


| Basic Information | |
|---|---|
| Family ID | F102792 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 101 |
| Average Sequence Length | 37 residues |
| Representative Sequence | MKKTSITVTEAARNFADCVNRAHYQNVTFVLLKNG |
| Number of Associated Samples | 95 |
| Number of Associated Scaffolds | 101 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 13.86 % |
| % of genes near scaffold ends (potentially truncated) | 97.03 % |
| % of genes from short scaffolds (< 2000 bps) | 91.09 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (86.139 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa (6.931 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.733 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.525 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.98% β-sheet: 0.00% Coil/Unstructured: 73.02% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 101 Family Scaffolds |
|---|---|---|
| PF03544 | TonB_C | 6.93 |
| PF02195 | ParBc | 5.94 |
| PF02604 | PhdYeFM_antitox | 4.95 |
| PF00069 | Pkinase | 3.96 |
| PF03739 | LptF_LptG | 2.97 |
| PF13614 | AAA_31 | 1.98 |
| PF14534 | DUF4440 | 1.98 |
| PF03061 | 4HBT | 0.99 |
| PF00717 | Peptidase_S24 | 0.99 |
| PF01434 | Peptidase_M41 | 0.99 |
| PF13470 | PIN_3 | 0.99 |
| PF17132 | Glyco_hydro_106 | 0.99 |
| PF00488 | MutS_V | 0.99 |
| PF13103 | TonB_2 | 0.99 |
| PF00578 | AhpC-TSA | 0.99 |
| PF02754 | CCG | 0.99 |
| PF13173 | AAA_14 | 0.99 |
| PF01402 | RHH_1 | 0.99 |
| PF13565 | HTH_32 | 0.99 |
| PF01346 | FKBP_N | 0.99 |
| PF01180 | DHO_dh | 0.99 |
| PF13714 | PEP_mutase | 0.99 |
| PF00005 | ABC_tran | 0.99 |
| PF13744 | HTH_37 | 0.99 |
| PF02537 | CRCB | 0.99 |
| PF00919 | UPF0004 | 0.99 |
| PF02843 | GARS_C | 0.99 |
| PF01833 | TIG | 0.99 |
| PF13563 | 2_5_RNA_ligase2 | 0.99 |
| PF03352 | Adenine_glyco | 0.99 |
| PF03030 | H_PPase | 0.99 |
| PF13520 | AA_permease_2 | 0.99 |
| PF02518 | HATPase_c | 0.99 |
| PF13502 | AsmA_2 | 0.99 |
| PF13320 | DUF4091 | 0.99 |
| PF08840 | BAAT_C | 0.99 |
| PF13007 | LZ_Tnp_IS66 | 0.99 |
| PF01545 | Cation_efflux | 0.99 |
| PF01370 | Epimerase | 0.99 |
| PF03358 | FMN_red | 0.99 |
| COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 15.84 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 6.93 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 4.95 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 4.95 |
| COG0795 | Lipopolysaccharide export LptBFGC system, permease protein LptF | Cell wall/membrane/envelope biogenesis [M] | 2.97 |
| COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 0.99 |
| COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 0.99 |
| COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 0.99 |
| COG0151 | Phosphoribosylamine-glycine ligase | Nucleotide transport and metabolism [F] | 0.99 |
| COG0167 | Dihydroorotate dehydrogenase | Nucleotide transport and metabolism [F] | 0.99 |
| COG0239 | Fluoride ion exporter CrcB/FEX, affects chromosome condensation | Cell cycle control, cell division, chromosome partitioning [D] | 0.99 |
| COG0247 | Fe-S cluster-containing oxidoreductase, includes glycolate oxidase subunit GlcF | Energy production and conversion [C] | 0.99 |
| COG0249 | DNA mismatch repair ATPase MutS | Replication, recombination and repair [L] | 0.99 |
| COG0465 | ATP-dependent Zn proteases | Posttranslational modification, protein turnover, chaperones [O] | 0.99 |
| COG0545 | FKBP-type peptidyl-prolyl cis-trans isomerase | Posttranslational modification, protein turnover, chaperones [O] | 0.99 |
| COG0621 | tRNA A37 methylthiotransferase MiaB | Translation, ribosomal structure and biogenesis [J] | 0.99 |
| COG1193 | dsDNA-specific endonuclease/ATPase MutS2 | Replication, recombination and repair [L] | 0.99 |
| COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 0.99 |
| COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 0.99 |
| COG2048 | Heterodisulfide reductase, subunit B | Energy production and conversion [C] | 0.99 |
| COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 0.99 |
| COG2818 | 3-methyladenine DNA glycosylase Tag | Replication, recombination and repair [L] | 0.99 |
