


| Basic Information | |
|---|---|
| Family ID | F102803 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 101 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MATGNRTLKLSILADVDDLKKKLGEADKAVETNSSKISEFGKKAAAAF |
| Number of Associated Samples | 85 |
| Number of Associated Scaffolds | 101 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 93.75 % |
| % of genes near scaffold ends (potentially truncated) | 14.85 % |
| % of genes from short scaffolds (< 2000 bps) | 12.87 % |
| Associated GOLD sequencing projects | 81 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (85.149 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (30.693 % of family members) |
| Environment Ontology (ENVO) | Unclassified (68.317 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (51.485 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 60.53% β-sheet: 0.00% Coil/Unstructured: 39.47% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 101 Family Scaffolds |
|---|---|---|
| PF03354 | TerL_ATPase | 1.98 |
| PF04586 | Peptidase_S78 | 1.98 |
| PF04860 | Phage_portal | 0.99 |
| COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
|---|---|---|---|
| COG3740 | Phage head maturation protease | Mobilome: prophages, transposons [X] | 1.98 |
| COG4626 | Phage terminase-like protein, large subunit, contains N-terminal HTH domain | Mobilome: prophages, transposons [X] | 1.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 85.15 % |
| All Organisms | root | All Organisms | 14.85 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002274|B570J29581_102792 | All Organisms → Viruses → Predicted Viral | 1125 | Open in IMG/M |
| 3300003395|JGI25917J50250_1013508 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1975 | Open in IMG/M |
| 3300005527|Ga0068876_10073006 | Not Available | 2065 | Open in IMG/M |
| 3300007540|Ga0099847_1031459 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1703 | Open in IMG/M |
| 3300008114|Ga0114347_1178201 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 732 | Open in IMG/M |
| 3300009165|Ga0105102_10450667 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 691 | Open in IMG/M |
| 3300009183|Ga0114974_10106088 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1801 | Open in IMG/M |
| 3300012964|Ga0153916_10626686 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1153 | Open in IMG/M |
| 3300017785|Ga0181355_1230881 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 716 | Open in IMG/M |
| 3300020498|Ga0208050_1001229 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3665 | Open in IMG/M |
| 3300020553|Ga0208855_1012770 | All Organisms → Viruses → Predicted Viral | 1340 | Open in IMG/M |
| 3300021140|Ga0214168_1073774 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 763 | Open in IMG/M |
| 3300023179|Ga0214923_10090621 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2105 | Open in IMG/M |
| 3300027693|Ga0209704_1020693 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1671 | Open in IMG/M |
| 3300031539|Ga0307380_11142542 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 609 | Open in IMG/M |
| 3300034012|Ga0334986_0168765 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1248 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 30.69% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 16.83% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 7.92% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 5.94% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 4.95% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.96% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.96% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 3.96% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 3.96% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 2.97% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.98% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.98% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 1.98% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.99% |
