


| Basic Information | |
|---|---|
| Family ID | F102823 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 101 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MSALYDWIIVGAGLAIGKLLVAIAVITVVTAILAVFFIIEEKTK |
| Number of Associated Samples | 55 |
| Number of Associated Scaffolds | 101 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 86.14 % |
| % of genes near scaffold ends (potentially truncated) | 14.85 % |
| % of genes from short scaffolds (< 2000 bps) | 64.36 % |
| Associated GOLD sequencing projects | 46 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.56 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (64.356 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake (39.604 % of family members) |
| Environment Ontology (ENVO) | Unclassified (76.238 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (79.208 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 58.33% β-sheet: 0.00% Coil/Unstructured: 41.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 101 Family Scaffolds |
|---|---|---|
| PF01075 | Glyco_transf_9 | 15.84 |
| PF00145 | DNA_methylase | 8.91 |
| PF13640 | 2OG-FeII_Oxy_3 | 8.91 |
| PF01555 | N6_N4_Mtase | 3.96 |
| PF03796 | DnaB_C | 1.98 |
| PF10544 | T5orf172 | 1.98 |
| PF08279 | HTH_11 | 0.99 |
| PF03237 | Terminase_6N | 0.99 |
| PF09374 | PG_binding_3 | 0.99 |
| PF13578 | Methyltransf_24 | 0.99 |
| PF11645 | PDDEXK_5 | 0.99 |
| PF12705 | PDDEXK_1 | 0.99 |
| COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
|---|---|---|---|
| COG0859 | ADP-heptose:LPS heptosyltransferase | Cell wall/membrane/envelope biogenesis [M] | 15.84 |
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 8.91 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 3.96 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 3.96 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 3.96 |
| COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 1.98 |
| COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 1.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 64.36 % |
| All Organisms | root | All Organisms | 35.64 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002408|B570J29032_109956817 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 8784 | Open in IMG/M |
| 3300005525|Ga0068877_10218150 | Not Available | 1134 | Open in IMG/M |
| 3300005581|Ga0049081_10120120 | Not Available | 972 | Open in IMG/M |
| 3300005805|Ga0079957_1238187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Chroococcales → Microcystaceae → Microcystis → Microcystis aeruginosa | 852 | Open in IMG/M |
| 3300006805|Ga0075464_10028070 | All Organisms → Viruses → Predicted Viral | 2976 | Open in IMG/M |
| 3300006805|Ga0075464_10030639 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2867 | Open in IMG/M |
| 3300006805|Ga0075464_10202388 | Not Available | 1180 | Open in IMG/M |
