


| Basic Information | |
|---|---|
| Family ID | F102800 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 101 |
| Average Sequence Length | 47 residues |
| Representative Sequence | VSKILEASRAGALAAPARRPFRLGAFVERESVFSWLMLTPPLLFLL |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 101 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 60.40 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 93.07 % |
| Associated GOLD sequencing projects | 95 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.010 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (13.861 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.624 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (43.564 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.70% β-sheet: 0.00% Coil/Unstructured: 47.30% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 101 Family Scaffolds |
|---|---|---|
| PF01547 | SBP_bac_1 | 41.58 |
| PF13416 | SBP_bac_8 | 18.81 |
| PF04055 | Radical_SAM | 0.99 |
| PF00850 | Hist_deacetyl | 0.99 |
| PF10518 | TAT_signal | 0.99 |
| PF00528 | BPD_transp_1 | 0.99 |
| COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
|---|---|---|---|
| COG0123 | Acetoin utilization deacetylase AcuC or a related deacetylase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.01 % |
| Unclassified | root | N/A | 0.99 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002122|C687J26623_10001126 | All Organisms → cellular organisms → Bacteria | 5472 | Open in IMG/M |
| 3300002908|JGI25382J43887_10134376 | All Organisms → cellular organisms → Bacteria | 1273 | Open in IMG/M |
| 3300002911|JGI25390J43892_10053898 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 946 | Open in IMG/M |
| 3300003347|JGI26128J50194_1012751 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300004633|Ga0066395_10456409 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 729 | Open in IMG/M |
| 3300004803|Ga0058862_12798773 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1567 | Open in IMG/M |
| 3300005167|Ga0066672_10234850 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1177 | Open in IMG/M |
| 3300005175|Ga0066673_10595635 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 644 | Open in IMG/M |
| 3300005332|Ga0066388_104928315 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 679 | Open in IMG/M |
| 3300005440|Ga0070705_100271397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 1201 | Open in IMG/M |
| 3300005440|Ga0070705_100487938 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 932 | Open in IMG/M |
| 3300005445|Ga0070708_100778693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 899 | Open in IMG/M |
| 3300005459|Ga0068867_100303173 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1318 | Open in IMG/M |
| 3300005471|Ga0070698_100350288 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1408 | Open in IMG/M |
| 3300005518|Ga0070699_101142515 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 714 | Open in IMG/M |
| 3300005536|Ga0070697_100458904 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 1110 | Open in IMG/M |
| 3300005552|Ga0066701_10067244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 2020 | Open in IMG/M |
| 3300005557|Ga0066704_10702858 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 637 | Open in IMG/M |
| 3300005578|Ga0068854_101776559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 565 | Open in IMG/M |
| 3300005718|Ga0068866_11411367 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 509 | Open in IMG/M |
| 3300006034|Ga0066656_10667426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 669 | Open in IMG/M |