| Aquatic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic | 0.99% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.99% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.99% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.99% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.99% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 0.99% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.99% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.99% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002274 | Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002297 | Freshwater microbial communities from Lake Mendota, WI - 17AUG2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002306 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002362 | Freshwater microbial communities from Lake Mendota, WI - 03AUG2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300003395 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300003431 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
| 3300011009 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_0.1_0.8_DNA | Environmental | Open in IMG/M |
| 3300012707 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES154 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012720 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES141 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012723 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES129 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012734 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES144 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013074 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES147 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300014811 | Aquatic viral communities from ballast water - Michigan State University - AB_ballast water | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020533 | Freshwater microbial communities from Lake Mendota, WI - 08JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020536 | Freshwater microbial communities from Lake Mendota, WI - 02JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020551 | Freshwater microbial communities from Lake Mendota, WI - 27JUL2010 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300020553 | Freshwater microbial communities from Lake Mendota, WI - 17MAY2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020554 | Freshwater microbial communities from Lake Mendota, WI - 17AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021140 | Freshwater microbial communities from Lake Mendota, WI - Practice 29OCT2010 epilimnion | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
| 3300024239 | Subsurface sediment microbial communities from gas well in Oklahoma, United States - OK STACK MC-2-E | Environmental | Open in IMG/M |
| 3300025445 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025887 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027600 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepA_8h | Environmental | Open in IMG/M |
| 3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027806 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300029268 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_19m | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