| COG3808 | Na+ or H+-translocating membrane pyrophosphatase | Energy production and conversion [C] | 0.99 |
| COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 0.99 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 86.14 % |
| Unclassified | root | N/A | 13.86 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090014|GPIPI_16834612 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1301 | Open in IMG/M |
| 3300001593|JGI12635J15846_10056166 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 2974 | Open in IMG/M |
| 3300004635|Ga0062388_101090776 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300004806|Ga0007854_10291459 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300005177|Ga0066690_10957926 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300005445|Ga0070708_102018495 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 534 | Open in IMG/M |
| 3300005529|Ga0070741_11579202 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300005538|Ga0070731_10176270 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1419 | Open in IMG/M |
| 3300005538|Ga0070731_10846182 | Not Available | 607 | Open in IMG/M |
| 3300005563|Ga0068855_102097337 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300005568|Ga0066703_10532625 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300005993|Ga0080027_10005882 | All Organisms → cellular organisms → Bacteria | 4535 | Open in IMG/M |
| 3300006806|Ga0079220_11473374 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
| 3300009075|Ga0105090_10256052 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1076 | Open in IMG/M |
| 3300009088|Ga0099830_10232104 | All Organisms → cellular organisms → Bacteria | 1454 | Open in IMG/M |
| 3300009137|Ga0066709_100894901 | All Organisms → cellular organisms → Bacteria | 1293 | Open in IMG/M |
| 3300009524|Ga0116225_1429582 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300009665|Ga0116135_1275393 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300009764|Ga0116134_1054686 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1517 | Open in IMG/M |
| 3300009838|Ga0116153_10348550 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300010343|Ga0074044_10084099 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2147 | Open in IMG/M |
| 3300012198|Ga0137364_11041036 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 617 | Open in IMG/M |
| 3300012205|Ga0137362_11728800 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300012362|Ga0137361_11149056 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300012929|Ga0137404_11941249 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
| 3300013297|Ga0157378_12497067 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 569 | Open in IMG/M |
| 3300014167|Ga0181528_10542746 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 641 | Open in IMG/M |
| 3300014169|Ga0181531_10092502 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1801 | Open in IMG/M |
| 3300014495|Ga0182015_10351046 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 957 | Open in IMG/M |
| 3300014654|Ga0181525_10436243 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 721 | Open in IMG/M |
| 3300014838|Ga0182030_10985093 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 744 | Open in IMG/M |
| 3300014839|Ga0182027_10368626 | All Organisms → cellular organisms → Bacteria | 1605 | Open in IMG/M |
| 3300015167|Ga0167661_1058391 | Not Available | 719 | Open in IMG/M |
| 3300016294|Ga0182041_11353645 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300017955|Ga0187817_10509920 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 767 | Open in IMG/M |
| 3300017975|Ga0187782_10975880 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 658 | Open in IMG/M |
| 3300017975|Ga0187782_11592475 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300018037|Ga0187883_10261543 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 885 | Open in IMG/M |
| 3300018040|Ga0187862_10214529 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1256 | Open in IMG/M |