| 3300006049|Ga0075417_10417573 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 665 | Open in IMG/M |
| 3300006806|Ga0079220_10151259 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1281 | Open in IMG/M |
| 3300006845|Ga0075421_102338568 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 561 | Open in IMG/M |
| 3300006904|Ga0075424_100536349 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1249 | Open in IMG/M |
| 3300007076|Ga0075435_101236531 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 654 | Open in IMG/M |
| 3300009038|Ga0099829_11357356 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 587 | Open in IMG/M |
| 3300009090|Ga0099827_10905078 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 764 | Open in IMG/M |
| 3300009098|Ga0105245_11338376 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 765 | Open in IMG/M |
| 3300009148|Ga0105243_11702460 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 660 | Open in IMG/M |
| 3300009174|Ga0105241_10822239 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 857 | Open in IMG/M |
| 3300010043|Ga0126380_10588342 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 874 | Open in IMG/M |
| 3300010303|Ga0134082_10259782 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 721 | Open in IMG/M |
| 3300010304|Ga0134088_10031771 | All Organisms → cellular organisms → Bacteria | 2384 | Open in IMG/M |
| 3300010320|Ga0134109_10086226 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1080 | Open in IMG/M |
| 3300010322|Ga0134084_10074082 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1045 | Open in IMG/M |
| 3300010329|Ga0134111_10463684 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 551 | Open in IMG/M |
| 3300010366|Ga0126379_10500218 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1287 | Open in IMG/M |
| 3300010375|Ga0105239_10794638 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1084 | Open in IMG/M |
| 3300012040|Ga0137461_1039364 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1261 | Open in IMG/M |
| 3300012096|Ga0137389_10041267 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 3428 | Open in IMG/M |
| 3300012096|Ga0137389_11417494 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 590 | Open in IMG/M |
| 3300012207|Ga0137381_11401759 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 591 | Open in IMG/M |
| 3300012351|Ga0137386_10740986 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 706 | Open in IMG/M |
| 3300012359|Ga0137385_10577349 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 947 | Open in IMG/M |
| 3300012360|Ga0137375_10271800 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1551 | Open in IMG/M |
| 3300012361|Ga0137360_10897991 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 764 | Open in IMG/M |
| 3300012362|Ga0137361_10463759 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1163 | Open in IMG/M |
| 3300012582|Ga0137358_10572293 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 759 | Open in IMG/M |
| 3300012929|Ga0137404_11817231 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 567 | Open in IMG/M |
| 3300012930|Ga0137407_10008300 | All Organisms → cellular organisms → Bacteria | 7211 | Open in IMG/M |
| 3300012971|Ga0126369_12779473 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 573 | Open in IMG/M |
| 3300012987|Ga0164307_10145723 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1552 | Open in IMG/M |
| 3300014150|Ga0134081_10315011 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 565 | Open in IMG/M |
