


| Basic Information | |
|---|---|
| Family ID | F102888 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 101 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MEPIVLFGIQFTLSLVAYLLIAFWYVVPRLSGLPRELAL |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 101 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 80.20 % |
| % of genes near scaffold ends (potentially truncated) | 94.06 % |
| % of genes from short scaffolds (< 2000 bps) | 94.06 % |
| Associated GOLD sequencing projects | 83 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.59 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (94.059 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (34.654 % of family members) |
| Environment Ontology (ENVO) | Unclassified (38.614 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (53.465 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 49.25% β-sheet: 0.00% Coil/Unstructured: 50.75% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 101 Family Scaffolds |
|---|---|---|
| PF12680 | SnoaL_2 | 5.94 |
| PF05368 | NmrA | 2.97 |
| PF01243 | Putative_PNPOx | 2.97 |
| PF01326 | PPDK_N | 2.97 |
| PF00270 | DEAD | 2.97 |
| PF01565 | FAD_binding_4 | 2.97 |
| PF01266 | DAO | 2.97 |
| PF07366 | SnoaL | 2.97 |
| PF08281 | Sigma70_r4_2 | 1.98 |
| PF13439 | Glyco_transf_4 | 1.98 |
| PF08327 | AHSA1 | 1.98 |
| PF12867 | DinB_2 | 1.98 |
| PF00891 | Methyltransf_2 | 0.99 |
| PF13592 | HTH_33 | 0.99 |
| PF09905 | VF530 | 0.99 |
| PF00903 | Glyoxalase | 0.99 |
| PF13602 | ADH_zinc_N_2 | 0.99 |
| PF00174 | Oxidored_molyb | 0.99 |
| PF02156 | Glyco_hydro_26 | 0.99 |
| PF08818 | DUF1801 | 0.99 |
| PF08450 | SGL | 0.99 |
| PF13401 | AAA_22 | 0.99 |
| PF13377 | Peripla_BP_3 | 0.99 |
| PF00356 | LacI | 0.99 |
| PF08031 | BBE | 0.99 |
| PF08020 | DUF1706 | 0.99 |
| PF12852 | Cupin_6 | 0.99 |
| PF01074 | Glyco_hydro_38N | 0.99 |
| PF13416 | SBP_bac_8 | 0.99 |
| PF00296 | Bac_luciferase | 0.99 |
| PF00303 | Thymidylat_synt | 0.99 |
| PF01022 | HTH_5 | 0.99 |
| PF01176 | eIF-1a | 0.99 |
| PF00069 | Pkinase | 0.99 |
| PF12697 | Abhydrolase_6 | 0.99 |
| PF07690 | MFS_1 | 0.99 |
| PF03466 | LysR_substrate | 0.99 |
| PF03029 | ATP_bind_1 | 0.99 |
| PF13567 | DUF4131 | 0.99 |
| PF04377 | ATE_C | 0.99 |
| COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.96 |
| COG0574 | Phosphoenolpyruvate synthase/pyruvate phosphate dikinase | Carbohydrate transport and metabolism [G] | 2.97 |
| COG0207 | Thymidylate synthase | Nucleotide transport and metabolism [F] | 0.99 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.99 |
| COG0361 | Translation initiation factor IF-1 | Translation, ribosomal structure and biogenesis [J] | 0.99 |
| COG0383 | Alpha-mannosidase | Carbohydrate transport and metabolism [G] | 0.99 |
| COG1100 | GTPase SAR1 family domain | General function prediction only [R] | 0.99 |
| COG2041 | Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductases | Energy production and conversion [C] | 0.99 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.99 |
| COG2229 | Signal recognition particle receptor subunit beta, a GTPase | Intracellular trafficking, secretion, and vesicular transport [U] | 0.99 |
| COG2935 | Arginyl-tRNA--protein-N-Asp/Glu arginylyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 0.99 |
| COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 0.99 |
| COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 0.99 |
| COG3915 | Uncharacterized conserved protein | Function unknown [S] | 0.99 |
| COG4124 | Beta-mannanase | Carbohydrate transport and metabolism [G] | 0.99 |
| COG4283 | Uncharacterized conserved protein DfsB/IRC4, DUF1706 (PF08020) domain | General function prediction only [R] | 0.99 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.99 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.99 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.99 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 94.06 % |
| Unclassified | root | N/A | 5.94 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459002|FZY7DQ102IYIGX | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300000878|AL9A1W_1124647 | Not Available | 1374 | Open in IMG/M |
| 3300001334|A2165W6_1345151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 506 | Open in IMG/M |
| 3300005186|Ga0066676_10633402 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300005435|Ga0070714_101430124 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300005435|Ga0070714_102454497 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300005536|Ga0070697_100507215 | All Organisms → cellular organisms → Bacteria | 1055 | Open in IMG/M |
| 3300005559|Ga0066700_10152928 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1564 | Open in IMG/M |
| 3300005561|Ga0066699_10773660 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300005574|Ga0066694_10209231 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
| 3300005576|Ga0066708_10195859 | All Organisms → cellular organisms → Bacteria | 1265 | Open in IMG/M |
| 3300005598|Ga0066706_10750872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 773 | Open in IMG/M |
| 3300006050|Ga0075028_100748132 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300006797|Ga0066659_10998265 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300006806|Ga0079220_10918762 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300006844|Ga0075428_100281340 | All Organisms → cellular organisms → Bacteria | 1790 | Open in IMG/M |
| 3300006847|Ga0075431_100406216 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1363 | Open in IMG/M |
| 3300006880|Ga0075429_101674760 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300006914|Ga0075436_100351419 | All Organisms → cellular organisms → Bacteria | 1062 | Open in IMG/M |
| 3300007255|Ga0099791_10173942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1011 | Open in IMG/M |
| 3300007265|Ga0099794_10141225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1220 | Open in IMG/M |
| 3300009038|Ga0099829_11412686 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 575 | Open in IMG/M |
| 3300009088|Ga0099830_10307509 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1267 | Open in IMG/M |
| 3300009088|Ga0099830_10372832 | All Organisms → cellular organisms → Bacteria | 1151 | Open in IMG/M |
| 3300009088|Ga0099830_10510832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 981 | Open in IMG/M |
| 3300009089|Ga0099828_10631462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 963 | Open in IMG/M |
| 3300009090|Ga0099827_10506683 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria | 1037 | Open in IMG/M |