| 3300018047|Ga0187859_10423425 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 733 | Open in IMG/M |
| 3300018062|Ga0187784_10813306 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 745 | Open in IMG/M |
| 3300020021|Ga0193726_1105450 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1272 | Open in IMG/M |
| 3300021171|Ga0210405_10016708 | All Organisms → cellular organisms → Bacteria | 6022 | Open in IMG/M |
| 3300021406|Ga0210386_10823418 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300021560|Ga0126371_10123092 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2621 | Open in IMG/M |
| 3300023068|Ga0224554_1128895 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300023091|Ga0224559_1167271 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 774 | Open in IMG/M |
| 3300023247|Ga0224529_1047008 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 766 | Open in IMG/M |
| 3300025439|Ga0208323_1078873 | Not Available | 550 | Open in IMG/M |
| 3300025504|Ga0208356_1039480 | Not Available | 962 | Open in IMG/M |
| 3300025506|Ga0208937_1036975 | Not Available | 1174 | Open in IMG/M |
| 3300025536|Ga0207952_1030103 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1015 | Open in IMG/M |
| 3300025888|Ga0209540_10579124 | Not Available | 572 | Open in IMG/M |
| 3300025914|Ga0207671_11440495 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300026041|Ga0207639_10539799 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1070 | Open in IMG/M |
| 3300026304|Ga0209240_1212928 | Not Available | 585 | Open in IMG/M |
| 3300026377|Ga0257171_1065927 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 633 | Open in IMG/M |
| 3300027394|Ga0209904_1010128 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 692 | Open in IMG/M |
| 3300027652|Ga0209007_1169545 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300027745|Ga0209908_10173278 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
| 3300027768|Ga0209772_10015411 | All Organisms → cellular organisms → Bacteria | 2131 | Open in IMG/M |
| 3300027842|Ga0209580_10316558 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 777 | Open in IMG/M |
| 3300027986|Ga0209168_10158055 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii | 1147 | Open in IMG/M |
| 3300028552|Ga0302149_1187804 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
| 3300028779|Ga0302266_10280271 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 614 | Open in IMG/M |
| 3300029636|Ga0222749_10530873 | Not Available | 639 | Open in IMG/M |
| 3300029636|Ga0222749_10771235 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300029914|Ga0311359_10799232 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 661 | Open in IMG/M |
| 3300029945|Ga0311330_11028384 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 607 | Open in IMG/M |
| 3300029984|Ga0311332_11411697 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 563 | Open in IMG/M |
| 3300029999|Ga0311339_10418003 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 1392 | Open in IMG/M |
| 3300030057|Ga0302176_10278794 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300030225|Ga0302196_10276295 | Not Available | 779 | Open in IMG/M |
| 3300030503|Ga0311370_12380616 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
| 3300030617|Ga0311356_11508015 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 608 | Open in IMG/M |
| 3300031027|Ga0302308_10181704 | Not Available | 1362 | Open in IMG/M |
| 3300031234|Ga0302325_12622170 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300031235|Ga0265330_10449406 | Not Available | 547 | Open in IMG/M |
| 3300031235|Ga0265330_10472577 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300031241|Ga0265325_10453875 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
| 3300031258|Ga0302318_10427399 | Not Available | 669 | Open in IMG/M |
| 3300031525|Ga0302326_10982767 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1188 | Open in IMG/M |
| 3300031564|Ga0318573_10231225 | All Organisms → cellular organisms → Bacteria | 984 | Open in IMG/M |