| 3300014308|Ga0075354_1003936 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1878 | Open in IMG/M |
| 3300015358|Ga0134089_10579974 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 500 | Open in IMG/M |
| 3300016319|Ga0182033_10294730 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1336 | Open in IMG/M |
| 3300017654|Ga0134069_1058712 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1218 | Open in IMG/M |
| 3300017659|Ga0134083_10083136 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1246 | Open in IMG/M |
| 3300017961|Ga0187778_10685377 | Not Available | 692 | Open in IMG/M |
| 3300018028|Ga0184608_10194064 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 888 | Open in IMG/M |
| 3300018051|Ga0184620_10224995 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 627 | Open in IMG/M |
| 3300018053|Ga0184626_10069235 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1487 | Open in IMG/M |
| 3300018081|Ga0184625_10565388 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 563 | Open in IMG/M |
| 3300018433|Ga0066667_11921370 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 540 | Open in IMG/M |
| 3300019259|Ga0184646_1604259 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 547 | Open in IMG/M |
| 3300019878|Ga0193715_1028731 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1207 | Open in IMG/M |
| 3300019878|Ga0193715_1103467 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 568 | Open in IMG/M |
| 3300019887|Ga0193729_1101860 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1092 | Open in IMG/M |
| 3300019999|Ga0193718_1028765 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1235 | Open in IMG/M |
| 3300020067|Ga0180109_1289018 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 537 | Open in IMG/M |
| 3300021080|Ga0210382_10289334 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 720 | Open in IMG/M |
| 3300022534|Ga0224452_1079389 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 994 | Open in IMG/M |
| 3300022534|Ga0224452_1169483 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 672 | Open in IMG/M |
| 3300025885|Ga0207653_10292540 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 630 | Open in IMG/M |
| 3300025898|Ga0207692_11156690 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 513 | Open in IMG/M |
| 3300025914|Ga0207671_10368860 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1140 | Open in IMG/M |
| 3300025941|Ga0207711_10776245 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 893 | Open in IMG/M |
| 3300025961|Ga0207712_11279072 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 655 | Open in IMG/M |
| 3300025972|Ga0207668_10361461 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1217 | Open in IMG/M |
| 3300025986|Ga0207658_10152576 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 1884 | Open in IMG/M |
| 3300026035|Ga0207703_10498536 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1143 | Open in IMG/M |
| 3300026088|Ga0207641_10307004 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1500 | Open in IMG/M |
| 3300026089|Ga0207648_12245470 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 506 | Open in IMG/M |
| 3300026527|Ga0209059_1208915 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 658 | Open in IMG/M |
| 3300026528|Ga0209378_1264655 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 546 | Open in IMG/M |
| 3300026538|Ga0209056_10155824 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1741 | Open in IMG/M |
| 3300027178|Ga0207606_101552 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 773 | Open in IMG/M |