| 3300006805|Ga0075464_10310222 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
| 3300006805|Ga0075464_10392512 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 843 | Open in IMG/M |
| 3300006805|Ga0075464_10410333 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300006805|Ga0075464_10450527 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Flavonifractor → environmental samples → uncultured Flavonifractor sp. | 785 | Open in IMG/M |
| 3300008962|Ga0104242_1088070 | Not Available | 515 | Open in IMG/M |
| 3300009068|Ga0114973_10005649 | All Organisms → cellular organisms → Bacteria | 8490 | Open in IMG/M |
| 3300009068|Ga0114973_10219654 | Not Available | 1033 | Open in IMG/M |
| 3300009152|Ga0114980_10003252 | Not Available | 11189 | Open in IMG/M |
| 3300009152|Ga0114980_10044232 | Not Available | 2718 | Open in IMG/M |
| 3300009152|Ga0114980_10217915 | Not Available | 1120 | Open in IMG/M |
| 3300009152|Ga0114980_10631353 | Not Available | 603 | Open in IMG/M |
| 3300009154|Ga0114963_10152388 | All Organisms → Viruses → Predicted Viral | 1371 | Open in IMG/M |
| 3300009155|Ga0114968_10001447 | Not Available | 18183 | Open in IMG/M |
| 3300009155|Ga0114968_10538613 | Not Available | 623 | Open in IMG/M |
| 3300009155|Ga0114968_10609550 | Not Available | 577 | Open in IMG/M |
| 3300009155|Ga0114968_10770952 | Not Available | 501 | Open in IMG/M |
| 3300009158|Ga0114977_10108555 | Not Available | 1679 | Open in IMG/M |
| 3300009159|Ga0114978_10404905 | Not Available | 816 | Open in IMG/M |
| 3300009159|Ga0114978_10636813 | Not Available | 613 | Open in IMG/M |
| 3300009160|Ga0114981_10108445 | Not Available | 1539 | Open in IMG/M |
| 3300009160|Ga0114981_10274327 | Not Available | 917 | Open in IMG/M |
| 3300009160|Ga0114981_10686891 | Not Available | 542 | Open in IMG/M |
| 3300009161|Ga0114966_10351693 | Not Available | 875 | Open in IMG/M |
| 3300009163|Ga0114970_10017192 | All Organisms → Viruses → Predicted Viral | 4938 | Open in IMG/M |
| 3300009163|Ga0114970_10023687 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4136 | Open in IMG/M |
| 3300009180|Ga0114979_10517428 | Not Available | 688 | Open in IMG/M |
| 3300009183|Ga0114974_10558825 | Not Available | 635 | Open in IMG/M |
| 3300010160|Ga0114967_10017656 | All Organisms → cellular organisms → Bacteria | 5103 | Open in IMG/M |
| 3300010334|Ga0136644_10002101 | All Organisms → cellular organisms → Bacteria | 15388 | Open in IMG/M |
| 3300010354|Ga0129333_10991020 | Not Available | 707 | Open in IMG/M |
| 3300010354|Ga0129333_11224350 | Not Available | 623 | Open in IMG/M |
| 3300010370|Ga0129336_10543811 | Not Available | 623 | Open in IMG/M |
| 3300010885|Ga0133913_12361776 | Not Available | 1303 | Open in IMG/M |
| 3300010885|Ga0133913_13494925 | Not Available | 1025 | Open in IMG/M |
| 3300012000|Ga0119951_1111699 | Not Available | 638 | Open in IMG/M |