| 3300031708|Ga0310686_112727795 | All Organisms → cellular organisms → Bacteria | 4151 | Open in IMG/M |
| 3300031941|Ga0310912_10550513 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 898 | Open in IMG/M |
| 3300032001|Ga0306922_11127269 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300032160|Ga0311301_10381645 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2174 | Open in IMG/M |
| 3300032160|Ga0311301_12003444 | Not Available | 676 | Open in IMG/M |
| 3300032180|Ga0307471_103720826 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300032342|Ga0315286_10557656 | All Organisms → cellular organisms → Bacteria | 1186 | Open in IMG/M |
| 3300032401|Ga0315275_11301807 | Not Available | 787 | Open in IMG/M |
| 3300032561|Ga0316222_1274416 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300032783|Ga0335079_10870451 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
| 3300032893|Ga0335069_11121663 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 866 | Open in IMG/M |
| 3300032896|Ga0335075_10693227 | All Organisms → cellular organisms → Bacteria | 981 | Open in IMG/M |
| 3300032898|Ga0335072_10384943 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1514 | Open in IMG/M |
| 3300033402|Ga0326728_10192293 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium | 2079 | Open in IMG/M |
| 3300033405|Ga0326727_10649824 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 860 | Open in IMG/M |
| 3300033405|Ga0326727_10906931 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300034091|Ga0326724_0370343 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300034170|Ga0370487_0338234 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 514 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.93% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 6.93% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 5.94% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.95% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 4.95% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.96% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.96% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 3.96% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.97% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.97% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.97% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.97% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 2.97% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 2.97% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.98% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.98% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.98% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.98% |
| Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 1.98% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.98% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.98% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.99% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.99% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 0.99% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.99% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.99% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.99% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.99% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.99% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.99% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.99% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.99% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.99% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.99% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.99% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.99% |