| 3300027725|Ga0209178_1087258 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1031 | Open in IMG/M |
| 3300027846|Ga0209180_10478685 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 699 | Open in IMG/M |
| 3300027907|Ga0207428_10429197 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 965 | Open in IMG/M |
| 3300028792|Ga0307504_10138077 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 816 | Open in IMG/M |
| 3300028811|Ga0307292_10132249 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 999 | Open in IMG/M |
| 3300028828|Ga0307312_10060822 | All Organisms → cellular organisms → Bacteria | 2276 | Open in IMG/M |
| 3300031751|Ga0318494_10211838 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1106 | Open in IMG/M |
| 3300031764|Ga0318535_10482929 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 551 | Open in IMG/M |
| 3300031965|Ga0326597_11422077 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 671 | Open in IMG/M |
| 3300032174|Ga0307470_11698208 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 531 | Open in IMG/M |
| 3300032179|Ga0310889_10187355 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 949 | Open in IMG/M |
| 3300033551|Ga0247830_10098733 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2048 | Open in IMG/M |
| 3300034660|Ga0314781_096276 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 590 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 13.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.91% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 8.91% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.93% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.95% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.96% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 2.97% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.97% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.97% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.97% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.98% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.98% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.98% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.99% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.99% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.99% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.99% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.99% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.99% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.99% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002122 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_2 | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
| 3300003347 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM | Host-Associated | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300012040 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT746_2 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014308 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D1 | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019259 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019878 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300019999 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a1 | Environmental | Open in IMG/M |
| 3300020067 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT47_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300027178 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05.2A5-11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034660 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| C687J26623_100011261 | 3300002122 | Soil | MSKVLEASRAGALMAPAHRPIRVGRLRAFVERESAFSWLMLTP |
