 | Open in IMG/M |
| 3300015371|Ga0132258_10031756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 11810 | Open in IMG/M |
| 3300015374|Ga0132255_103105065 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300016270|Ga0182036_11187067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 634 | Open in IMG/M |
| 3300016319|Ga0182033_11290040 | Not Available | 656 | Open in IMG/M |
| 3300016371|Ga0182034_11826014 | Not Available | 536 | Open in IMG/M |
| 3300016404|Ga0182037_11454138 | Not Available | 607 | Open in IMG/M |
| 3300018028|Ga0184608_10532302 | Not Available | 501 | Open in IMG/M |
| 3300018067|Ga0184611_1228691 | Not Available | 661 | Open in IMG/M |
| 3300018431|Ga0066655_10047743 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2191 | Open in IMG/M |
| 3300018433|Ga0066667_10319737 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1218 | Open in IMG/M |
| 3300018433|Ga0066667_10562514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 947 | Open in IMG/M |
| 3300018468|Ga0066662_10055549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2554 | Open in IMG/M |
| 3300018468|Ga0066662_11805864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 640 | Open in IMG/M |
| 3300021560|Ga0126371_12138493 | Not Available | 675 | Open in IMG/M |
| 3300026327|Ga0209266_1159465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 898 | Open in IMG/M |
| 3300026528|Ga0209378_1241054 | Not Available | 574 | Open in IMG/M |
| 3300026538|Ga0209056_10385067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 882 | Open in IMG/M |
| 3300027381|Ga0208983_1054003 | Not Available | 774 | Open in IMG/M |
| 3300027616|Ga0209106_1155839 | Not Available | 508 | Open in IMG/M |
| 3300027663|Ga0208990_1016809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2412 | Open in IMG/M |
| 3300027874|Ga0209465_10250192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 887 | Open in IMG/M |
| 3300027903|Ga0209488_11093603 | Not Available | 545 | Open in IMG/M |
| 3300028712|Ga0307285_10010538 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1983 | Open in IMG/M |
| 3300028875|Ga0307289_10206015 | Not Available | 809 | Open in IMG/M |
| 3300028878|Ga0307278_10101685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1292 | Open in IMG/M |
| 3300031543|Ga0318516_10167388 | Not Available | 1264 | Open in IMG/M |
| 3300031545|Ga0318541_10414534 | Not Available | 753 | Open in IMG/M |
| 3300031681|Ga0318572_10218537 | Not Available | 1116 | Open in IMG/M |
| 3300031768|Ga0318509_10714493 | Not Available | 556 | Open in IMG/M |
| 3300031771|Ga0318546_10915770 | Not Available | 617 | Open in IMG/M |
| 3300031879|Ga0306919_10062124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 2515 | Open in IMG/M |
| 3300031890|Ga0306925_10091296 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3233 | Open in IMG/M |
| 3300031894|Ga0318522_10005466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 3572 | Open in IMG/M |
| 3300031896|Ga0318551_10898197 | Not Available | 517 | Open in IMG/M |
| 3300031945|Ga0310913_10334963 | Not Available | 1070 | Open in IMG/M |