| Serpentinite Rock And Fluid | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Serpentinite Rock And Fluid | 0.99% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.99% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.99% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.99% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 0.99% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004806 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug08 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300009075 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300009838 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC028_MetaG | Engineered | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014167 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015167 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11b, vegetated hydrological feature) | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300023068 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 20-24 | Environmental | Open in IMG/M |
| 3300023091 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 30-34 | Environmental | Open in IMG/M |
| 3300023247 | Peat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T50 | Environmental | Open in IMG/M |
| 3300025439 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025504 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025506 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025536 | Serpentinite rock and fluid subsurface biosphere microbial communities from McLaughlin Reserve, California, USA - CR12Aug_8Ca (SPAdes) | Environmental | Open in IMG/M |
| 3300025888 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-21A (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026377 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-B | Environmental | Open in IMG/M |
| 3300027394 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 712P3D | Environmental | Open in IMG/M |
| 3300027652 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027745 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2M | Environmental | Open in IMG/M |
| 3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028552 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_1 | Environmental | Open in IMG/M |
| 3300028779 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_2 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029914 | III_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029945 | I_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029984 | I_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030225 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_3 | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300031027 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Host-Associated | Open in IMG/M |
| 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Host-Associated | Open in IMG/M |
| 3300031258 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_1 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
| 3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
| 3300032561 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18011 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| 3300034091 | Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00N | Environmental | Open in IMG/M |
| 3300034170 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_03D_16 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPIPI_02627380 | 2088090014 | Soil | MKKTSITVTEASRNFADCVNRAHYQNVTFVLLKNGE |
| JGI12635J15846_100561664 | 3300001593 | Forest Soil | VKKTTISVTEAARNFADCLNRSHYQDVTFVLLKNGAP |
| Ga0062388_1010907762 | 3300004635 | Bog Forest Soil | MTKVSITVTEAARNFSDCINRARYQDVTFLLLKNGSPVAE |
| Ga0007854_102914591 | 3300004806 | Freshwater | MQTKAISVTEAARNFADCVNRVHYQNVTYVLLKNGLPFAR |
| Ga0066690_109579261 | 3300005177 | Soil | MKRTTITVTDAARNFADCVIRAHYQNVIFVLLKNGTPFARLVPHDE |
| Ga0070708_1020184951 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKTSITVTEASRNFADCVNRAHYQNVTFVLLKNGEPVAR |
| Ga0070741_115792021 | 3300005529 | Surface Soil | MKEVSITVTEAARMFADCVNRAHYQNMAFVLTKNGKPVARLVPE |
| Ga0070731_101762703 | 3300005538 | Surface Soil | MRKLTISVTEAARNFADCVNRAHYQNITFLLVKNGSPWPD* |
| Ga0070731_108461822 | 3300005538 | Surface Soil | MKTTSISVTEAARNFSDCVSRAHYQNVTFVLLKNGAPF |
| Ga0068855_1020973371 | 3300005563 | Corn Rhizosphere | MAKRTISVTEAARNFADCVNRAHYQNVTFVLLKNGA |
| Ga0066703_105326251 | 3300005568 | Soil | MKKTNITVTEAARNFADCVNRVHYQNVTFVLLKNGKPFARLV |
