


| Basic Information | |
|---|---|
| Family ID | F102754 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 101 |
| Average Sequence Length | 40 residues |
| Representative Sequence | ALVALTLVAAVWVALHAYEIIWWREARARTRALRLPASA |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 101 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 96.04 % |
| % of genes from short scaffolds (< 2000 bps) | 93.07 % |
| Associated GOLD sequencing projects | 89 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.57 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.079 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (18.812 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.723 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.525 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 49.25% β-sheet: 0.00% Coil/Unstructured: 50.75% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.57 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 101 Family Scaffolds |
|---|---|---|
| PF06224 | HTH_42 | 4.95 |
| PF00909 | Ammonium_transp | 4.95 |
| PF06348 | DUF1059 | 4.95 |
| PF13462 | Thioredoxin_4 | 3.96 |
| PF01243 | Putative_PNPOx | 3.96 |
| PF08241 | Methyltransf_11 | 2.97 |
| PF01434 | Peptidase_M41 | 1.98 |
| PF00903 | Glyoxalase | 1.98 |
| PF07992 | Pyr_redox_2 | 1.98 |
| PF08327 | AHSA1 | 1.98 |
| PF05988 | DUF899 | 1.98 |
| PF06772 | LtrA | 1.98 |
| PF13847 | Methyltransf_31 | 0.99 |
| PF03795 | YCII | 0.99 |
| PF03551 | PadR | 0.99 |
| PF08281 | Sigma70_r4_2 | 0.99 |
| PF06480 | FtsH_ext | 0.99 |
| PF13472 | Lipase_GDSL_2 | 0.99 |
| PF00118 | Cpn60_TCP1 | 0.99 |
| PF01494 | FAD_binding_3 | 0.99 |
| PF15780 | ASH | 0.99 |
| PF02826 | 2-Hacid_dh_C | 0.99 |
| PF09335 | SNARE_assoc | 0.99 |
| PF08308 | PEGA | 0.99 |
| PF03176 | MMPL | 0.99 |
| PF01565 | FAD_binding_4 | 0.99 |
| PF09413 | DUF2007 | 0.99 |
| PF00150 | Cellulase | 0.99 |
| PF13671 | AAA_33 | 0.99 |
| PF00004 | AAA | 0.99 |
| PF14534 | DUF4440 | 0.99 |
| PF14342 | DUF4396 | 0.99 |
| PF07510 | DUF1524 | 0.99 |
| PF00999 | Na_H_Exchanger | 0.99 |
| PF00462 | Glutaredoxin | 0.99 |
| PF01510 | Amidase_2 | 0.99 |
| PF08240 | ADH_N | 0.99 |
| PF12697 | Abhydrolase_6 | 0.99 |
| PF07690 | MFS_1 | 0.99 |
| PF01266 | DAO | 0.99 |
| PF01370 | Epimerase | 0.99 |
| PF06803 | DUF1232 | 0.99 |
| PF13365 | Trypsin_2 | 0.99 |
| PF13419 | HAD_2 | 0.99 |
| PF03061 | 4HBT | 0.99 |
| COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
|---|---|---|---|
| COG0004 | Ammonia channel protein AmtB | Inorganic ion transport and metabolism [P] | 4.95 |
| COG3214 | DNA glycosylase YcaQ, repair of DNA interstrand crosslinks | Replication, recombination and repair [L] | 4.95 |
| COG0465 | ATP-dependent Zn proteases | Posttranslational modification, protein turnover, chaperones [O] | 2.97 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.98 |
| COG4292 | Low temperature requirement protein LtrA (function unknown) | Function unknown [S] | 1.98 |
| COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 1.98 |
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 0.99 |
| COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 0.99 |
| COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 0.99 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 0.99 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.99 |
| COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 0.99 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.99 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.99 |
| COG1033 | Predicted exporter protein, RND superfamily | General function prediction only [R] | 0.99 |
| COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 0.99 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.99 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.99 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.99 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.99 |
| COG2409 | Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily | General function prediction only [R] | 0.99 |
| COG2730 | Aryl-phospho-beta-D-glucosidase BglC, GH1 family | Carbohydrate transport and metabolism [G] | 0.99 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 0.99 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 0.99 |
| COG3339 | Uncharacterized membrane protein YkvA, DUF1232 family | Function unknown [S] | 0.99 |
| COG3934 | Endo-1,4-beta-mannosidase | Carbohydrate transport and metabolism [G] | 0.99 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 0.99 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 93.07 % |
| Unclassified | root | N/A | 6.93 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000033|ICChiseqgaiiDRAFT_c0266412 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300000550|F24TB_11264893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 520 | Open in IMG/M |
| 3300000891|JGI10214J12806_12152706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 951 | Open in IMG/M |
| 3300000955|JGI1027J12803_105156163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 908 | Open in IMG/M |