| 3300031947|Ga0310909_10091990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae | 2424 | Open in IMG/M |
| 3300031947|Ga0310909_10097596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 2357 | Open in IMG/M |
| 3300032043|Ga0318556_10193111 | All Organisms → cellular organisms → Bacteria | 1058 | Open in IMG/M |
| 3300032055|Ga0318575_10324952 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300032261|Ga0306920_100604537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1622 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 15.84% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 12.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.88% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.90% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 8.91% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.93% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.95% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.95% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.97% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.97% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 2.97% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.98% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.98% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.98% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.99% |
| Sugar Cane Bagasse Incubating Bioreactor | Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor | 0.99% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.99% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000156 | Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic | Engineered | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010117 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010127 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012377 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300027381 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027616 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028712 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| KansclcFeb2_12995070 | 2124908045 | Soil | FVIWRGIMKALIAAIALVTLIASPTFAQSYPNEQPEQTNVSPASPNFGDNGY |
| ICChiseqgaiiDRAFT_04834872 | 3300000033 | Soil | MKALIAALALVTLIASPTFAQSYPNEQPEQTNVSPASPNFGDNGY* |
| NODE_05269901 | 3300000156 | Sugar Cane Bagasse Incubating Bioreactor | MKTILAALALVTLIASPTFAQSVPTGDLEQAALVSPSSPNFGDNGY*DQ |
| AF_2010_repII_A1DRAFT_100225641 | 3300000597 | Forest Soil | MKTILAALALVTLIASPTFAQSVPTGDLEQAALVSPSSPNFGDNGY* |
| JGI12053J15887_101273072 | 3300001661 | Forest Soil | MKALITALALLTLVAGPTFAQSVYSGEQGTAHNVSPSSSDFGDNGY* |
| JGI12053J15887_102889053 | 3300001661 | Forest Soil | MKALIAALALVTLIAGPTFAQSAYTGEHQPVYNASPASPDFGDNGN* |
| Ga0066674_103081642 | 3300005166 | Soil | MKALIAALALVTLIASPSFAQWYPGEHVEQSNVSPASPNFGDNGY* |
| Ga0066672_103087962 | 3300005167 | Soil | MKALIAALALVTLIASPSFAQSYPGEHVEQSNVSPASPNFGDNGY* |
| Ga0066677_105010473 | 3300005171 | Soil | EPRTIVRKWRGIMKALIAALALVTLIASPSFAQSYPGEHVEQSNVSPASPNFGDNGY* |
| Ga0066680_105489831 | 3300005174 | Soil | NNMKALIAALALVTLIASPSFAQSYPGEHVEQSNVSPASPNFGDNGY* |