| Ga0080027_100058821 | 3300005993 | Prmafrost Soil | MKKTSISVTEAARNFADCVNRVRYQNMSFVLLKNGS |
| Ga0079220_114733741 | 3300006806 | Agricultural Soil | MKKTGISLTEAARNFADCVNRVHYQNMTFVLLKNGEPF |
| Ga0105090_102560521 | 3300009075 | Freshwater Sediment | VITVTEAARNFAHCVNRAHYQPTTFVLLKNGKRFARL |
| Ga0099830_102321044 | 3300009088 | Vadose Zone Soil | MKKTSITVTEAARNFADCVNRVHYQNVTFVLVKNG |
| Ga0066709_1008949011 | 3300009137 | Grasslands Soil | VKKTTITVTEAARNFADCVNRAHYQNVTFVLLKNGVP |
| Ga0116225_14295822 | 3300009524 | Peatlands Soil | VRQTIITVTEAARNFADCVNRAHYQNVTFVLLKNGSP |
| Ga0116135_12753932 | 3300009665 | Peatland | MKTTTISVTEAARNFADCVNRVRYQNVSYVLLKNGRPV |
| Ga0116134_10546861 | 3300009764 | Peatland | MDTVAISVTEASRNFADCVNRARYQGTTFVLEKNGN |
| Ga0116153_103485501 | 3300009838 | Anaerobic Digestor Sludge | MKRKTITVTEAARNFADCVNRAHYQHTTFVLLKNGR |
| Ga0074044_100840992 | 3300010343 | Bog Forest Soil | MPKTLITVTEAARNFADCVNRAHYQNVTFVLLKNG |
| Ga0137364_110410361 | 3300012198 | Vadose Zone Soil | MKRLISVTEAARNFADCVNRVRYQNVTYVLLKNGF |
| Ga0137362_117288001 | 3300012205 | Vadose Zone Soil | MKKTAITVTQASRNFADCVNRVHYQNLTFVLLRNGRPVAHIS |
| Ga0137361_111490561 | 3300012362 | Vadose Zone Soil | MKKTTITVTEAARNFADCVNRAHYQNVTFVLLKNGV |
| Ga0137404_119412491 | 3300012929 | Vadose Zone Soil | MEKKGISVTEAARNFSECVNRVRYQNVTYVLLKNGRPVAR |
| Ga0157378_124970671 | 3300013297 | Miscanthus Rhizosphere | MKKVEISVTDASRNFADCVNRVHYQNITFVLLKNGRPVARISP |
| Ga0181528_105427461 | 3300014167 | Bog | MREQAISVTEAARNFSDCINRARYQGTTFILHKNGV |
| Ga0181531_100925021 | 3300014169 | Bog | MEIVSISVTEASRNFADCVNRARYQGTTFILEKNG |
| Ga0182015_103510461 | 3300014495 | Palsa | MSEKAISVTEAARNFADCINRAHYQGTTFILHKNG |
| Ga0181525_104362432 | 3300014654 | Bog | METVSISVTEASRNFADCVNRARYQGTTFVLEKNGN |
| Ga0182030_109850932 | 3300014838 | Bog | MKLKEISVTEAARNFAECVNQVRYQNAGFVLMKNG |
| Ga0182027_103686263 | 3300014839 | Fen | MKETTITVTEAARNFADCVNRAHYQNTSFVLLKNG |
| Ga0167661_10583911 | 3300015167 | Glacier Forefield Soil | MKKMAITVTVTEAARNFAHCINRVHYQNRSFVLVKNGKP |
| Ga0182041_113536452 | 3300016294 | Soil | MKKTNITVTDASRNFADCVNRAHYQNVTFILVKNGEPVARLV |
| Ga0187817_105099203 | 3300017955 | Freshwater Sediment | MKKMPISVTEAARNFADCVNRVRYQNVTFVLLKNGKPV |
| Ga0187782_109758802 | 3300017975 | Tropical Peatland | MEIVPISVTEASRNFADCVNRARYQGTTFILEKNGNAIA |
| Ga0187782_115924751 | 3300017975 | Tropical Peatland | MEIRPITVTEASRNFADCINRARYQGVSFLLIKGG |
| Ga0187883_102615431 | 3300018037 | Peatland | MEVVSISVTEASRNFADCVNRARYQGTTFILEKNGVQVARI |
| Ga0187862_102145293 | 3300018040 | Peatland | METVSISVTEASRNFADCVNRARYQGTTFILEKNG |
| Ga0187859_104234252 | 3300018047 | Peatland | MEIVSISVTEASRNFADCVNRARYQGTIFILEKNGVPVARIV |
| Ga0187784_108133062 | 3300018062 | Tropical Peatland | METQAISVTEASRNFADCVNRARYQGTSFLLLKAGEP |
| Ga0193726_11054501 | 3300020021 | Soil | MKKTVISVTEAARNFADCVNRAHYQNITFVLLKNGS |
| Ga0210405_100167089 | 3300021171 | Soil | MKKTSITVTEAARNFADCVNRVHYQNMTFVLVKNGEPFARL |
| Ga0210386_108234182 | 3300021406 | Soil | MRTTAISVTEAARNFADCVNRVRYQNMSFVLLKNGTP |
| Ga0126371_101230924 | 3300021560 | Tropical Forest Soil | MKETAITVTEAARNFSEYLNRAHYQNVTFVLLKNGMPFARLMPDH |
| Ga0224554_11288952 | 3300023068 | Soil | MKKHFISVTEAARNFADCVNRAHYQNVTFVLLKNGTAF |
| Ga0224559_11672712 | 3300023091 | Soil | MEIVSISVTEASRNFADCVNRARYQGTTFILEKNGIP |
| Ga0224529_10470082 | 3300023247 | Soil | MEIVSISVTEASRNFADCVNRAHYQGTTFILEKNGI |
| Ga0208323_10788732 | 3300025439 | Peatland | MKETTITVTEAARNFADCVNRAHYQNTTFVLLKNGKP |
| Ga0208356_10394802 | 3300025504 | Arctic Peat Soil | MKKTSISVTEAARNFAHCINRVHYQNRSFVLVKNGRPLAR |
| Ga0208937_10369753 | 3300025506 | Peatland | MKTTTISVTEAARNFADCVNRAHYQNVTFVLLRNG |
| Ga0207952_10301033 | 3300025536 | Serpentinite Rock And Fluid | MTETTITVIEAARNLADCVNRAHYQNTTFVFLQDGVPFARLV |
| Ga0209540_105791242 | 3300025888 | Arctic Peat Soil | MKNTAITVTEAARNFAHCINRVHYQNRSFVLVKNG |
| Ga0207671_114404951 | 3300025914 | Corn Rhizosphere | MKKTSITVTEASRNFADCVNRAHYQNVTFVLLKNGEPV |
| Ga0207639_105397992 | 3300026041 | Corn Rhizosphere | MKKTSITVTEASRNFADCVNRAHYQNVTFVLLKNG |