| 3300000956|JGI10216J12902_101643668 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 608 | Open in IMG/M |
| 3300001538|A10PFW1_10030239 | All Organisms → cellular organisms → Bacteria | 984 | Open in IMG/M |
| 3300002568|C688J35102_120880165 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1984 | Open in IMG/M |
| 3300004480|Ga0062592_101258648 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 695 | Open in IMG/M |
| 3300004643|Ga0062591_100079975 | All Organisms → cellular organisms → Bacteria | 2023 | Open in IMG/M |
| 3300005180|Ga0066685_10184189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1429 | Open in IMG/M |
| 3300005294|Ga0065705_10782399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 617 | Open in IMG/M |
| 3300005332|Ga0066388_100740396 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1584 | Open in IMG/M |
| 3300005535|Ga0070684_102023389 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 544 | Open in IMG/M |
| 3300005538|Ga0070731_11110194 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300005557|Ga0066704_10409789 | Not Available | 899 | Open in IMG/M |
| 3300005598|Ga0066706_11039587 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300006845|Ga0075421_102594311 | Not Available | 526 | Open in IMG/M |
| 3300006854|Ga0075425_100575994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1295 | Open in IMG/M |
| 3300006914|Ga0075436_100071633 | All Organisms → cellular organisms → Bacteria | 2397 | Open in IMG/M |
| 3300006969|Ga0075419_10698339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Propionibacteriaceae → Microlunatus | 719 | Open in IMG/M |
| 3300007076|Ga0075435_101416218 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300009089|Ga0099828_11000487 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 745 | Open in IMG/M |
| 3300009098|Ga0105245_10968474 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
| 3300009098|Ga0105245_11222453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 799 | Open in IMG/M |
| 3300009100|Ga0075418_11119005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 853 | Open in IMG/M |
| 3300009137|Ga0066709_101240813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1096 | Open in IMG/M |
| 3300009137|Ga0066709_104443760 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 512 | Open in IMG/M |
| 3300009148|Ga0105243_11222979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 765 | Open in IMG/M |
| 3300009176|Ga0105242_11999263 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 622 | Open in IMG/M |
| 3300009553|Ga0105249_10703528 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Halobacteria | 1071 | Open in IMG/M |
| 3300010043|Ga0126380_10093832 | All Organisms → cellular organisms → Bacteria | 1780 | Open in IMG/M |
| 3300010325|Ga0134064_10241837 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 664 | Open in IMG/M |
| 3300010358|Ga0126370_11914491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 577 | Open in IMG/M |
| 3300010396|Ga0134126_12173463 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 606 | Open in IMG/M |
| 3300010398|Ga0126383_12345242 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 619 | Open in IMG/M |
| 3300010401|Ga0134121_10121148 | All Organisms → cellular organisms → Bacteria | 2209 | Open in IMG/M |
| 3300012200|Ga0137382_10522672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 844 | Open in IMG/M |
| 3300012204|Ga0137374_10347139 | All Organisms → cellular organisms → Bacteria | 1198 | Open in IMG/M |
| 3300012205|Ga0137362_10952548 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 732 | Open in IMG/M |
| 3300012353|Ga0137367_10943266 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 592 | Open in IMG/M |
| 3300012362|Ga0137361_10013489 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5954 | Open in IMG/M |
| 3300012914|Ga0157297_10185131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 708 | Open in IMG/M |
| 3300012960|Ga0164301_10122935 | Not Available | 1537 | Open in IMG/M |
| 3300012961|Ga0164302_11703598 | Not Available | 528 | Open in IMG/M |
| 3300013308|Ga0157375_13297587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 538 | Open in IMG/M |
| 3300014157|Ga0134078_10267249 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 724 | Open in IMG/M |
| 3300014745|Ga0157377_11518017 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 533 | Open in IMG/M |
| 3300015371|Ga0132258_10694655 | All Organisms → cellular organisms → Bacteria | 2561 | Open in IMG/M |
| 3300015371|Ga0132258_11974187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1468 | Open in IMG/M |
| 3300015372|Ga0132256_102407161 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300015372|Ga0132256_103876778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 503 | Open in IMG/M |
| 3300018027|Ga0184605_10156145 | All Organisms → cellular organisms → Bacteria | 1028 | Open in IMG/M |