| JGI25382J43887_101343761 | 3300002908 | Grasslands Soil | MGRVVEASRAPALEARDYRPLRFGRLREFVERESVFSWLILTPPLLFLLLFLGYPFFY |
| JGI25390J43892_100538982 | 3300002911 | Grasslands Soil | LSKILEASRARALAAPAHRPIRFGRLGAFMERESVFSWLMLTPPVLFLVAFLGYP |
| JGI26128J50194_10127512 | 3300003347 | Arabidopsis Thaliana Rhizosphere | MSRIFEASGAPTLEVGAHGPVGLGRLRAFVEREQVYSWLMLTPPVLFLLAFLGYPFFY |
| Ga0066395_104564092 | 3300004633 | Tropical Forest Soil | MSKILEARASTLAARAPRSFALRGFLEREAVFSWLMMTPPVLFLVAFLGYPF |
| Ga0058862_127987731 | 3300004803 | Host-Associated | LSEIFEVSRTGELAASVRRPLGRGGLRAFVERESVYSWLMLTPPLLFLLLFLG |
| Ga0066672_102348502 | 3300005167 | Soil | MSKVLEAARAGALPAPARRPFRLAAFMERESVFSWLMLTPPLL |
| Ga0066673_105956351 | 3300005175 | Soil | MSEVVEASRATALAAPARGSIRSGRLGALVQRESVFSWLMLTPPVLFL |
| Ga0066388_1049283151 | 3300005332 | Tropical Forest Soil | MSPGIEASPAAALETTARRLFGLGRLTAFVEREAVFSALMLTPPLLFLLGFLG |
| Ga0070705_1002713971 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | LSKVLEASRAGAVMAPARRPFRLAAFVERESVFSWLMLTPPLLFLLA |
| Ga0070705_1004879382 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | LSKILEAPRAGALTAPAHRPIRFGRLGAFLERESVFSWLMLTPP |
| Ga0070708_1007786932 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | LSKILEASRAGALAAPARRPFGLAAFIERESIFSWLMLTPPVLF |
| Ga0068867_1003031732 | 3300005459 | Miscanthus Rhizosphere | LSKILEAPRAGALTAPAHRPIRFGRLGAFLERESVFSWLMLTPPVLF |
| Ga0070698_1003502881 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | LSKILEAGRAGALEAAPARRPFRLAAFFDRESTFSWLMLTPPLLF |
| Ga0070699_1011425151 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | LSKILEASRAGALAAPARRPFRLAAFMERESVFSWLMLTPPLLFLLA |
| Ga0070697_1004589041 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VSKILEASRAGALAAPARRPLGWGGLRAFVERESVFSWLMLTPPVLFLLAFLGYPF |
| Ga0066701_100672443 | 3300005552 | Soil | MSKVLEAARAGALPAPARRPFRLAAFMERESVFSWLMLTPPMLFLLAF |
| Ga0066704_107028582 | 3300005557 | Soil | LSKILEASRTGALVTPVRRPLGWGALRAFVERESVFSWLMLTP |
| Ga0068854_1017765592 | 3300005578 | Corn Rhizosphere | VSTNPAVGTSGAAALGARAYRSVGVGQRLREFVEREWVFSWLILTPPLLFLLCFLGYPFFYGVYLSFFRRE |
| Ga0068866_114113671 | 3300005718 | Miscanthus Rhizosphere | MSRVVGASPATALETPAPRLLGLGRLAAFVEREAVFSWLM |
| Ga0066656_106674261 | 3300006034 | Soil | MSKVLEAARAGALPAPARRPFRLAAFMERESVFSWLMLTPPMLFLLAFL |
| Ga0075417_104175731 | 3300006049 | Populus Rhizosphere | VSKILEASRTGGLAASVRRPLGLGALRTFVERESVF |
| Ga0079220_101512591 | 3300006806 | Agricultural Soil | LSEIFEVSRTGELAASVRRPLGRGGLRAFVERESVYSWLMLTPPLLFLLLFL |
| Ga0075421_1023385681 | 3300006845 | Populus Rhizosphere | LSEIFEVSRTGELAASVRRPLGRSGLRAFVERESVYSWLMLTPPLLFLLLFLGYPFIY |
| Ga0075424_1005363491 | 3300006904 | Populus Rhizosphere | LSEIFEVSRTGELAASVRRPLGRGGLRAFVERESVYSWLMLTPPLL |
| Ga0075435_1012365312 | 3300007076 | Populus Rhizosphere | MSEVAEASRTTALAGPANRSLRVGRLGALVQRESVFSWLMVT |
| Ga0099829_113573562 | 3300009038 | Vadose Zone Soil | LSKILEASRTGALATPVRRPLGWGALRAFVERESVFSWLMLTPPLLFLLLFMC |
| Ga0099827_109050781 | 3300009090 | Vadose Zone Soil | MSKILEASRAGALEAPARRPFQVGRLRAFFERESV |
| Ga0105245_113383761 | 3300009098 | Miscanthus Rhizosphere | LSKILEASRAGPLAAPAHRPIGLGRLGAFVERESVFSWL |
| Ga0105243_117024602 | 3300009148 | Miscanthus Rhizosphere | MGRAVEASRAPALEARDYRPLRFGRFREFVERESVFSWLILTPPILFLLLFLGYPFF |
| Ga0105241_108222392 | 3300009174 | Corn Rhizosphere | MSKILEASRAGALAAPARRTLGLGRLHAFVERESV |
| Ga0126380_105883421 | 3300010043 | Tropical Forest Soil | MGRAVEASRATALEARDYRPLRFGRLREFVERESVFSWLVLTPPLLFLLLFLGYPFFYG |