| 3300009090|Ga0099827_11748591 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 542 | Open in IMG/M |
| 3300009094|Ga0111539_12162489 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 645 | Open in IMG/M |
| 3300009147|Ga0114129_10194151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2754 | Open in IMG/M |
| 3300009147|Ga0114129_11021431 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
| 3300009148|Ga0105243_10419842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium | 1247 | Open in IMG/M |
| 3300010046|Ga0126384_11034684 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Psychromicrobium → Psychromicrobium silvestre | 749 | Open in IMG/M |
| 3300010303|Ga0134082_10014740 | All Organisms → cellular organisms → Bacteria | 2835 | Open in IMG/M |
| 3300010335|Ga0134063_10411203 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300010359|Ga0126376_12528708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Psychromicrobium → Psychromicrobium silvestre | 561 | Open in IMG/M |
| 3300010362|Ga0126377_11070358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Psychromicrobium → Psychromicrobium silvestre | 874 | Open in IMG/M |
| 3300010376|Ga0126381_102409251 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 755 | Open in IMG/M |
| 3300010398|Ga0126383_12164691 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 643 | Open in IMG/M |
| 3300011269|Ga0137392_10480843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1031 | Open in IMG/M |
| 3300011269|Ga0137392_10614405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 902 | Open in IMG/M |
| 3300012003|Ga0120163_1046722 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1068 | Open in IMG/M |
| 3300012096|Ga0137389_10417031 | All Organisms → cellular organisms → Bacteria | 1147 | Open in IMG/M |
| 3300012199|Ga0137383_10352639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1078 | Open in IMG/M |
| 3300012202|Ga0137363_10322954 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1272 | Open in IMG/M |
| 3300012203|Ga0137399_11562513 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 547 | Open in IMG/M |
| 3300012204|Ga0137374_10245225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1506 | Open in IMG/M |
| 3300012208|Ga0137376_10559886 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 990 | Open in IMG/M |
| 3300012208|Ga0137376_11573489 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300012210|Ga0137378_10024208 | All Organisms → cellular organisms → Bacteria | 5348 | Open in IMG/M |
| 3300012211|Ga0137377_11102720 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 724 | Open in IMG/M |
| 3300012285|Ga0137370_10409698 | Not Available | 822 | Open in IMG/M |
| 3300012351|Ga0137386_10421195 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 961 | Open in IMG/M |
| 3300012362|Ga0137361_11270131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 660 | Open in IMG/M |
| 3300012917|Ga0137395_10418776 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 960 | Open in IMG/M |
| 3300012918|Ga0137396_10218248 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1404 | Open in IMG/M |
| 3300012918|Ga0137396_10283587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1224 | Open in IMG/M |
| 3300012923|Ga0137359_10943609 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 742 | Open in IMG/M |