| 3300018027|Ga0184605_10521924 | Not Available | 515 | Open in IMG/M |
| 3300018054|Ga0184621_10054335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1346 | Open in IMG/M |
| 3300018054|Ga0184621_10352811 | Not Available | 517 | Open in IMG/M |
| 3300018073|Ga0184624_10354828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 656 | Open in IMG/M |
| 3300018433|Ga0066667_10253784 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1335 | Open in IMG/M |
| 3300018482|Ga0066669_10556895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1000 | Open in IMG/M |
| 3300018482|Ga0066669_11511110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 610 | Open in IMG/M |
| 3300019269|Ga0184644_1090906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 630 | Open in IMG/M |
| 3300019279|Ga0184642_1619096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 567 | Open in IMG/M |
| 3300019767|Ga0190267_10553457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 697 | Open in IMG/M |
| 3300021344|Ga0193719_10282473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 698 | Open in IMG/M |
| 3300024288|Ga0179589_10579451 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 525 | Open in IMG/M |
| 3300025910|Ga0207684_10295100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1398 | Open in IMG/M |
| 3300025915|Ga0207693_10975804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 648 | Open in IMG/M |
| 3300025919|Ga0207657_10871831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 694 | Open in IMG/M |
| 3300025928|Ga0207700_10370271 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1251 | Open in IMG/M |
| 3300025939|Ga0207665_10763179 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 763 | Open in IMG/M |
| 3300025949|Ga0207667_11475226 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 652 | Open in IMG/M |
| 3300025981|Ga0207640_10465870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1045 | Open in IMG/M |
| 3300025981|Ga0207640_10713430 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 861 | Open in IMG/M |
| 3300026075|Ga0207708_11289409 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 640 | Open in IMG/M |
| 3300026089|Ga0207648_10952583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 803 | Open in IMG/M |
| 3300026116|Ga0207674_12138577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 523 | Open in IMG/M |
| 3300026121|Ga0207683_10567851 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1049 | Open in IMG/M |
| 3300026300|Ga0209027_1044604 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1668 | Open in IMG/M |
| 3300026540|Ga0209376_1386851 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 523 | Open in IMG/M |
| 3300027577|Ga0209874_1041696 | All Organisms → cellular organisms → Bacteria | 1220 | Open in IMG/M |
| 3300027907|Ga0207428_11113164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 552 | Open in IMG/M |
| 3300027908|Ga0209006_10672864 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300027908|Ga0209006_11059622 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 642 | Open in IMG/M |
| 3300028715|Ga0307313_10119172 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Capillimicrobiaceae → Capillimicrobium → Capillimicrobium parvum | 807 | Open in IMG/M |
| 3300028716|Ga0307311_10081256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 890 | Open in IMG/M |
| 3300028717|Ga0307298_10157654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 661 | Open in IMG/M |
| 3300028771|Ga0307320_10159947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 873 | Open in IMG/M |
| 3300028796|Ga0307287_10242020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 683 | Open in IMG/M |
| 3300028807|Ga0307305_10290781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 744 | Open in IMG/M |
| 3300028811|Ga0307292_10211047 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 799 | Open in IMG/M |
| 3300028824|Ga0307310_10568878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 575 | Open in IMG/M |
| 3300028875|Ga0307289_10092794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1229 | Open in IMG/M |
| 3300028876|Ga0307286_10177227 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. Ag109_G2-15 | 769 | Open in IMG/M |
| 3300028878|Ga0307278_10029219 | All Organisms → cellular organisms → Bacteria | 2528 | Open in IMG/M |
| 3300028878|Ga0307278_10105238 | All Organisms → cellular organisms → Bacteria | 1268 | Open in IMG/M |
| 3300028878|Ga0307278_10231893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 821 | Open in IMG/M |
| 3300028885|Ga0307304_10374578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 639 | Open in IMG/M |
| 3300030336|Ga0247826_10839467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 722 | Open in IMG/M |
| 3300031820|Ga0307473_10790298 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 676 | Open in IMG/M |
| 3300032782|Ga0335082_10698382 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 876 | Open in IMG/M |