| 3300013006|Ga0164294_10030920 | Not Available | 4287 | Open in IMG/M |
| 3300013006|Ga0164294_10055556 | All Organisms → cellular organisms → Bacteria | 3053 | Open in IMG/M |
| 3300013006|Ga0164294_10793584 | Not Available | 638 | Open in IMG/M |
| 3300013372|Ga0177922_10411652 | Not Available | 804 | Open in IMG/M |
| 3300014050|Ga0119952_1095121 | Not Available | 706 | Open in IMG/M |
| 3300017766|Ga0181343_1108134 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 787 | Open in IMG/M |
| 3300017774|Ga0181358_1118988 | Not Available | 930 | Open in IMG/M |
| 3300017778|Ga0181349_1237766 | Not Available | 613 | Open in IMG/M |
| 3300017785|Ga0181355_1118528 | Not Available | 1085 | Open in IMG/M |
| 3300019784|Ga0181359_1074850 | Not Available | 1277 | Open in IMG/M |
| 3300020533|Ga0208364_1003382 | All Organisms → Viruses → Predicted Viral | 2863 | Open in IMG/M |
| 3300021961|Ga0222714_10396107 | Not Available | 730 | Open in IMG/M |
| 3300021962|Ga0222713_10327359 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Hymenobacteraceae | 966 | Open in IMG/M |
| 3300021963|Ga0222712_10001710 | All Organisms → cellular organisms → Bacteria | 26479 | Open in IMG/M |
| 3300021963|Ga0222712_10004267 | All Organisms → cellular organisms → Bacteria | 15069 | Open in IMG/M |
| 3300022190|Ga0181354_1154808 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → SAR116 cluster → Candidatus Puniceispirillum → Candidatus Puniceispirillum marinum → Candidatus Puniceispirillum marinum IMCC1322 | 714 | Open in IMG/M |
| 3300022747|Ga0228703_1038191 | Not Available | 1373 | Open in IMG/M |
| 3300022752|Ga0214917_10004018 | Not Available | 16671 | Open in IMG/M |
| 3300022752|Ga0214917_10016866 | All Organisms → cellular organisms → Bacteria | 6233 | Open in IMG/M |
| 3300022752|Ga0214917_10140479 | Not Available | 1299 | Open in IMG/M |
| 3300022752|Ga0214917_10150836 | Not Available | 1229 | Open in IMG/M |
| 3300022752|Ga0214917_10155579 | Not Available | 1200 | Open in IMG/M |
| 3300022752|Ga0214917_10192364 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → unclassified Rhodocyclaceae → Rhodocyclaceae bacterium | 1017 | Open in IMG/M |
| 3300022752|Ga0214917_10250802 | Not Available | 825 | Open in IMG/M |
| 3300022752|Ga0214917_10268523 | Not Available | 781 | Open in IMG/M |
| 3300022752|Ga0214917_10424196 | Not Available | 539 | Open in IMG/M |
| 3300023174|Ga0214921_10003621 | All Organisms → cellular organisms → Bacteria | 23447 | Open in IMG/M |
| 3300023174|Ga0214921_10029690 | Not Available | 5405 | Open in IMG/M |
| 3300023174|Ga0214921_10114187 | All Organisms → Viruses → Predicted Viral | 1968 | Open in IMG/M |
| 3300023174|Ga0214921_10157907 | Not Available | 1519 | Open in IMG/M |
| 3300023174|Ga0214921_10437933 | Not Available | 650 | Open in IMG/M |