| 3300012924|Ga0137413_10185327 | All Organisms → cellular organisms → Bacteria | 1388 | Open in IMG/M |
| 3300012929|Ga0137404_11711880 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300012975|Ga0134110_10068713 | All Organisms → cellular organisms → Bacteria | 1409 | Open in IMG/M |
| 3300013296|Ga0157374_12128819 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 588 | Open in IMG/M |
| 3300013296|Ga0157374_12638837 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300013308|Ga0157375_12121852 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 669 | Open in IMG/M |
| 3300013765|Ga0120172_1093100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 736 | Open in IMG/M |
| 3300014157|Ga0134078_10073180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Nostocaceae → Nostoc → unclassified Nostoc → Nostoc sp. 'Peltigera membranacea cyanobiont' N6 | 1234 | Open in IMG/M |
| 3300015359|Ga0134085_10559405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 528 | Open in IMG/M |
| 3300015373|Ga0132257_100908616 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1104 | Open in IMG/M |
| 3300018431|Ga0066655_10232433 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1164 | Open in IMG/M |
| 3300018465|Ga0190269_11810292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Psychromicrobium → Psychromicrobium silvestre | 521 | Open in IMG/M |
| 3300018468|Ga0066662_10268539 | All Organisms → cellular organisms → Bacteria | 1408 | Open in IMG/M |
| 3300020001|Ga0193731_1002816 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 4518 | Open in IMG/M |
| 3300021080|Ga0210382_10092648 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1250 | Open in IMG/M |
| 3300021861|Ga0213853_11023585 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1149 | Open in IMG/M |
| 3300022195|Ga0222625_1266376 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300025929|Ga0207664_11780872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Psychromicrobium → Psychromicrobium silvestre | 538 | Open in IMG/M |
| 3300026023|Ga0207677_11188277 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 698 | Open in IMG/M |
| 3300026088|Ga0207641_11552276 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 664 | Open in IMG/M |
| 3300026297|Ga0209237_1206067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 625 | Open in IMG/M |
| 3300026298|Ga0209236_1059868 | All Organisms → cellular organisms → Bacteria | 1854 | Open in IMG/M |
| 3300026310|Ga0209239_1010430 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4947 | Open in IMG/M |
| 3300026310|Ga0209239_1062366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis echigonensis | 1648 | Open in IMG/M |
| 3300026313|Ga0209761_1075701 | All Organisms → cellular organisms → Bacteria | 1765 | Open in IMG/M |
| 3300026542|Ga0209805_1380171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 541 | Open in IMG/M |
| 3300027671|Ga0209588_1261946 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300027674|Ga0209118_1009314 | All Organisms → cellular organisms → Bacteria | 3415 | Open in IMG/M |
| 3300027681|Ga0208991_1237677 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 519 | Open in IMG/M |
| 3300027748|Ga0209689_1094987 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1551 | Open in IMG/M |