| Ga0134082_102597821 | 3300010303 | Grasslands Soil | MSKVLEAARAGALPAPARRPFRLAAFMERESVFSWLM |
| Ga0134088_100317713 | 3300010304 | Grasslands Soil | MGRVVEASRAPALEARDYRPLRFGRLREFVERESVFSWLILTPPLLFLLLFLG |
| Ga0134109_100862261 | 3300010320 | Grasslands Soil | MNEVVEASRATALAAPAQGSFRLGRLGALVQRESVFSWLMLTPPVLF |
| Ga0134084_100740822 | 3300010322 | Grasslands Soil | MSKVLEAARAGALAVPARRPFRLAAFMERESVFSWLMLTPP |
| Ga0134111_104636841 | 3300010329 | Grasslands Soil | LSKILEASRARALAAPAHRPIRFGRLGAFMERESVFSWLMLTPPVLFLVAFLGYPF |
| Ga0126379_105002181 | 3300010366 | Tropical Forest Soil | MSPVVEASRATALPSRAYRPVRMSRLREFVERESVFSWLILTPPVLFLLAFLGYPFF |
| Ga0105239_107946381 | 3300010375 | Corn Rhizosphere | MSKILEASRAGALAAPARRTLGLGRLHAFVERESVFSWLMLTPPLLFLLAF |
| Ga0137461_10393642 | 3300012040 | Soil | MSKVLEAPRAGALSAPAHRPIRVGRFRGLVERESVFSWLMLTPPLLFLLAFL |
| Ga0137389_100412671 | 3300012096 | Vadose Zone Soil | LSKVLEASRAGALAAPARRPIRFGRFGAFMERESV |
| Ga0137389_114174941 | 3300012096 | Vadose Zone Soil | LSKILEASRAGALAAPARRAYRLAAFFERESVFSWLMLTPPLLFLL |
| Ga0137381_114017592 | 3300012207 | Vadose Zone Soil | LSKILEAGRAGALAAPVRRPFRLAAFFDRESTFSWLMLTP |
| Ga0137386_107409861 | 3300012351 | Vadose Zone Soil | LSKILEASRAGALAAPAHRPFRRAAFFERESVFSWLMLTPPLLFLLAFLGYP |
| Ga0137385_105773491 | 3300012359 | Vadose Zone Soil | MSKVLEAARAGALPAPARRPFRLAAFMERESVFSGLILTPPMLFLLSFLGYPFCYGVY |
| Ga0137375_102718001 | 3300012360 | Vadose Zone Soil | LSKVLEASRAGALAAPARRPIRFGRFGAFMERESVFS |
| Ga0137360_108979911 | 3300012361 | Vadose Zone Soil | LSKILEASRTGALAAPVRRPFRLAAFLESETVFSWLMLTPPLLFLLAF |
| Ga0137361_104637591 | 3300012362 | Vadose Zone Soil | LVSKILEASRAGALAAPARRPLGWGRLRAFVERESVFSWLMLTPPLLFL |
| Ga0137358_105722931 | 3300012582 | Vadose Zone Soil | LVSKILEASRAGALAAPARRPLGWGRLRAFVERESV |
| Ga0137404_118172311 | 3300012929 | Vadose Zone Soil | MSKVLEASRAGALEAPARRPFRLAGFFERESVFSWLMLTPPLLFLLAFL |
| Ga0137407_1000830012 | 3300012930 | Vadose Zone Soil | MSKVLEASRAGALMAPARRPFRLAGFFERESVFSWLMLTPPLLFLLAFLGYPFI |
| Ga0126369_127794732 | 3300012971 | Tropical Forest Soil | MSRVIEASPAAALETPARRPFGLGRLAAFVEREAVFSALMLTP |
| Ga0164307_101457232 | 3300012987 | Soil | LVSKILEASRAGALAAPARRPLGWGRLRAFVERESVFSWLMLTPPLLF |
| Ga0134081_103150112 | 3300014150 | Grasslands Soil | MNEVVEASRATALAAPAQGSFRLGRLGALVQRESVFSWLMLTPPVLFLLAFLGY |
| Ga0075354_10039361 | 3300014308 | Natural And Restored Wetlands | LSKILEAPRAGALMAPTHRPFRLAAFLAREPVFSSLMLTRTM |
| Ga0134089_105799742 | 3300015358 | Grasslands Soil | VSTNPAVGASGAAALEARGYRSVGLSRLREFIERESVFSWLILTPPLLFLLAFLGYP |
| Ga0182033_102947302 | 3300016319 | Soil | VSKILEARAPTLAARAARPFALRGLFDRESAFSWLMMTPPLLFLLAFLG |
| Ga0134069_10587121 | 3300017654 | Grasslands Soil | LSKILEASLAGALAAPAHRPIRFGRLGAFMERESVF |
| Ga0134083_100831362 | 3300017659 | Grasslands Soil | MSEVVEASRATALAAPARGSIRSGRLGALVQRESVFSWLMLTPPVLFLLAFLGY |
| Ga0187778_106853772 | 3300017961 | Tropical Peatland | LSKILEAGRPGALAAPIRRPFGRAAFCERESIFSWLMLTP |
| Ga0184608_101940641 | 3300018028 | Groundwater Sediment | VSKILEASRAGALAAPARRPFRLGAFVERESVFSWLMLTPPLLFLL |
| Ga0184620_102249951 | 3300018051 | Groundwater Sediment | MSEILEASRAGALAAPARRPLGLGRLRAFVERESVFSWLMLTPP |
| Ga0184626_100692352 | 3300018053 | Groundwater Sediment | MSKVLEASRAGARAAPAQRPFRLAAFVERESVFSWLM |
| Ga0184625_105653881 | 3300018081 | Groundwater Sediment | MSRVIGASPATTLATPARRALGRGRLAAFVERESVFSWLMLTPPLLFLL |
| Ga0066667_119213702 | 3300018433 | Grasslands Soil | MSPVVEASRAAALESRAYRPVAVRRLREFIERESVFSWLILTPPVLFLLAFLGYPFFY |
| Ga0184646_16042592 | 3300019259 | Groundwater Sediment | MSKVLEASRAGARAAPARRPFRLAAFVERESVFSWLMLTPPLLFLLAFLGY |
| Ga0193715_10287311 | 3300019878 | Soil | MSEILEASRAGALAAPARRPLGLGRLRAFVERESVFSWLMLTPPL |