| 3300023179|Ga0214923_10005428 | All Organisms → cellular organisms → Bacteria | 14822 | Open in IMG/M |
| 3300023179|Ga0214923_10021795 | Not Available | 5678 | Open in IMG/M |
| 3300023179|Ga0214923_10072573 | Not Available | 2463 | Open in IMG/M |
| 3300023179|Ga0214923_10296656 | Not Available | 881 | Open in IMG/M |
| 3300023179|Ga0214923_10442359 | Not Available | 654 | Open in IMG/M |
| 3300023179|Ga0214923_10632039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingopyxis → unclassified Sphingopyxis → Sphingopyxis sp. GW247-27LB | 501 | Open in IMG/M |
| 3300025896|Ga0208916_10000529 | All Organisms → cellular organisms → Bacteria | 17758 | Open in IMG/M |
| 3300025896|Ga0208916_10002409 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 7655 | Open in IMG/M |
| 3300025896|Ga0208916_10027103 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 2288 | Open in IMG/M |
| 3300027733|Ga0209297_1216405 | Not Available | 751 | Open in IMG/M |
| 3300027734|Ga0209087_1039581 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2210 | Open in IMG/M |
| 3300027736|Ga0209190_1024068 | Not Available | 3363 | Open in IMG/M |
| 3300027741|Ga0209085_1041584 | All Organisms → Viruses → Predicted Viral | 2151 | Open in IMG/M |
| 3300027747|Ga0209189_1132781 | All Organisms → Viruses → Predicted Viral | 1080 | Open in IMG/M |
| 3300027754|Ga0209596_1000511 | Not Available | 35599 | Open in IMG/M |
| 3300027754|Ga0209596_1014440 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 5003 | Open in IMG/M |
| 3300027754|Ga0209596_1329298 | Not Available | 597 | Open in IMG/M |
| 3300027759|Ga0209296_1044814 | Not Available | 2344 | Open in IMG/M |
| 3300027763|Ga0209088_10000292 | All Organisms → cellular organisms → Bacteria | 36570 | Open in IMG/M |
| 3300027763|Ga0209088_10087473 | Not Available | 1448 | Open in IMG/M |
| 3300027763|Ga0209088_10242920 | Not Available | 751 | Open in IMG/M |
| 3300027806|Ga0209985_10212814 | Not Available | 913 | Open in IMG/M |
| 3300027973|Ga0209298_10032601 | Not Available | 2513 | Open in IMG/M |
| 3300027973|Ga0209298_10068946 | All Organisms → Viruses → Predicted Viral | 1598 | Open in IMG/M |
| 3300031857|Ga0315909_10082069 | Not Available | 2841 | Open in IMG/M |
| 3300033233|Ga0334722_10539976 | Not Available | 835 | Open in IMG/M |
| 3300033979|Ga0334978_0002398 | Not Available | 10712 | Open in IMG/M |
| 3300034356|Ga0335048_0470016 | Not Available | 608 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 39.60% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 24.75% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 9.90% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 7.92% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.96% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 