| 3300027875|Ga0209283_10217034 | All Organisms → cellular organisms → Bacteria | 1270 | Open in IMG/M |
| 3300027882|Ga0209590_10427733 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 855 | Open in IMG/M |
| 3300027882|Ga0209590_10497780 | Not Available | 787 | Open in IMG/M |
| 3300027882|Ga0209590_10616560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 697 | Open in IMG/M |
| 3300027903|Ga0209488_10118314 | All Organisms → cellular organisms → Bacteria | 1993 | Open in IMG/M |
| 3300028711|Ga0307293_10087574 | All Organisms → cellular organisms → Bacteria | 984 | Open in IMG/M |
| 3300028754|Ga0307297_10019887 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1883 | Open in IMG/M |
| 3300028789|Ga0302232_10299011 | Not Available | 795 | Open in IMG/M |
| 3300028803|Ga0307281_10192249 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 732 | Open in IMG/M |
| 3300028884|Ga0307308_10407760 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300030399|Ga0311353_10755063 | Not Available | 834 | Open in IMG/M |
| 3300030520|Ga0311372_11349013 | Not Available | 895 | Open in IMG/M |
| 3300031781|Ga0318547_10476622 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 770 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 34.65% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.91% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 6.93% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.94% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.95% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.95% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 3.96% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 2.97% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.97% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.98% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.98% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.99% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.99% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.99% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.99% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.99% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.99% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.99% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.99% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.99% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459002 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 direct MP BIO 1O1 lysis 0-21 cm | Environmental | Open in IMG/M |
| 3300000878 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-5 cm-9A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001334 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A21-65cm)- 6 month illumina | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012003 | Permafrost microbial communities from Nunavut, Canada - A20_80cm_0.25M | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013765 | Permafrost microbial communities from Nunavut, Canada - A30_80cm_6M | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020001 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2 | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022195 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028754 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157 | Environmental | Open in IMG/M |