| Ga0209240_12129282 | 3300026304 | Grasslands Soil | MKKSAITVTEAARNFADCVNRVHYQHISFVLLKNGKPV |
| Ga0257171_10659272 | 3300026377 | Soil | MKKTSITVTEAARNFADCVNRAHYQNVTFVLLKNG |
| Ga0209904_10101281 | 3300027394 | Thawing Permafrost | MKELTISVTVAARRFADCINRVRYQGTSFILHKNGVP |
| Ga0209007_11695451 | 3300027652 | Forest Soil | MKEETISVTEAARNFADCVNRSHYQDVTFILLKNGE |
| Ga0209908_101732782 | 3300027745 | Thawing Permafrost | MREKVITVTEAARNFADCVNRAHYQGMTFILQKNG |
| Ga0209772_100154111 | 3300027768 | Bog Forest Soil | MKKTSLSVTEAARNFADCVNRAHYQNVTFVLLKNGKP |
| Ga0209580_103165582 | 3300027842 | Surface Soil | MKKTIISVTEAARNFAECVNRVRYQNMTFVLVKNG |
| Ga0209168_101580552 | 3300027986 | Surface Soil | MRKTEKITVTEASRNFADCVNRARYQNASFVLTKNGEAVA |
| Ga0302149_11878041 | 3300028552 | Bog | MEIVSISVTEASRNFADCVNRARYQGTTFVLEKNGNPV |
| Ga0302266_102802711 | 3300028779 | Bog | MSEKVISVTEAARNFADCVNRTRYQGTTFVLHKNG |
| Ga0222749_105308732 | 3300029636 | Soil | MKRKTITVTEAARNFGNYVNRAHYQNTTFVLLKNGRPFGCG |
| Ga0222749_107712352 | 3300029636 | Soil | MKKTNITVTEAARNFADCVNRVHYQNVSFVLLKNGEPFAR |
| Ga0311359_107992322 | 3300029914 | Bog | MPDRNISVTEAARNFSDCVNRAHYQATTFILLKNG |
| Ga0311330_110283841 | 3300029945 | Bog | MKKVISVTEAARNFADCVNRAHYQNVTFVLLKNGAP |
| Ga0311332_114116972 | 3300029984 | Fen | MRELVISVTQAARRFADCINRVRYQNTSFVLHRNGVP |
| Ga0311339_104180031 | 3300029999 | Palsa | MKEKVITVTEAARNFAECVNRTHYQGMTFILHKNGVP |
| Ga0302176_102787942 | 3300030057 | Palsa | MKTTTISVTDAARNFADCVNRVHYQNVSYVLLKNGKPVAR |
| Ga0302196_102762952 | 3300030225 | Bog | MSTKAITVTEAARNFADCVNRVRYQGTTFVLQKNGVPV |
| Ga0311370_123806162 | 3300030503 | Palsa | VDEKAISVTEAARNFADCINRAHYQGVTFILHKNG |
| Ga0311356_115080152 | 3300030617 | Palsa | MKTTPISVTEAARNFADCVNRVRYQNVSFVLLKNGRPVA |
| Ga0302308_101817042 | 3300031027 | Palsa | MSEKAITVTEAARNFADCVNRVRYQGTTFVLHKNGVPVA |
| Ga0302325_126221702 | 3300031234 | Palsa | MKTTAISVTEAARNFADCVNRVRYQNVTFVLLKNGTPRGASSSGE |
| Ga0265330_104494061 | 3300031235 | Rhizosphere | MKETAITVTEAARNFSDCLNRAHYQNMSFVLLKNGKPFAR |
| Ga0265330_104725772 | 3300031235 | Rhizosphere | MKELVISVTQAARRFSDCVNRVRYQGTSFVLQKNGV |
| Ga0265325_104538752 | 3300031241 | Rhizosphere | MKELTISVTQAARRFADCVNRVRYQGTSFVLHKNGVPVAR |
| Ga0302318_104273992 | 3300031258 | Bog | MSERIITVTEAARNFADCINRARYQGTTFVLQKNGLP |
| Ga0302326_109827672 | 3300031525 | Palsa | MIKTTISVTEASRNFADCVSRAHYQNVTFVLLKNGVP |
| Ga0318573_102312251 | 3300031564 | Soil | MKKTSITVTDASRNFADCVNRAHYQKITFVLLKNG |
| Ga0310686_1127277954 | 3300031708 | Soil | MKKTSITVTEASRNFAECVNRAHYQKVTFVLLKNGEPV |
| Ga0310912_105505131 | 3300031941 | Soil | MKKTISISVTDAARNFSDCINRVRYQGVSFVLHKNGVPVAR |
| Ga0306922_111272692 | 3300032001 | Soil | MKKRSITVTEASRNFAECVNRAHYQNVTFVLLKNGE |
| Ga0311301_103816451 | 3300032160 | Peatlands Soil | METHAISVTEASRNFADFVSRARYQGTSFLLLKEGEPVAR |
| Ga0311301_120034441 | 3300032160 | Peatlands Soil | MRTTTINVTEAARNFADCVNRAHDQNVSIVLLKNGLPFARLVPE |
| Ga0307471_1037208261 | 3300032180 | Hardwood Forest Soil | MRKTNISVTEAARNFADCVNRAHYQNVTFVLLKNGEPF |
| Ga0315286_105576562 | 3300032342 | Sediment | MKETTITVTEAARNFSDCVNRARYQHVTFVLVKNGRPV |
| Ga0315275_113018071 | 3300032401 | Sediment | MKETTITVTEAARNFSDCVNRARYQHVTFVLVKNGRP |
| Ga0316222_12744161 | 3300032561 | Freshwater | MQKANISVTEAARNFADCVNRAHYQNVTFILLKNG |
| Ga0335079_108704511 | 3300032783 | Soil | MHKTIITVTQAARHFADCVNRAHYQNVTFVLVKNGSPV |
| Ga0335069_111216631 | 3300032893 | Soil | MKETTITVTEAARSFAECVNRAHYQRTTFVLLKNGRPFARIE |
| Ga0335075_106932272 | 3300032896 | Soil | MRRIAITVTKAVRSFADCINRVHYQDVTFVLLKNGTAVAELAP |
| Ga0335072_103849431 | 3300032898 | Soil | MRSVSISVTEAARNFADCINRVRYQGISFILHRNG |
| Ga0326728_101922932 | 3300033402 | Peat Soil | MKEKTITVTEAARNFADCVNRAHYQHTTFVLLKNG |
| Ga0326727_106498242 | 3300033405 | Peat Soil | METVSISVTEASRNFADCVNRARYQDVSFILLKNGNP |
| Ga0326727_109069312 | 3300033405 | Peat Soil | MKKAVITVTEAARNFAHCVNRAHHQNTSFVLLQNGKPA |
| Ga0326724_0370343_3_107 | 3300034091 | Peat Soil | MREKAISVTEAARNFADCVNRAHYQGMTFVLYKNG |
| Ga0370487_0338234_1_123 | 3300034170 | Untreated Peat Soil | MRSKIITVTEAARNFADCVNRVRYQNCAFTLVKNGTPVASL |
| ⦗Top⦘ |