3.96% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.97% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.99% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.99% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.99% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.99% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.99% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.99% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.99% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300008962 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5 | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300012000 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007A | Environmental | Open in IMG/M |
| 3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300014050 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007B | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020533 | Freshwater microbial communities from Lake Mendota, WI - 08JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022747 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17_Aug_MG | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027747 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027806 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300033979 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME30Aug2017-rr0003 | Environmental | Open in IMG/M |
| 3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J29032_10995681718 | 3300002408 | Freshwater | MSALYDWVIVGAGLAIGKLLVAIAVITIVTAILAVFFIIEEKTK* |
| Ga0068877_102181503 | 3300005525 | Freshwater Lake | MSALSEWIVVGMGLAIGRLIVASAVIAFGIAILAVFFIWEEKTK* |
| Ga0049081_101201202 | 3300005581 | Freshwater Lentic | MSALYDWIVVGAGLAIGKLLVAIAVITVVTAILAVFFIWEERSK* |
| Ga0079957_12381872 | 3300005805 | Lake | MSALSEWIVAGMGLAIGRLIVASAVIAVVVAILAVIFIWEERTK* |
| Ga0075464_100280704 | 3300006805 | Aqueous | MSALYDWIVVGAGLAIGKLLVAITVITVITAILAVFFIIEEKTK* |
| Ga0075464_100306391 | 3300006805 | Aqueous | MSALYDWIIVGAGLAIGRLLVAIAVITVVTAILAVFFIIEEKTK* |
| Ga0075464_102023884 | 3300006805 | Aqueous | MNVIKEWILVGAGLAIGKLLVAIAVIAAVTAILAVFFIIEEKTK* |
| Ga0075464_103102222 | 3300006805 | Aqueous | MSALYDWIVVGAGLAIGKLLVAIAVITIVTAILAVFFIMEERSK* |
| Ga0075464_103925123 | 3300006805 | Aqueous | MNTLMEWIAVGAGLAIGKLLVAIAVITIVTAILAVFFIMEERSK* |
| Ga0075464_104103335 | 3300006805 | Aqueous | MNALYDWIVVGAGLAIGRLLVAIAVITVVTAILAVFFIIEEKTK* |
| Ga0075464_104505272 | 3300006805 | Aqueous | MSALYDWIIVGAGLAIGKLLVAIAVITVVTAILAVFFIIEEKTK* |
| Ga0104242_10880703 | 3300008962 | Freshwater | MSALYDWIVVGAGLAIGRLLVAIAVITVVTAILAVFFIIEEKTK* |
| Ga0114973_1000564917 | 3300009068 | Freshwater Lake | VSALYDWIIVGAGLAIGKLLVAIAVIAAVTAILAVFFIIEEKTK* |
| Ga0114973_102196542 | 3300009068 | Freshwater Lake | MNVIKEWILVGAGLAIGKLLVAIAVITVVTAILAVFFIIEEKTK* |
| Ga0114980_1000325219 | 3300009152 | Freshwater Lake | VSALLDWIIVGAGLAIGRLLVAIAVITIGIAILAAFFIYEEKTK* |