| 3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034063 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
| 3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| 3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
| 3300034280 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME10Aug2009-rr0048 | Environmental | Open in IMG/M |
| 3300034355 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Oct2015-rr0135 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J29581_1027924 | 3300002274 | Freshwater | MATGNRTLKLSILADVDDLKKKLGEADKAVESNSSKISEFG |
| B570J29603_1004557 | 3300002297 | Freshwater | MATGNRTLKLSILADVDDLKKKLGEADKAVETNSSRIADF |
| B570J29618_10076181 | 3300002306 | Freshwater | MATGNRTLKLSILADVDDLKKKLGEADKAVESNSSKIADFG |
| B570J29607_1004786 | 3300002362 | Freshwater | MATGNRTLKLSILADVDDLKKKLGEADKAVETNSSRIADFGKKAAA |
| JGI25917J50250_10135081 | 3300003395 | Freshwater Lake | MATGNRTLKLSILADVDDLKKKLGEADKAVETNASKIADFGKKAAAAFAVAAAA |
| JGI25913J50563_10191841 | 3300003431 | Freshwater Lake | VARDTRTLSLKILADIDDLKNKLNQADNAVETNSEKISAFGKKAAAA |
| Ga0068877_106878562 | 3300005525 | Freshwater Lake | MATGNRTLKLSILADVDDLKKKLGDADKAVEENSNKISEFGKKAAAAFAVVG |
| Ga0068876_100730066 | 3300005527 | Freshwater Lake | MATGNRTLKLSILADVDDLKKKLGEADKAVETNSSKISEFGKKAAAAF |
| Ga0075470_102280222 | 3300006030 | Aqueous | MATGNRTLKLSILADVDDLKKKLGEADKAVENNSNKISEFGK |
| Ga0075464_109361042 | 3300006805 | Aqueous | MATGSRTLKLSILADVDDLKKKLGEADKAVESNASKISEFGKKAAAAFAVAAAA |
| Ga0070748_12439281 | 3300006920 | Aqueous | MARDTRTLSLKILADIDDLKNKLNEADNAVETNSEKISAFGKKAAAAFA |
| Ga0099847_10314591 | 3300007540 | Aqueous | MGVMATGNRTLKLSILADVDDLKKKLGEADKSVESNQKK |
| Ga0102828_10574911 | 3300007559 | Estuarine | VGIVARDTRTLSLKILADIDDLKNKLNQADNAVETNSEKISAFGKKAAAAFAV |
| Ga0114347_10544207 | 3300008114 | Freshwater, Plankton | MATGNRTLKLSILADVDDLKKKLGEADKAVETNSSKISEFGKKAAA |
| Ga0114347_11782013 | 3300008114 | Freshwater, Plankton | MATGNRTLKLSILADVDDLKKKLGDADKAVESNSSKISEFGKKAAAAFAVAAAAA |
| Ga0114880_10684031 | 3300008450 | Freshwater Lake | MATGNRTLKLSILADVDDLKKKLGDADKAVESNSSKISEFGKKAAAA |
| Ga0114880_11022934 | 3300008450 | Freshwater Lake | MATGNRTLKLSILADVDELKKSLKTGETEVKGFSDKVSDFGKKAAAAFA |
| Ga0105098_103953513 | 3300009081 | Freshwater Sediment | MAGNRTLKLSILADVDDLNKKLKAANTDVESSSDKISKFGKAAAAAFAIA |
| Ga0105103_104388542 | 3300009085 | Freshwater Sediment | MATGNRTLKLSILADVDDLKKKLGEADKAVESNSSKISEFGKKAAAAFAVLLLLPLPMALN* |
| Ga0114978_104371611 | 3300009159 | Freshwater Lake | MASDNRTLKLSILADVDELKKGLASANKEVESTADKIGEFGKKAALAFAAV |
| Ga0105102_104506673 | 3300009165 | Freshwater Sediment | MAIGSRTLKLSILADVDDLKKKLGEADKAVETNANKVSDFGKK |
| Ga0105097_102502551 | 3300009169 | Freshwater Sediment | MATGNRTLKLSILADVDDLKKKLGEADKSVEDNSKKISEFGNKEA |
| Ga0114974_101060885 | 3300009183 | Freshwater Lake | MATGNRTLKLSILADVDELKKSLGDANKSVETSADKIADFGKKVSAAGVNSVIA* |
| Ga0115546_13199092 | 3300009435 | Pelagic Marine | MATGNRTLKLSILADVDDLKKKLGEADKAVETNASKITEFGKKAAAAFA |
| Ga0129318_102337872 | 3300011009 | Freshwater To Marine Saline Gradient | MATGNRTLKLSILADVDDLKKKLDEADKAVESNSSKISEFGKKAAAAFAVAAAAA |
| Ga0157623_10023001 | 3300012707 | Freshwater | MATGSRTLKLSILADVDDLKKKLGEADKAVESNASKISEFGKKAAAAF |
| Ga0157613_11239771 | 3300012720 | Freshwater | MAKDNRTLKLSILADVDDLKKKLGEADKAVETNADK |
| Ga0157604_10472285 | 3300012723 | Freshwater | MATGNRTLKLSILADVDDLKKKLGEADKAVESNASKISEFGKK |
| Ga0157615_12077911 | 3300012734 | Freshwater | MATGNRTLKLSILADVDDLKKKLGEADKAVETNSSKIGE |
| Ga0157615_12765081 | 3300012734 | Freshwater | MATGNRTLKLSILADVDDLKKKLGEADKAVESNSSKISEFGKK |