| Ga0066684_105313003 | 3300005179 | Soil | MKALIAALALVTLIASPSFAQSYPGEHVEQSNVSPASPNFG |
| Ga0066685_104130703 | 3300005180 | Soil | MKALIAALALVTLIASPSFAPSYPGEHVEQSNVSPASPNFGDNGY* |
| Ga0066685_109350461 | 3300005180 | Soil | MKALIAALALVTLIASPTFARSVPSGHWEQTNVSPSSPNFGDNGY* |
| Ga0066388_1000086413 | 3300005332 | Tropical Forest Soil | MKTILAALALVALIASPAFAQSVPSAHWEQTNVSPSSPDFGDNGY* |
| Ga0066388_1001797394 | 3300005332 | Tropical Forest Soil | MKALIAALALVTLLASPTFAQSYPGEHQEQTNVSPASPDFGDNGY* |
| Ga0066388_1010063272 | 3300005332 | Tropical Forest Soil | MKALIAALALVTLIASPTFAQAVPGEHQEQTNVSPASPNFGDNGY* |
| Ga0008090_134847601 | 3300005363 | Tropical Rainforest Soil | MKAILAALALVTLIASPTFAQSVPTGDLEQAALVSPSSPNFGDNGY* |
| Ga0066687_105800091 | 3300005454 | Soil | MKALIAALALVTLIASPTFAQSVPSGHWEQTNVSPSNPNFGDNGY* |
| Ga0070698_1003265912 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MKAFITALALLTLVAGQTFAQSAYAGEQGVAHNVSPSSSDFGDNGY* |
| Ga0070699_1000123489 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MKALIAALALVTLIASPTLAQSYPGEQPEQTNVSPASPNFGDNGY* |
| Ga0070704_1016886911 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | LIAALALVTLIASPTLAQSYPGEQPEQTNVSPASPNFGDNGY* |
| Ga0066700_103119622 | 3300005559 | Soil | MKALIAALALVTLIASPSFAQSYPGEHVEQSNGSPASPNFGDNGY* |
| Ga0066670_101895862 | 3300005560 | Soil | MKALIAALALVTLIASPTFAQSVPSGHWEQTNVSPSSPNFGDNGY* |
| Ga0066699_111397111 | 3300005561 | Soil | AFGNNGYSNRRTIMKALITALALVTLFASPSFAQSYPGEHQEQTNVSPASPNFGDNGY* |
| Ga0066905_1000506814 | 3300005713 | Tropical Forest Soil | MKALIAALALVTLLASPTFAQSYPGEQPEQTNVSPASPNFGDNGY* |
| Ga0066903_1002291352 | 3300005764 | Tropical Forest Soil | MKALIAALALVTLIASPTFAQSVYSGEHQEQTNVSPASPDFGDNGY* |
| Ga0066903_1010963983 | 3300005764 | Tropical Forest Soil | MKAILAAFALVTLIATPTFAQSVPGAHWEQAALVSPSSPDFGDNGY* |
| Ga0066903_1022446981 | 3300005764 | Tropical Forest Soil | TWRSIMKAILAALALVTLIASPTFAQSYPGEQPEQTNVSPASPNFGDNGY* |
| Ga0066903_1062799832 | 3300005764 | Tropical Forest Soil | MKAILAALALVTLIATPTFAQSVPTGDLEQAALVSPSSPDFG |
| Ga0081455_100386074 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MKAFITALALLTMIAGPTFAQSVYSGEQPVAHNVSPSSSDFGDNGY* |
| Ga0081455_104254022 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MKAFIAALALVTLLTGPTFAQSAAYSHEHEPAHDVSPASPDFGDNGN* |
| Ga0081539_104624261 | 3300005985 | Tabebuia Heterophylla Rhizosphere | MKALITALALVTLIAGPTFAQSAAYSHEHEPAHDVSPANQDFGDNGN* |
| Ga0066665_110576623 | 3300006796 | Soil | KWRTNMKALIAALALVTLIASPSFAQSYPGEHVEQSNVSPASPNFGDNGY* |
| Ga0075428_1022470372 | 3300006844 | Populus Rhizosphere | LIAALALVTLIASPTFAQSYPNEQPEQTNVSPASPNFGDNGY* |
| Ga0075418_130529232 | 3300009100 | Populus Rhizosphere | MKALIAALALVTLIASPTFAQSYPNEQPEQTNVSPASP |
| Ga0126374_104067232 | 3300009792 | Tropical Forest Soil | MKALIAALALATLIASPTFAQSYPGEQPEQTNVSPASPNFGDNGY* |
| Ga0126374_108512291 | 3300009792 | Tropical Forest Soil | MKALIAALALVTLLAGPTFAQSYPGEQPEQTNVSPASPNFGDNGY* |
| Ga0126380_100718404 | 3300010043 | Tropical Forest Soil | MKAILAALALVTLIASPTFAQSYPGEQPEQTNVSPASPNFGDNGY* |
| Ga0126380_105676453 | 3300010043 | Tropical Forest Soil | MKALIAALALVTLIASPTFAQSYPGEQPEQTNVSPASPNFGDNGY* |