| Ga0114980_100442328 | 3300009152 | Freshwater Lake | MNALTDWIIVGAGLAIGRLLVAIAVITVVAAILAAFFIWEERSK* |
| Ga0114980_102179151 | 3300009152 | Freshwater Lake | MNVIKEWILVGAGLAIGRLLVAIAVITVVTAILAVFFIIEEKTK* |
| Ga0114980_106313531 | 3300009152 | Freshwater Lake | MNVIKEWILVGAGLAIGKLLVAIAVIAVVATILAVFFIIEEKTK* |
| Ga0114963_101523882 | 3300009154 | Freshwater Lake | MNTLMEWIAVGAGLAIGKLLVAVAVIAIGLMPLIIFFIWEEKTK* |
| Ga0114968_1000144716 | 3300009155 | Freshwater Lake | MSALYDWIIVGAGLAIGKLLVAIAVITAITAILAVLFIIEEKTK* |
| Ga0114968_105386132 | 3300009155 | Freshwater Lake | MSALYDWIIVGAGLAIGKLLVAIAVITVVTAILAVFFIIEDKTK* |
| Ga0114968_106095503 | 3300009155 | Freshwater Lake | MNEKMNILMEWIAVGAGLAIGKLLVAIAVITIVTAILAVFFIMEERSK* |
| Ga0114968_107709522 | 3300009155 | Freshwater Lake | VGAGLAIGKLLVAVAVIAIGLIPLIIFFIWEEKTK* |
| Ga0114977_101085553 | 3300009158 | Freshwater Lake | MNVIKEWILVGAGLAIGKLLVAIAVITVGTAILAVFFIIEEKTK* |
| Ga0114978_104049052 | 3300009159 | Freshwater Lake | MSVLLDWIIVGAGLAIGKLLVAIAVITAITAILAVLFIIEEKTK* |
| Ga0114978_106368132 | 3300009159 | Freshwater Lake | MSAIYDWIIVGAGLAIGKLLVAIAVITIVTAILAVFFIIEEKTK* |
| Ga0114981_101084458 | 3300009160 | Freshwater Lake | MSALYDWIIVGAGLAIGRLLVAIAVITVVAAILAA |
| Ga0114981_102743272 | 3300009160 | Freshwater Lake | MSALTDWIIVGAGLAIGRLLVAIAVITVVAAILAAFFIWEERSK* |
| Ga0114981_106868912 | 3300009160 | Freshwater Lake | VSALLDWIIVGAGLAIGKLLVAIAVITVVTAILAVFFIIEEKTK* |
| Ga0114966_103516931 | 3300009161 | Freshwater Lake | MNEKMNILMEWIAVGAGLAIGKLLVAVAVIAIGLIPLIIFFIWEEKTK* |
| Ga0114970_100171926 | 3300009163 | Freshwater Lake | MNALLDWIIVGAGLAIGKLLVAMAVITVVTAILAVIFIMEERSK* |
| Ga0114970_100236875 | 3300009163 | Freshwater Lake | MSALYDWIIVGAGLAIGKLLVAIAVIAVVTAILAVFFIIEENTK* |
| Ga0114979_105174283 | 3300009180 | Freshwater Lake | MSALYDWIIVGAGLAIGKLLVAIAVITVVTAILAVFFII |
| Ga0114974_105588253 | 3300009183 | Freshwater Lake | MSALTDWIIVGAGLAIGKLLVAIAVITVVTAILAVFFIIEEKTK |
| Ga0114967_1001765610 | 3300010160 | Freshwater Lake | MNVIKEWILVGAGLAIGKLLVAIAVIAVVTAILAVFFIIEEKTK* |
| Ga0136644_1000210122 | 3300010334 | Freshwater Lake | MTTLTDWIMAGAGLAIGRLIVATAVIVIVTALLAVFFIIEERTK* |
| Ga0129333_109910203 | 3300010354 | Freshwater To Marine Saline Gradient | MNMLYEWIIVGAGLAIGKLIVALGVIFVVTAILALL |
| Ga0129333_112243502 | 3300010354 | Freshwater To Marine Saline Gradient | MSSLSEWIVAGMGLAIGRLIVASAVIAVVVAILAVIFIWEERTK* |
| Ga0129336_105438111 | 3300010370 | Freshwater To Marine Saline Gradient | AQMNMLYEWIIVGAGLAIGKLIVALGVIFVVTAILALLFILEERSK* |
| Ga0133913_123617761 | 3300010885 | Freshwater Lake | MSALYDWIIVGAGLAIGRLLVAIAVITVVAAILAAFFIWEERSK* |
| Ga0133913_134949252 | 3300010885 | Freshwater Lake | MNALYDWIIVGAGLAIGKLLVAIAVIAVITAIFAVLFIIEEKTK* |
| Ga0119951_11116993 | 3300012000 | Freshwater | MNTLMEWIAVGAGLAIGKLLVAVAVIAIGLIPLIIFFIWEEKTK* |
| Ga0164294_100309208 | 3300013006 | Freshwater | MAGAGLAIGKLIVATAVIVIVTAVLAVFFIIEERTK* |