| Ga0153916_106266864 | 3300012964 | Freshwater Wetlands | MATGNRTLKLSILADVDDLKKKLDAGSKEVETFGDKVAGFGKAAGLAF |
| Ga0164293_109293791 | 3300013004 | Freshwater | MATGNRTLKLSILADVDDLKKKLGEADKAVESNSSKISEF |
| Ga0157618_10076191 | 3300013074 | Freshwater | MATGNRTLKLSILADVDDLKKKLNEANGDVEVAATGMEKFGNKAAA |
| Ga0170791_146220381 | 3300013295 | Freshwater | MGLMATGNRTLKLSILADVDDLKKKLGEADKAVED |
| Ga0170791_150976914 | 3300013295 | Freshwater | MATGNRTLKLSILADVDELKKSLGEANKTVETSAD |
| Ga0119960_10665951 | 3300014811 | Aquatic | MATGNRTLKLSILADVDDLKKKLGEADKAVENNSSKICRS* |
| Ga0181347_11563582 | 3300017722 | Freshwater Lake | MATGNRTLKLSILADVDELKKGLASANKEVESTADKIGEFGK |
| Ga0181365_11308301 | 3300017736 | Freshwater Lake | MATGNRTLKLSILADVDDLKKKLGEADNAVETNSEKISAF |
| Ga0181365_11595081 | 3300017736 | Freshwater Lake | MARDTRTLKLSILADVDDLKKKLGEADKAVETNASKIADFGKKAAAAFAVA |
| Ga0181355_12308813 | 3300017785 | Freshwater Lake | MASDSRTLKLSILADVDDLKKKLGEADKAVETNASKIADFG |
| Ga0181355_12643972 | 3300017785 | Freshwater Lake | MATGNRTLKLSILADVDDLKKKLGEADNAVQTNSEKISAFGKKAAAAFAVA |
| Ga0181359_11422993 | 3300019784 | Freshwater Lake | MAGNRTLKLSILADVDDLKKKLGDGNQEVEGFGAKVGEFGKKAGAAFAVA |
| Ga0181359_11431101 | 3300019784 | Freshwater Lake | MATGNRTLKLSILADVDDLKKKLGEADNAVQTNSEKIAAFGKKAAAA |
| Ga0211734_102479847 | 3300020159 | Freshwater | MATGSRTLKLSILADVDDLKKKLGEADKAVAENSSKIAEFGK |
| Ga0211729_108537131 | 3300020172 | Freshwater | MATGSRTLKLSILADVDDLKKKLGEADKAVAENSSKIAEFGKKAAVAFAVAGAA |
| Ga0208050_10012291 | 3300020498 | Freshwater | MATGNRTLKLSILADVDDLKKKLGDADKAVESNASKISEFGKK |
| Ga0208364_10524932 | 3300020533 | Freshwater | MATGNRTLKLSILADVDDLKKKLGDADKAVESNASKISEFGKKAALAFTVA |
| Ga0207939_10105461 | 3300020536 | Freshwater | MATGNRTLKLSILADVDDLKKKLGEADKAVETNSSRIADFGKKAAAAFAVAAAAAV |
| Ga0208360_10229503 | 3300020551 | Freshwater | MARDSRTLSLKILADIDDLKKKLDQADNAVETNSQKIAAFGKKAAAAFAVAAAA |
| Ga0208855_10127701 | 3300020553 | Freshwater | MAKDNRTLKLSILADVDDLKKKLGEADKAVETNADKISDFGKKAALAFAAAGAAATAFAI |
| Ga0208599_10302861 | 3300020554 | Freshwater | MATGNRTLKLSILADVDDLKKKLGEADKAVESNSSKISEFGKKA |
| Ga0214168_10737743 | 3300021140 | Freshwater | MATGNRTLKLSILADVDDLKKKLGDADKAVESNASKISEFGKKAALAFTVAAAAAVAYAGKLAIDGV |
| Ga0222714_103128561 | 3300021961 | Estuarine Water | MARDTRTLSLKILADIDDLKNKLNQADNAVETNSEKISAFGKKAAAAFAVAAA |
| Ga0214923_100906216 | 3300023179 | Freshwater | MARDTRTLSLKILADIDDLKKKLNEADGSVETSSSKIADYGKKAAAA |
| Ga0247724_10089761 | 3300024239 | Deep Subsurface Sediment | MAGNRTLKLSILADVDDLKKKLGQGEKEVQGFGDKLGEFGKKAAAAFAVAA |
| Ga0208424_10228882 | 3300025445 | Aqueous | MAGNRTLKLSILADVDDLRKKLGEGSREVQTFGSKLKDFGKKAGVVLAAVGAA |
| Ga0208544_103716821 | 3300025887 | Aqueous | MATGSRTLKLSILADVDDLKKKLGEADNAVESNSSKISEFG |
| Ga0255117_10098807 | 3300027600 | Freshwater | VARDTRTLSLKILADIDDLKNKLNQADNAVETNSQKISAFGKKAAAAFA |
| Ga0209704_10206931 | 3300027693 | Freshwater Sediment | MARDNRTLKLSILADIDDLKKKLDQADKAVETNSSKIGAFTAKIGKAF |
| Ga0209599_101688662 | 3300027710 | Deep Subsurface | MATGNRTLKLSILADVDDLKKKLGEADKAVEGNASKISEFGKKAAAA |
| Ga0209297_11710333 | 3300027733 | Freshwater Lake | MATGNRTLKLSILADVDDLKKKLGEADNAVEGNAN |
| Ga0209768_101394914 | 3300027772 | Freshwater Lake | MATGNRTLKLSILADVDDLKKKLGEADKAVETNASKIADFGKKAAAAFAVAA |
| Ga0209768_104391242 | 3300027772 | Freshwater Lake | MASDSRTLKLSILADVDDLKKKLGDADSAVQQNSSKMSEFGKKAALAFA |
| Ga0209500_102183883 | 3300027782 | Freshwater Lake | MATGNRTLKLSILADVDELKKSLGEANKTVETSADKIADFGKKAALAFA |
| Ga0209353_101567384 | 3300027798 | Freshwater Lake | VAKDTRTLSLKILADIDDLKNKLNQADNAVETNSEKISAFGKKAAAAFAV |
| Ga0209358_101682821 | 3300027804 | Freshwater Lake | MAGNRTLKLSILADVDDLKKKLGQGEKEVEGFGNKLGEFGKKAAAAFAVAAAAA |