| Ga0126384_106014351 | 3300010046 | Tropical Forest Soil | GQSSATWRSIMKALIAALALVTLIASPSFAQSYPGEHQEQTNVSPASPNFGDNGY* |
| Ga0126384_111161082 | 3300010046 | Tropical Forest Soil | MKAFVAALALVTLLASPTFAQSYPGEHQEQTNVSPASPDFGDNGY* |
| Ga0127449_10810092 | 3300010117 | Grasslands Soil | MKALIAALALVTLIASPSFAQSYPGEHVEQSNVSPASPNFWDNGY* |
| Ga0127489_11336991 | 3300010127 | Grasslands Soil | AALALVTLIASPSFAQWYPGEHVEQSNVSPASPNFGNNGY* |
| Ga0126370_108590321 | 3300010358 | Tropical Forest Soil | MKALIAALALVTLIASPTFAQSYPGEHQEQTNVSPASPNFGDNGY* |
| Ga0126377_127496582 | 3300010362 | Tropical Forest Soil | MKALIAALALVTLIASPTFAQSYPGEQPEQINMSPASPNFGDNGY* |
| Ga0126379_135038711 | 3300010366 | Tropical Forest Soil | MKALIAAFALVTLIASPTFAQSYPGEHQEQTNVSPASPNFGDNGY* |
| Ga0126381_1024444641 | 3300010376 | Tropical Forest Soil | MKALIAALALVTLLASPTFAQSYPGEHQEQTNVSPASPDF |
| Ga0126383_107359072 | 3300010398 | Tropical Forest Soil | MKTLIAALALVTLLGNPTFAQSYPGEHQEQTPASPDFGDNGY* |
| Ga0137365_105051181 | 3300012201 | Vadose Zone Soil | MKALIAALALVTLIASPSFAQWYPGEQQADVSPASPNFGDNGY* |
| Ga0137374_103051372 | 3300012204 | Vadose Zone Soil | MKALIAAIALVTLIASPTFAQSYPNEQPEQTNVSPASPNFGDNGY* |
| Ga0137376_104604052 | 3300012208 | Vadose Zone Soil | MKALITALALVTLIASPSFAQSYPGEHVEQSNVSPASPNFGDNGY* |
| Ga0137387_108183441 | 3300012349 | Vadose Zone Soil | MKALIAALALVTLIASPTFAQSYPGELPEQTNVSPASPNFGDNGY* |
| Ga0137372_104952281 | 3300012350 | Vadose Zone Soil | MKALIAALALVTLIASPTLAQSYPNEQPEQTNVSPASPNFGDNGY* |
| Ga0137371_110603333 | 3300012356 | Vadose Zone Soil | LTWRTIMKALIAALALVTLIASPSFAQWYPGEHVEQSNVSPASPNFGDNGY* |
| Ga0137375_108238161 | 3300012360 | Vadose Zone Soil | MKALIAAIALVTLIASPTFAQSYPNEQPEQTNVSPASPNFG |
| Ga0137361_100890264 | 3300012362 | Vadose Zone Soil | MKALIAALALVTLIASPSFAQSYPGEHVEQSNVSPASPNFGDN |
| Ga0134029_11244841 | 3300012377 | Grasslands Soil | MKALIAALALVTLIARPSFAQSYPGEHVEQSNVSPASPNFGDNGY* |
| Ga0137413_116199821 | 3300012924 | Vadose Zone Soil | MKTLIAALALVTLIAGPTFAQSASTGEHQPVYNASPASPDFGDNGN* |
| Ga0126375_104411201 | 3300012948 | Tropical Forest Soil | MKALIAALALVTLIASPTFAQSYPGEQPEQTNMSPASPNFGDNGY* |
| Ga0134078_106444741 | 3300014157 | Grasslands Soil | MKALIAALALVTLIASPSFAPSYPGEHVEQSNVSPASPNFGD |
| Ga0134085_103363922 | 3300015359 | Grasslands Soil | MKALIAALALVTLIASPSFAPSYPGEHVEQSNVSPASPNFWDNGY* |
| Ga0132258_100317564 | 3300015371 | Arabidopsis Rhizosphere | MKALITALALVTLIASPSFAQSYPGEHQEQTNVSPASPNFGDNGY* |
| Ga0132255_1031050651 | 3300015374 | Arabidopsis Rhizosphere | MKAIFAALALVTLISSPTFAQSIPAGDLEQAALVSPSSPNFGDN |
| Ga0182036_111870671 | 3300016270 | Soil | MKALIAALALVTLIASPTFAQSYPGEQPEQTNVSPASPNFGDNGY |
| Ga0182033_112900401 | 3300016319 | Soil | KRPLTWRGAMKAILAALALVTLIATPTFAQSAPSAHWEQTNVSPSSPNFGDNGY |
| Ga0182034_118260141 | 3300016371 | Soil | MKAILAALALVTLIASPTFAQSVSTEHQTNVSPSSSDFGDNGY |
| Ga0182037_114541381 | 3300016404 | Soil | MKAILAALALVTLIASPTFAQSYPGEQPEQTNVSPA |
| Ga0184608_105323022 | 3300018028 | Groundwater Sediment | AALALVTLIAGPTFAQSAYTGEQQPVYNASPASPDFGDNGN |