| 3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E1_09107810 | 2170459002 | Grass Soil | VKPIVLFSIQFSLSLVAYALVAAWYVVPRLSGRPRETA |
| AL9A1W_11246472 | 3300000878 | Permafrost | MPPIVLFGIQFTFCLAAYALFAWWYGASRLSRLPREVALVPLVWIHV |
| A2165W6_13451511 | 3300001334 | Permafrost | MAPIVLFGIQFTFSLVAYALIAWWYGAPRLAKLPPEVALVPLVWIHA |
| Ga0066676_106334021 | 3300005186 | Soil | VKPIVLFSIQFSLSLVAYSLIAAWYVVPRLSERPRETALQPPLWVHAFRVAGGA |
| Ga0070714_1014301242 | 3300005435 | Agricultural Soil | MKPILLFGTQFTLSLVAYALLGLWYAVPRLSGLSRQAALQ |
| Ga0070714_1024544971 | 3300005435 | Agricultural Soil | MKPIVLFSLQFTLSLAAYALIAAWYVIPRLSGKPREAALQPLV |
| Ga0070697_1005072151 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MAPIVLFGIQFTLSLAAYALIAWWYVSPRLARLPREAALVPLVWIHAFRI |
| Ga0066700_101529284 | 3300005559 | Soil | MEPVVLFGIQFTLSLAAYALIGFWYVVPRLSRLPREMALPPLLWIH |
| Ga0066699_107736601 | 3300005561 | Soil | MEPMVLFGIQFTLSLLAYLLIAFWYVAPRLSRLPREVALV |
| Ga0066694_102092312 | 3300005574 | Soil | MAPIVLFGIQFTFCLVAYSLIAWWYGLPRLSALPRAAALVPLVWIHVF |
| Ga0066708_101958592 | 3300005576 | Soil | MPPIALFGIQFTLALVAYALIAWWYVSPRLAGLRPE |
| Ga0066706_107508721 | 3300005598 | Soil | MIEPIVLFGIQFTFALIVYALAARSYAVPRLRRIPP |
| Ga0075028_1007481322 | 3300006050 | Watersheds | VPPIVLFGIQFTFCLAAYALIAWWYGAPRLSRLPREVALVPLVWIHAFR |
| Ga0066659_109982653 | 3300006797 | Soil | MIEPIVLFGIQFTFALIVYALAARWYAVPRLRRVPPAAALV |
| Ga0079220_109187622 | 3300006806 | Agricultural Soil | MKPIALFSIQFTLSLVAYALIAAWYVIPRLSGKPRNI |
| Ga0075428_1002813402 | 3300006844 | Populus Rhizosphere | MAPIVLFSIQFTMSVVAYKWYVQPRLSLLPRDEALAPLLWVR* |
| Ga0075431_1004062164 | 3300006847 | Populus Rhizosphere | VIEPIVLFGIQFTLSLVAYALIARWHVWPRLFPLPRAIA |
| Ga0075429_1016747601 | 3300006880 | Populus Rhizosphere | MGPVVLFGIQFTLSLAAYLLIAFWYVAPHLSKLPLE |
| Ga0075436_1003514192 | 3300006914 | Populus Rhizosphere | MQPIVLFGIQFTFSLVAYALAAWWYLAPRLARLPREL |
| Ga0099791_101739423 | 3300007255 | Vadose Zone Soil | MEPVVLFGIQFTLALVAYALIGFWYVSPRLSALPREVAL |
| Ga0099794_101412251 | 3300007265 | Vadose Zone Soil | MEPIVLFGIQFTFALVAYAVAAWWYLAPRLARLPREAALV |
| Ga0099829_114126862 | 3300009038 | Vadose Zone Soil | MDPIVLFGIQFTLSLVAYTLIAFWYVVPRLSGLPR |
| Ga0099830_103075091 | 3300009088 | Vadose Zone Soil | MPPIVLFGIQFTFSLIAYALIAWWYVAPRLSRLPREAA |
| Ga0099830_103728321 | 3300009088 | Vadose Zone Soil | MQPIVLFGLQFTFSLVAYALAAWWYLVPRLARLPREIA |
| Ga0099830_105108323 | 3300009088 | Vadose Zone Soil | MAPIVLFGIQFTFSLAAYALLAWWYLVPRLARLPRELALVPLVWI |
| Ga0099828_106314621 | 3300009089 | Vadose Zone Soil | MAPIVLFGIQFTFSLAAYALLAWWYLVPRLARLPRELALVPL |
| Ga0099827_105066831 | 3300009090 | Vadose Zone Soil | MEPTVLFGIQFTLSLVAYTLIAFWYVVPRLSGLPRGEAVMPLL |
| Ga0099827_117485911 | 3300009090 | Vadose Zone Soil | MEPVVIFGIQFSLSLVAYALIATWYGVPRLSRLPRDLALMPLL |
| Ga0111539_121624891 | 3300009094 | Populus Rhizosphere | MIEPIVLFGIQFTFALIAYALAARWYVVPRLRQLPLLVALVP |
| Ga0114129_101941516 | 3300009147 | Populus Rhizosphere | MEPLVLFGIQFTLSLVIYGLVGFWYVAPRISKLPREA |
| Ga0114129_110214311 | 3300009147 | Populus Rhizosphere | MEPIVLFGIQFTLSLVAYSLVAFWYVAPRLSGLPPEL |
| Ga0105243_104198421 | 3300009148 | Miscanthus Rhizosphere | MEPIILFGLQFTLSLVAYALIAFWYVAPRLSKLPREAAL |
| Ga0126384_110346841 | 3300010046 | Tropical Forest Soil | VLFSIQFSLSLLAYALIAAWYVVPRLSRWPRETALQPLLWVH |