| Ga0209358_101898044 | 3300027804 | Freshwater Lake | MATGNRTLKLSILADVDELKKSLGDANKSVETSADKIADF |
| Ga0209985_101988033 | 3300027806 | Freshwater Lake | MATGNRTLKLSILADVDDLKKKLGDADKAVEENSNKI |
| (restricted) Ga0247842_103688951 | 3300029268 | Freshwater | MAKDNRTLKLSILADIDDLKKKLDQADKAVETNSNKIGEFSKKIGKAFLVAG |
| Ga0307380_111425422 | 3300031539 | Soil | MAASRTLKLSILADVDQLKKSLGAADKSVGSSADKMRDFGKK |
| Ga0307379_103649711 | 3300031565 | Soil | MATGNRTLKLSILADVDDLKKKLGEADKSVEANSKKISDFGKKTALAFAAVGAAAVVFGK |
| Ga0315907_106438741 | 3300031758 | Freshwater | MATGNRTLKLSILADVDDLKKKLGDADKAVEENSNK |
| Ga0315290_107296721 | 3300031834 | Sediment | MATGNRTLKLSILADVDDLKKKLGEADNAVETNSEKISAFG |
| Ga0315904_100278141 | 3300031951 | Freshwater | MATGNRTLKLSILADVDDLKKKLGEADKAVETNSSKISEFGKKAA |
| Ga0315904_114525582 | 3300031951 | Freshwater | MATGNRTLKLSILADVDDLKKKLGEADNAVESNASKI |
| Ga0315906_104904033 | 3300032050 | Freshwater | MATGNRTLKLSILADVDDLKKKLGDADKAIKNNSNKISK |
| Ga0315284_105428574 | 3300032053 | Sediment | MATGNRTLKLSILADVDDLKKKLGEADKAVEDNSNRIADFGKKAALAFAAVGAAAGAF |
| Ga0315277_115394292 | 3300032118 | Sediment | MASDSRTLKLSILADVDDLKKKLGDADSAVSQNSSKMSEFGKKA |
| Ga0315275_112954172 | 3300032401 | Sediment | MATGNRTLKLSILADVDDLKKKLGEADNAVETNSEKIAAFGKKAA |
| Ga0334982_0541707_2_157 | 3300033981 | Freshwater | MATGNRTLKLSILADVDDLKKKLGDADKAVESNSSKISEFGKKAAAAFAVAA |
| Ga0334994_0202052_968_1072 | 3300033993 | Freshwater | MATGNRTLKLSILADVDDLKKKLGEADKAVETNSS |
| Ga0334994_0543068_3_167 | 3300033993 | Freshwater | MAKDNRTLKLSILADVDDLKKKLGEADKAVETNADKISDFGKKAALAFAAAGAAA |
| Ga0334994_0543183_396_530 | 3300033993 | Freshwater | MARDNRTLKLSILADVDDLKKKLGDADKAVETNSSKIAEFGKKAA |
| Ga0334994_0558634_1_159 | 3300033993 | Freshwater | MASDSRTLKLSILADVDDLKKKLGDADSAVAQNSSKMSEFGKKAAAAFAIAAA |
| Ga0334986_0168765_1134_1247 | 3300034012 | Freshwater | MATGNRTLKLSILADVDDLKKKLGEADKAVENNSSKIS |
| Ga0334986_0242438_847_984 | 3300034012 | Freshwater | MATGNRTLKLSILADVDDLKKKLGEADKAVETNASKIAEFGKKAAA |
| Ga0334998_0532188_3_155 | 3300034019 | Freshwater | MGIMASDSRTLKLSILADVDDLKKKLGDADSAVAQNSSKMSEFGKKAAAAF |
| Ga0334995_0607106_494_634 | 3300034062 | Freshwater | MARDSRTLSLKILADIDDLKKKLDQADNAVETNSQKISAFGKKAAAA |
| Ga0335000_0256557_938_1093 | 3300034063 | Freshwater | MATGNRTLKLSILADVDDLKKKLGEADKAVESNSSKISEFGKKAAAAFAVAA |
| Ga0335019_0769800_416_544 | 3300034066 | Freshwater | MARDNRTLKLSILADVDDLKKKLGEADKAVETNADKISDFGKK |
| Ga0335020_0007678_6531_6674 | 3300034082 | Freshwater | MATGNRTLKLSILADVDDLKKKLGEADKAVETNSSKIGEFGKKAAAAF |
| Ga0335010_0279807_1_150 | 3300034092 | Freshwater | MAKDNRTLKLSILADVDDLKKKLGEADKAVETNADKISDFGKKAALAFAA |
| Ga0335010_0398829_2_148 | 3300034092 | Freshwater | MARDSRTLSLKILADIDDLKKKLDQADNAVESNSQKISAFGKKAAAAFA |
| Ga0335027_0203606_1276_1401 | 3300034101 | Freshwater | MATGNRTLKLSILADVDDLKKKLGEADKAVESNSSKISEFGK |
| Ga0335031_0341247_2_157 | 3300034104 | Freshwater | MGLMAKDNRTLKLSILADVDDLKKKLGEADKSVENNANKISEFGKKAALAFA |
| Ga0335036_0366988_3_116 | 3300034106 | Freshwater | MARDNRTLKLSILADVDDLKKKLGEADKSVETNANKIS |
| Ga0335036_0744825_3_140 | 3300034106 | Freshwater | MATGNRTLKLSILADVDDLKKKLDQADKAVETNSDKISAFGKKAAA |
| Ga0335066_0350791_2_151 | 3300034112 | Freshwater | MARDSRTLSLKILADIDDLKKKLDQADNAVESNSEKISAFGKKAAAAFAV |
| Ga0335053_0583087_505_645 | 3300034118 | Freshwater | MATGNRTLKLSILADVDDLKKKLGEADKAVDTNATKISDFGKKAALA |
| Ga0334997_0356273_1_147 | 3300034280 | Freshwater | MATGNRTLKLSILADVDDLKKKLGDADKAVESNSSKISEFGKNAAAAFA |
| Ga0335039_0402020_569_703 | 3300034355 | Freshwater | MATGNRTLKLSILADVDELKKGLGEANKSVESSADKIADFGKKAA |
| ⦗Top⦘ |