| Ga0193715_11034672 | 3300019878 | Soil | LSKILEASRAGALAAPARRPFRLAAFLERESVFSWLMLTPPVLFLL |
| Ga0193729_11018601 | 3300019887 | Soil | VSKILEASRAGALAAPVRRPLGWGGLRAFVERESVFSWHML |
| Ga0193718_10287652 | 3300019999 | Soil | LSKILEAPRAGALAAPAHRSVRFGRLGAFVERESVFSWLMLTP |
| Ga0180109_12890181 | 3300020067 | Groundwater Sediment | LSKVLEASRAGALMAPARRPFRLGGFIERESVFSWLMLTPPVLFLLAFL |
| Ga0210382_102893341 | 3300021080 | Groundwater Sediment | MSEILEASRAGALAAPARRPLGLGRLRAFVERESVFSWLMLT |
| Ga0224452_10793891 | 3300022534 | Groundwater Sediment | MSKALEASREGALAAPSQRPFRLAAFVERESVFSWLMLTPPLLFL |
| Ga0224452_11694831 | 3300022534 | Groundwater Sediment | LSKILEASRAGALAAPARRPFGLGGLRAFLERESVFSWLMLTPPLLFLLAFLGYPF |
| Ga0207653_102925402 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | VSKILEASRTGGLAAPVRRPLGWGALRAFVEREAVFSWLMLTPPLLFL |
| Ga0207692_111566902 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | VSKILEASRTGALAAPVRRPLGWGALRAFVERESVFSWLML |
| Ga0207671_103688602 | 3300025914 | Corn Rhizosphere | LSEIFEVSRTSELAASVRRPLGRGGLRAFVERESVYSWL |
| Ga0207711_107762452 | 3300025941 | Switchgrass Rhizosphere | MSKILEASRAGALAAPARRTLGLGRLHAFVERESVFSW |
| Ga0207712_112790721 | 3300025961 | Switchgrass Rhizosphere | MSRVIGASPAAALETPARRALGLGRLAALVERESVFS |
| Ga0207668_103614612 | 3300025972 | Switchgrass Rhizosphere | LSKILEASRAGALAAPARRPFGLAAFIERESIFSWLMLTPPVLFLLLFL |
| Ga0207658_101525761 | 3300025986 | Switchgrass Rhizosphere | LSEIFEVSRTGELAASVRRPLGRGGLRAFVERESVYSWLMLT |
| Ga0207703_104985361 | 3300026035 | Switchgrass Rhizosphere | LSKILEASRAGPLAAPAHRPIGLGRLGAFVERESVFSWLMLTPPLLFLLAF |
| Ga0207641_103070041 | 3300026088 | Switchgrass Rhizosphere | LSEIFEVSRTGELAASVRRPLGRGGLRAFVERESVYSWLMLTPPLLFLLLFLGYPFIY |
| Ga0207648_122454702 | 3300026089 | Miscanthus Rhizosphere | LSKILEAPRAGALTAPAHRPIRFGRLGAFLERESVFSWLMLTPPVLFLLAFLGYPF |
| Ga0209059_12089151 | 3300026527 | Soil | MSKVLEAARAGALPAPARRPFRLAAFMERESVFSWLMLTPPMLFL |
| Ga0209378_12646551 | 3300026528 | Soil | MSKVLEAARAGALAVPARRPFRLAAFMERESVFSWLML |
| Ga0209056_101558242 | 3300026538 | Soil | MSPLVEASRAAALEARTYRPVRLGRLREFVEREQVFSWLILTPPVLFLLAFLGYPFLYG |
| Ga0207606_1015522 | 3300027178 | Soil | LSEIFEVSRTGELAASVRRPLGRGGLRAFVERESVY |
| Ga0209178_10872582 | 3300027725 | Agricultural Soil | LSEIFEVSRTGELAASVRRPLGRGGLRAFVERESVYSWLMLTPPLLFLLLFLGYPF |
| Ga0209180_104786851 | 3300027846 | Vadose Zone Soil | MSKILEASRAGALEAPARRPFQFGRLRAFFERESVF |
| Ga0207428_104291972 | 3300027907 | Populus Rhizosphere | VSTNPAVGTSGAAALEARAYRSVGLGRRLREFIEREWVFSWLILTPPLLFLLCFLGYPFF |
| Ga0307504_101380771 | 3300028792 | Soil | LSKILEAGRAGALAAPARRPFRLAAFFERESVFSWLMLTPPLLFLLAFLG |
| Ga0307292_101322492 | 3300028811 | Soil | MSEILEASRAGALAAPARRPLGLGRLRAFVERESVFSWLMLTPPLLFLLAFLGYPFF |
| Ga0307312_100608223 | 3300028828 | Soil | MSEILEASRAGALAAPARRPLGLGRLRAFVERESVFSWLMLTPPLLFLLAFLGY |
| Ga0318494_102118382 | 3300031751 | Soil | VSKILEARAPTLAAHAPRPLALRRLFDRESTFSWLMMTPPLLFLLAFLGYPF |
| Ga0318535_104829292 | 3300031764 | Soil | VSKILEARAPTLAAHAPRPLALRRLFDRESTFSWLMMTPPLLFLLAFLG |
| Ga0326597_114220771 | 3300031965 | Soil | MSKVLEASRAGALMAPAHRPIRVGRLRAFVERESVFSWLMLTPPLLFLLAFLGYPF |
| Ga0307470_116982082 | 3300032174 | Hardwood Forest Soil | LSKILEAPRAGALTAPAHRPIRFGRLGALVERESVYSWLMITPPVLFLL |
| Ga0310889_101873552 | 3300032179 | Soil | MGRVVEASRAPALEARAYRSVRSSRLREFVERESVFSWLILTPPILFLLLFLGYPFFYG |
| Ga0247830_100987331 | 3300033551 | Soil | MSRVIGASPATALATPAPRPLGLGRLAAFVERESVFSWLMLTPPLLFLL |
| Ga0314781_096276_446_589 | 3300034660 | Soil | MSEIFEVSRTGELAASVRRPLGRGGLRAFVERESVYSWLMLTPPLLFL |
| ⦗Top⦘ |