| Ga0134082_100147401 | 3300010303 | Grasslands Soil | MPPIALFGIQFTLALVAYALIAWWYVSPRLAGLRPEKALVPLVW |
| Ga0134063_104112032 | 3300010335 | Grasslands Soil | MEPIVLFSIQFTFFLAAYAVAAWWYVEPRLARLPRELALVP |
| Ga0126376_125287081 | 3300010359 | Tropical Forest Soil | VKPIVLFSIQFSLSLVAYALIAAWYVVPRLSGRPREAALQPL |
| Ga0126377_110703583 | 3300010362 | Tropical Forest Soil | VLFSIQFSLSLLAYALIAAWYVVPRLSERPREAALQ |
| Ga0126381_1024092511 | 3300010376 | Tropical Forest Soil | MEPIVLFGLQFTLSLVAYALLAFWYVVPRLSTLPR |
| Ga0126383_121646911 | 3300010398 | Tropical Forest Soil | MSAISLFGIQFTLSLIGYALAAWWYLAPRLARMPRRDALQPLL |
| Ga0137392_104808432 | 3300011269 | Vadose Zone Soil | MPPIVLFGIQFTFSLVAYALIAWWYAAPRLFRLPREVALVPLVWIH |
| Ga0137392_106144052 | 3300011269 | Vadose Zone Soil | MPPIVLFGIQFTFSLVAYALIAWWYGAPRLSRPPR |
| Ga0120163_10467221 | 3300012003 | Permafrost | MAPIVLFGIQFTFSLVAYALIAWWYGSPRLSRLPRELALVPLLWI |
| Ga0137389_104170313 | 3300012096 | Vadose Zone Soil | MEPIVLFGIQFTFALVAYAVAAWWYLVPRLARLPREAALVPLVW |
| Ga0137383_103526392 | 3300012199 | Vadose Zone Soil | MEPIALFGIQFTMSLVAYALIAFWYVVPRLSSLPREV |
| Ga0137363_103229541 | 3300012202 | Vadose Zone Soil | MEPIVLFGIQFTFALVAYAVAAWWYLAPRLARLPR |
| Ga0137399_115625131 | 3300012203 | Vadose Zone Soil | MEPIVLFGIQFTFSLVAYALIAWWYGAPRLARLPREAALVPL |
| Ga0137374_102452253 | 3300012204 | Vadose Zone Soil | MGPIVLFGIQFTLSLVAYLLIAFWYVAPRLSKLPQEAVLEV |
| Ga0137376_105598861 | 3300012208 | Vadose Zone Soil | MEPIVLFGIQFTLSLVAYLLIAFWYVVPRLSLLPRELA |
| Ga0137376_115734892 | 3300012208 | Vadose Zone Soil | MPPIVLFGIQFTVSLIAYALIAWWYGAPRLARLPREAALVPLVWIHVFRIV |
| Ga0137378_100242086 | 3300012210 | Vadose Zone Soil | MEPIVLFSIQFTLSLVAYAFIGFWYVAPRLSGLPRDLVASR* |
| Ga0137377_111027201 | 3300012211 | Vadose Zone Soil | MEPIVLFGIQFTLSLVAYALIGFWYVAPRLSRLSR |
| Ga0137370_104096981 | 3300012285 | Vadose Zone Soil | MKPFVLFGIQFTFSLVAYGLAAWWYLVPRLARLPREVALVPLVW |
| Ga0137386_104211951 | 3300012351 | Vadose Zone Soil | MAPIVLFGIQFTFSLVIYAVIGWWYGVPRLSRLPRELALIP |
| Ga0137361_112701311 | 3300012362 | Vadose Zone Soil | MAPIVLFGIQFTFFLVAYAVAAWWYIAPRLARLPREAALVPLV* |
| Ga0137395_104187762 | 3300012917 | Vadose Zone Soil | MEPIVLFGIQFTFALVAYAVAAWWYLAPRLARLPREAALVPLVWI |
| Ga0137396_102182481 | 3300012918 | Vadose Zone Soil | MEPIVLFSIQFTLSLLAYLFIAFWYVVPRLSRLPRE |
| Ga0137396_102835873 | 3300012918 | Vadose Zone Soil | MEPIVLFSIQFTFALVAYAVAAWWYLAPRLARLPRGAAL |
| Ga0137359_109436091 | 3300012923 | Vadose Zone Soil | MEPIVLFGIQFTFSLVAYALGAWWYLAPRLARLPREVALVPLVWVHV |
| Ga0137413_101853272 | 3300012924 | Vadose Zone Soil | MAPIVLFGIQFTVSLIAYALIAWWYGAPRLARLPREAALVPLVWIH |
| Ga0137404_117118802 | 3300012929 | Vadose Zone Soil | MAPIVVFGIQFTVSLIAYALIAWWYGAPRLARLPREAALVPLVWIHVFRIV |
| Ga0134110_100687131 | 3300012975 | Grasslands Soil | MEPIVLFGIQFTLSLLAYLLIAFWYVVPRLSGLPRQLALVP |
| Ga0157374_121288191 | 3300013296 | Miscanthus Rhizosphere | MEPIVLFSIQFTLSLVVYLLSGFWYVAPRLLGLSRAAALAPLL |
| Ga0157374_126388371 | 3300013296 | Miscanthus Rhizosphere | MDPFILFGIQFTLSLVGYALVAAWYLEPRLSRMPSAL |
| Ga0157375_121218522 | 3300013308 | Miscanthus Rhizosphere | MTPIVLFSIQFTLSLFSYMLIAAWYVWPRLRNQQRELAL |
| Ga0120172_10931002 | 3300013765 | Permafrost | MEPIVLFGVQFTLSLVAYSLIAFWYVAPRLSGLPRE |
| Ga0134078_100731802 | 3300014157 | Grasslands Soil | MEPIVLFGIQFTLSLLAYLLIAFWYVVPRLSGLPRELALVP |