| Ga0164294_100555562 | 3300013006 | Freshwater | MSALYDWIIVGAGLAIGKLLVAIAVITIVTAILAVFFIIEENTK* |
| Ga0164294_107935842 | 3300013006 | Freshwater | MSALTDWIIVGAGLAIGKLLVAIAVITVVTAILAVFFIWDERSK* |
| Ga0177922_104116521 | 3300013372 | Freshwater | MSALYDWIIVGAGLAIGRLLVAIAVITVVTAILAVFFIWEERSK* |
| Ga0119952_10951214 | 3300014050 | Freshwater | MSALYDWIVVGAGLAIGRLLVAIAVITVVTAILAVFFII |
| Ga0181343_11081341 | 3300017766 | Freshwater Lake | MSALTDWIIVGAGLAIGRLLVAIAVITVVTAILAVFFIWEERSK |
| Ga0181358_11189885 | 3300017774 | Freshwater Lake | MSALTDWIIVGAGLAIGRLLVAIAVITVVAAILAVFFIWE |
| Ga0181349_12377663 | 3300017778 | Freshwater Lake | MSALTDWIIVGAGLAIGRLLVAIAVITVVAAILAAFF |
| Ga0181355_11185281 | 3300017785 | Freshwater Lake | MSALTDWIIVGAGLAIGRLLVAIAVITVVAAILAA |
| Ga0181359_10748502 | 3300019784 | Freshwater Lake | MSALTDWIIVGAGLAIGRLLVAIAVITVVAAILAAFFIWEERSK |
| Ga0208364_10033827 | 3300020533 | Freshwater | MSALYDWVIVGAGLAIGKLLVAIAVITIVTAILAVFFIIEEKTK |
| Ga0222714_103961073 | 3300021961 | Estuarine Water | MNVIKEWILVGAGLAIGKLLVAIAVIAVVATILAVFFIIEEKTK |
| Ga0222713_103273592 | 3300021962 | Estuarine Water | MNTLMEWIAVGAGLAIGKLLVAVAVIAIGLIPLIIFFIWEEKTK |
| Ga0222712_100017105 | 3300021963 | Estuarine Water | MNVIKEWILVGAGLAIGKLLVAIAVIAVVAAILAVFFIIKEKTK |
| Ga0222712_1000426723 | 3300021963 | Estuarine Water | MSALYDWILVGAGLAIGKLLVAIAVIAVVATILAVFFIIEEKTK |
| Ga0181354_11548082 | 3300022190 | Freshwater Lake | MSALYDWIVVGAGLAIGKLLVAIAVITVVTAILAVFFIL |
| Ga0228703_10381912 | 3300022747 | Freshwater | MSALLDWIIVGAGLAIGKLLVAIAVITIGIAILAAFFIWEEKTK |
| Ga0214917_1000401817 | 3300022752 | Freshwater | MNEKMNILMEWIAVGAGLAIGRLLVAIAVITIVTAILAVFFIMEERSK |
| Ga0214917_100168662 | 3300022752 | Freshwater | MSALYDWIIVGAGLAIGKLLVAIAVITVVTAILAVFFIWEERSK |
| Ga0214917_101404792 | 3300022752 | Freshwater | MNTLMEWIAVGAGLAIGKLLVAIAVITIVTAILAVLFIMEERSK |
| Ga0214917_101508364 | 3300022752 | Freshwater | MSALYDWIVVGAGLAIGRLLVAIAVITVVTAILAVFFIIEEKTK |
| Ga0214917_101555792 | 3300022752 | Freshwater | MNALYDWIIVGAGLAIGRLLVAIAVMAIGIAILAAFFIWEEKTK |
| Ga0214917_101923642 | 3300022752 | Freshwater | MSALSEWIIVGAGLAIGRLIVAAAVIAIGLIPLVIFFIWEEKTK |
| Ga0214917_102508022 | 3300022752 | Freshwater | MNTLMEWIAVGAGLAIGRLLVAIAVITIVTAILAVFFIMEERSK |
| Ga0214917_102685233 | 3300022752 | Freshwater | MNTLMEWIAVGAGLAIGKILVVIAVITIVTAILAVFFIMEERSK |
| Ga0214917_104241963 | 3300022752 | Freshwater | MNVIKEWILVGAGLAIGKLLVAIAVITVVTAILAV |
| Ga0214921_1000362118 | 3300023174 | Freshwater | MNTLMEWIAVGAGLAIGKLLVAIAVITIVTAILAVFFIMEERSK |
| Ga0214921_100296908 | 3300023174 | Freshwater | MTTLTDWIMAGAGLAIGKLIVATAVIVIVTALLAVFFIIEERTK |
| Ga0214921_101141875 | 3300023174 | Freshwater | MTTLTDWIMAGAGLAIGKLIVATAVIVIVTAVLAVFFIIEERTK |
| Ga0214921_101579073 | 3300023174 | Freshwater | MSVIKEWILVGAGLAIGKLLVAIAVITVVTAILAVFFIIEEKTK |