| Ga0184611_12286912 | 3300018067 | Groundwater Sediment | MKALITALALLTLVAGPTFAQSVYSGEQGTAHNVSPSSSDFGDNGY |
| Ga0066655_100477432 | 3300018431 | Grasslands Soil | MKALIAALALVTLIASPSFAQWYPGEHVEQSNVSPASPNFGDNGY |
| Ga0066667_103197372 | 3300018433 | Grasslands Soil | MKALIAALALVTLIASPSFAQWYPGEQQANVSPASPNFGDNGY |
| Ga0066667_105625141 | 3300018433 | Grasslands Soil | MKALIAALALVTLIASPSFAQSYPGEHVEQSNVSPASPNFGDNGY |
| Ga0066662_100555492 | 3300018468 | Grasslands Soil | MKALIAALALVTLIASPSFAPSYPGEHVEQSNVSPASPNFGDNGY |
| Ga0066662_118058642 | 3300018468 | Grasslands Soil | MKALIAALALVTLIASPTLAQSYPGEQPEQTNVSPASPNFGDNGY |
| Ga0126371_121384931 | 3300021560 | Tropical Forest Soil | MKAILAALALVTLIASPTFAQSYPGEQPEQTNVSPASPSFGDNGY |
| Ga0209266_11594653 | 3300026327 | Soil | TWRTIMKALIAALALVTLIASPSFAQWYPGEHVEQSNVSPASPNFGDNGY |
| Ga0209378_12410541 | 3300026528 | Soil | MKALIAALALVTLIASPSFAQWYPGEHVEQSNVSPASPNF |
| Ga0209056_103850671 | 3300026538 | Soil | RNNMKALIAALALVTLIASPSFAQWYPGEQQANVSPASPNFGDNGY |
| Ga0208983_10540031 | 3300027381 | Forest Soil | MKALIAALALVTLIAGPTFAQSASTGEHQPVYNASPASPDFGDNGN |
| Ga0209106_11558392 | 3300027616 | Forest Soil | ALVTLIAGPTFAQSASTGEHQPVYNASPASPDFGDNGN |
| Ga0208990_10168095 | 3300027663 | Forest Soil | MKTLIAALALVTLIAGPTFAQSASTGEHQPVYNASPASPDFGDNGN |
| Ga0209465_102501921 | 3300027874 | Tropical Forest Soil | WRSIMKALIAALALVTLIASPTFAQSYPGEQPEQTNVSPASPNFGDNGY |
| Ga0209488_110936032 | 3300027903 | Vadose Zone Soil | MKALIAALALVTLIASPTFAQTAATDEPAVQTNVSPASPTFGDNGY |
| Ga0307285_100105382 | 3300028712 | Soil | MKALITALALLTLVAGPTFAQSVYSDEQGTAHNVSPSSSDFGDNGY |
| Ga0307289_102060151 | 3300028875 | Soil | MKALIAALALVTLIAGPTFAQSAYTGEQQPVYNASPASPDFGDNGN |
| Ga0307278_101016852 | 3300028878 | Soil | MKALIAALALVTLIASPTFAQSYPGEHQEQTNVSPASPNFGDNGY |
| Ga0318516_101673883 | 3300031543 | Soil | MKAILAALALVTLIASPTFAQSAPSAHWEQTNVSPSSPNFGDNGY |
| Ga0318541_104145342 | 3300031545 | Soil | MKAILAALALVTLIATPTFAQSAPSAHWEQTNVSPSSSNFGDNGY |
| Ga0318572_102185373 | 3300031681 | Soil | EGAMKAILAALALVTLIASPTFAQSAPSAHWEQTNVSPSSPNFGDNGY |
| Ga0318509_107144932 | 3300031768 | Soil | VTLIASPTFAQSAPSAHWEQTNVSPSSPNFGDNGY |
| Ga0318546_109157702 | 3300031771 | Soil | MKALIAALALVTLLASPTFAQSYSGEHQEQTNVSPASPDFGDNGY |
| Ga0306919_100621242 | 3300031879 | Soil | MKAILAALALVTLIATPTFAQSAPSAHWEQTNVSPSSPNFGDNGY |
| Ga0306925_100912965 | 3300031890 | Soil | FAALALVTLIASPTFAQSAPSAHWEQTNVSPSSPNFGDNGY |
| Ga0318522_100054661 | 3300031894 | Soil | MKAIFAALALVTLIASPTFAQSAPSAHWEQTNVSPSSPNFGDNGY |
| Ga0318551_108981971 | 3300031896 | Soil | WRGAMKAILAALALVTLIATPTFAQSAPSAHWEQTNVSPSSSNFGDNGY |
| Ga0310913_103349633 | 3300031945 | Soil | LALVTLIASPTFAQSAPSAHWEQTNVSPSSPNFGDNGY |
| Ga0310909_100919903 | 3300031947 | Soil | MKAILAALALVTLIATPTFAQSAPSAHWEQTNVSPSSS |
| Ga0310909_100975964 | 3300031947 | Soil | LVTLIATPTFAQSAPSAHWEQTNVSPSSSNFGDNGY |
| Ga0318556_101931111 | 3300032043 | Soil | MKAILAALALVTLIATPTFAQSAPSAHWEQTNVSPSSSNFGDNG |
| Ga0318575_103249522 | 3300032055 | Soil | MKAILAALALVTLIATPTFAQSAPSAHWEQTNVSPSSSNFGD |
| Ga0306920_1006045371 | 3300032261 | Soil | QSSVTWRSIMKAILAALALVTLIASPTFAQSYPGEQPEQTNVSPASPNFGDNGY |
| ⦗Top⦘ |