| Ga0134085_105594051 | 3300015359 | Grasslands Soil | MEPIVLFGIQFTLSLLAFLLIAFWYVVPRLAGLPR |
| Ga0132257_1009086161 | 3300015373 | Arabidopsis Rhizosphere | MIEPIVLFGIQFTFALIAYALAAHWYVVPRLRQLPL |
| Ga0066655_102324333 | 3300018431 | Grasslands Soil | MEPIVLFGVQFTLSLVAYLLIAFWLVPRLSVLPRELAL |
| Ga0190269_118102921 | 3300018465 | Soil | VKPMVLFSIQFTLSLVAYALIAAWYVVPRLSGRPREAAPQPLVWVHAF |
| Ga0066662_102685392 | 3300018468 | Grasslands Soil | MEPIVLFGIQFTLSLLAYLLIAFWYVVPRLSGLPRELALVPLLW |
| Ga0193731_10028168 | 3300020001 | Soil | MEPVVIFGIQFTLSLLAYALIAAWYAVPRLSRLPRD |
| Ga0210382_100926482 | 3300021080 | Groundwater Sediment | MIEPIVLFGIRFTLSLAAYALIALWYVRPRLSRLP |
| Ga0213853_110235851 | 3300021861 | Watersheds | SVQFTLSLVVYGLSAAWYVAPRLSTLPRELALVPLVNLWAGGRCR |
| Ga0222625_12663761 | 3300022195 | Groundwater Sediment | MKPIVLFGIQFTLSLVAYSLIAFWYVAPHLSALPRELALARYPNQPHSDL |
| Ga0207664_117808722 | 3300025929 | Agricultural Soil | VTPMVLFSIQFSLSLVAYTLIAAWYVVPRLSERPRETALQPLLWV |
| Ga0207677_111882772 | 3300026023 | Miscanthus Rhizosphere | MIEPIALFGIQFTLSLAVYGLIALWYVTPRLSRLP |
| Ga0207641_115522761 | 3300026088 | Switchgrass Rhizosphere | MEPIVLFGIQFTLSLVAYALIAFWYIRPRLSRLPLEAALVP |
| Ga0209237_12060672 | 3300026297 | Grasslands Soil | MEPIVLFGIQFTLSLLAYLLIAFWYVVPRLSLLPREL |
| Ga0209236_10598681 | 3300026298 | Grasslands Soil | MAPIVLFAIQFTFSLGAYALLAWWYLAPRLAKLPREVALVPLIWIHTFRIAGA |
| Ga0209239_10104301 | 3300026310 | Grasslands Soil | MAPIVLFGIQFTFALVVYALVAWWYVAPRLLGMPREAALVPLVWVHV |
| Ga0209239_10623663 | 3300026310 | Grasslands Soil | MEPIVLFSIQFTFFLAAYAVAAWWYVEPRLARLPRE |
| Ga0209761_10757014 | 3300026313 | Grasslands Soil | MEPIVLFGTQFTLSLAAYAFIAFWDFRVARRLNGA |
| Ga0209805_13801711 | 3300026542 | Soil | MEPIVLFGIQFTLSLVAYLLIAFWYVVPRLSLLLRELALVP |
| Ga0209588_12619462 | 3300027671 | Vadose Zone Soil | MEPIVLFGIQFTFSLVAYALIAWWYGAPRLARLPREAALVPLVWIHAFRIVG |
| Ga0209118_10093141 | 3300027674 | Forest Soil | MEPIVLFGIQFTLSLVAYLLIAFWYVVPRLSGLPRELAL |
| Ga0208991_12376771 | 3300027681 | Forest Soil | MPPIVLFGLQFTFCLVAYALIAWWYGAPRLSKLPRG |
| Ga0209689_10949871 | 3300027748 | Soil | MEPVVLFGIQFTLSLAAYALIGFWYVVPRLSRLPREMALP |
| Ga0209283_102170342 | 3300027875 | Vadose Zone Soil | MEPIVLFSIQFTLSLLAYLLIAFWYIVPRLSRLPRELALVPL |
| Ga0209590_104277334 | 3300027882 | Vadose Zone Soil | MEPIVLFGIQFTFFLVAYSLIAWWYGVPRLARLPREAALVPLVWIHA |
| Ga0209590_104977801 | 3300027882 | Vadose Zone Soil | MKPIALFGAQFTLCLVAYALIAAWYVVPRLAKRAREDAVVPLL |
| Ga0209590_106165603 | 3300027882 | Vadose Zone Soil | MEPIVLFGIQFTFSLVAYAVAAWWYLAPRLVRLPREVAL |
| Ga0209488_101183142 | 3300027903 | Vadose Zone Soil | MEPIVLFGIQFTLSLLAYLLIAFWYVVPRLSRLPRDHVGNRGR |
| Ga0307293_100875742 | 3300028711 | Soil | MEPIVLFGIQFMLSLVAYWLIAFWYVAPRLSGLPPE |
| Ga0307297_100198871 | 3300028754 | Soil | MIEPIALFGIQFTLSLAAYALIALWYVTPRLSRLPL |
| Ga0302232_102990112 | 3300028789 | Palsa | LKPILLFGTQFTLSLVAYALLGLWYAVPRLSGRPRQAALQPLVWV |
| Ga0307281_101922491 | 3300028803 | Soil | MIEPIVLFGIQFTLSLAAYALIALWYVRPRLSRLPL |
| Ga0307308_104077602 | 3300028884 | Soil | MDPIPLFAIQFTLSLVAYALIAFWYVAPRLAGIPRELAL |
| Ga0311353_107550632 | 3300030399 | Palsa | LKPILLFGTQFTLSLVAYALLGLWYAVPRLSGRPRQAALQPLVWVH |
| Ga0311372_113490131 | 3300030520 | Palsa | LKPILLFGTQFTLSLVAYALLGLWYAVPRLSGRPRQAALQPL |
| Ga0318547_104766222 | 3300031781 | Soil | MKPIVLFSIQFTLSLAAYALIAAWYVIPRLSRKPREAALQTRSGSTPSG |
| ⦗Top⦘ |