| Ga0214921_104379333 | 3300023174 | Freshwater | MNVIKEWILVGAGLAIGKLLVAIAVITVVTAILAVFFIIEEKTK |
| Ga0214923_1000542822 | 3300023179 | Freshwater | MSALSEWIIVGAGLAIGRLLVAVAVIAIGLIPLVIFFIWEEKTK |
| Ga0214923_100217955 | 3300023179 | Freshwater | MNALYDWILVGAGLAIGKLLVAIAVIAVVATILAVFFIIEEKTK |
| Ga0214923_100725732 | 3300023179 | Freshwater | MSALSDWIIVGAGLAIGRLLVAVAVIAIGLIPLVIFFIWEERSK |
| Ga0214923_102966562 | 3300023179 | Freshwater | MSALSDWIIVGAGLAIGRLLVAVSVIAIGLIPLVIFFIWEEKTK |
| Ga0214923_104423592 | 3300023179 | Freshwater | MSALSDWIIVGAGLAIGRLLVAIAVIAIGLIPLVIFFIWEEKTK |
| Ga0214923_106320392 | 3300023179 | Freshwater | MSALSEWIIVGAGLAIGRLLVAVAVIAIGLIPLVIFFVLEERSK |
| Ga0208916_1000052921 | 3300025896 | Aqueous | MSALYDWIIVGAGLAIGRLLVAIAVITVVTAILAVFFIIEEKTK |
| Ga0208916_100024094 | 3300025896 | Aqueous | MSALYDWIVVGAGLAIGKLLVAITVITVITAILAVFFIIEEKTK |
| Ga0208916_100271035 | 3300025896 | Aqueous | MSALYDWIVVGAGLAIGKLLVAIAVITIVTAILAVFFIMEERSK |
| Ga0209297_12164053 | 3300027733 | Freshwater Lake | MNVIKEWILVGAGLAIGKLLVAIAVITVGTAILAVFFIIEEKTK |
| Ga0209087_10395814 | 3300027734 | Freshwater Lake | IVGAGLAIGKLLVAIAVITAITAILAVLFIIEEKTK |
| Ga0209190_10240685 | 3300027736 | Freshwater Lake | MNALLDWIIVGAGLAIGKLLVAMAVITVVTAILAVIFIMEERSK |
| Ga0209085_10415842 | 3300027741 | Freshwater Lake | MNTLMEWIAVGAGLAIGKLLVAVAVIAIGLMPLIIFFIWEEKTK |
| Ga0209189_11327812 | 3300027747 | Freshwater Lake | MTTLTDWIMAGAGLAIGRLIVATAVIVIVTALLAVFFIIEERTK |
| Ga0209596_100051135 | 3300027754 | Freshwater Lake | MSALYDWIIVGAGLAIGKLLVAIAVITAITAILAVLFIIEEKTK |
| Ga0209596_10144406 | 3300027754 | Freshwater Lake | MNVIKEWILVGAGLAIGKLLVAIAVIAVVTAILAVFFIIEEKTK |
| Ga0209596_13292982 | 3300027754 | Freshwater Lake | MNEKMNILMEWIAVGAGLAIGKLLVAVAVIAIGLIPLIIFFIWEEKTK |
| Ga0209296_10448142 | 3300027759 | Freshwater Lake | MSVLLDWIIVGAGLAIGKLLVAIAVITAITAILAVLFIIEEKTK |
| Ga0209088_1000029240 | 3300027763 | Freshwater Lake | VSALLDWIIVGAGLAIGRLLVAIAVITIGIAILAAFFIYEEKTK |
| Ga0209088_100874733 | 3300027763 | Freshwater Lake | DWIIVGAGLAIGKLLVAIAVITVVTAILAVFFIIEEKTK |
| Ga0209088_102429204 | 3300027763 | Freshwater Lake | VSALLDWIIVGAGLAIGKLLVAIAVITVVTAILAVFFIIEEKTK |
| Ga0209985_102128142 | 3300027806 | Freshwater Lake | MSALSEWIVVGMGLAIGRLIVASAVIAFGIAILAVFFIWEEKTK |
| Ga0209298_100326012 | 3300027973 | Freshwater Lake | MSALYDWIIVGAGLAIGRLLVAIAVITVVAAILAAFFIWEERSK |
| Ga0209298_100689462 | 3300027973 | Freshwater Lake | MSAIYDWIIVGAGLAIGKLLVAIAVITIVTAILAVFFIIEEKTK |
| Ga0315909_100820692 | 3300031857 | Freshwater | MSALYDWIIVGAGLAIGKLFVAIAVITVVTAILAVFFIIEEKTK |
| Ga0334722_105399762 | 3300033233 | Sediment | MNVIKEWILVGAGLAIGKLIVGIVVIAILAVIFALVFIAEEDNQ |
| Ga0334978_0002398_1697_1831 | 3300033979 | Freshwater | MSALYDWIIVGAGLAIGRLLVAIAVITVVTAILAVFFIWEERSK |
| Ga0335048_0470016_498_608 | 3300034356 | Freshwater | MSALSEWIVVGMGLAIGRLIVASAVIAVGIAILAVFF |
| ⦗Top⦘ |