| 3300033550|Ga0247829_11807794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 503 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 18.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.92% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.93% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.93% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.94% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.95% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.95% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.96% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.98% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.98% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.98% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.98% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.98% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.98% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.98% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.99% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.99% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.99% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.99% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.99% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.99% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.99% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.99% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.99% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.99% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.99% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001538 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012914 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2 | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019269 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019279 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300027577 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICChiseqgaiiDRAFT_02664122 | 3300000033 | Soil | VALALLTAVWVALHAYELIWWREARAETRAMRLTASAS* |
| F24TB_112648931 | 3300000550 | Soil | LVPAALAVQAIVALGLVTAVWVVLHAYELIWWRAARAELRAQREPASAS* |
| JGI10214J12806_121527063 | 3300000891 | Soil | GLTLVTMVWLGLHAYEIIWWREARAEARALRAPAA* |
| JGI1027J12803_1051561632 | 3300000955 | Soil | LALALITVVWLALHAYELIWWREARAETRALPRPT* |
| JGI10216J12902_1016436681 | 3300000956 | Soil | LVAAVWVALHTYEIVWWREARAQTRALRASAPAS* |
| A10PFW1_100302392 | 3300001538 | Permafrost | VVVPALVALALVAVVWLTLHAYELISWSEARGTARNRA |
| C688J35102_1208801653 | 3300002568 | Soil | ALSLLAAVWVALHAYELIWWRAARTETRTQREMASVSSP* |
| Ga0062592_1012586482 | 3300004480 | Soil | VVVPALVALALVAGVWVTLHAYELIWWREARAEARLQRSPV* |
| Ga0062591_1000799755 | 3300004643 | Soil | VPALVALTLVTIVWLGLHAYEIIWWREARAQTRALRAPAA* |
| Ga0066685_101841891 | 3300005180 | Soil | VPALVALTLVTIVWVGLHAYEVIWWREARAQTRALRVPAS* |
| Ga0065705_107823991 | 3300005294 | Switchgrass Rhizosphere | ALVVPALVALALVAAVWVALHAYEIIWWREDRARIRAQRVPVSAP* |
| Ga0066388_1007403961 | 3300005332 | Tropical Forest Soil | SIPAIVALALVTGVWVVLHAYELIWWRAQRAEIRAERVPASVS* |
| Ga0070684_1020233892 | 3300005535 | Corn Rhizosphere | VPALIALTLVTIVWLGLHAYEIIWWREARAEARALRAPAA |
| Ga0070731_111101941 | 3300005538 | Surface Soil | VVPALAALALVAGVVVALHAYELIWWREARAEAHAQRYPVQT* |
| Ga0066704_104097891 | 3300005557 | Soil | ALFPAARAVSALIALTLIAAVWIALHAYEIIGWREARAEARALR* |
| Ga0066706_110395872 | 3300005598 | Soil | VAVPALLALALVAAVWVALHAYEIIWWREARARTRALRLPASAS* |
| Ga0075421_1025943111 | 3300006845 | Populus Rhizosphere | ALVVPALVALTLLAVVWVVFHAYELIWWREERAQVRALRVPG* |
| Ga0075425_1005759941 | 3300006854 | Populus Rhizosphere | LLAAVWIALHAYELIWWRAARTEIRTQREMASVSSP* |
| Ga0075436_1000716335 | 3300006914 | Populus Rhizosphere | LAVPALVTVVLVAAVWVSLHAYELIWWREARAERRAMQAQAS* |
| Ga0075419_106983392 | 3300006969 | Populus Rhizosphere | LTLVTGVWLALHAYELIWWREARAEARASRSPAPASP* |
| Ga0075435_1014162181 | 3300007076 | Populus Rhizosphere | LAALGLVAAVWVALHAYEIIWFREARAQTRALRQPASP* |
| Ga0099828_110004871 | 3300009089 | Vadose Zone Soil | LVALTLVAAVWVALHAYEIIWWREARARTRALRLPASAS* |
| Ga0105245_109684743 | 3300009098 | Miscanthus Rhizosphere | VVPALAALALVAAVWVCLHAYELIWWREARAETRLQRLPASS* |
| Ga0105245_112224533 | 3300009098 | Miscanthus Rhizosphere | LTLVTIVWLGLHAYEIIWWREARAQTRALRAPAA* |
| Ga0075418_111190053 | 3300009100 | Populus Rhizosphere | AIGALAALTAVWVALHAYELIWWREARAEVREQRVPASAS* |
| Ga0066709_1012408132 | 3300009137 | Grasslands Soil | ALALVAAVWIALHAYEIIWWREARERTRALRSPASAS* |
| Ga0066709_1044437601 | 3300009137 | Grasslands Soil | TLVTAVWVAFHAYEIIWWREARARTRAQRLPASAS* |
| Ga0105243_112229792 | 3300009148 | Miscanthus Rhizosphere | ALVAAVWVALHAYEIIWWREARAETRALRAPVSAS* |
| Ga0105242_119992631 | 3300009176 | Miscanthus Rhizosphere | IALVVPALISLALVTAVWVALHTYEIIWWREARAQTRALRQPTP* |
| Ga0105249_107035282 | 3300009553 | Switchgrass Rhizosphere | ALTLVATVWVALHAYELIWWREARAETRALRLPA* |
| Ga0126380_100938323 | 3300010043 | Tropical Forest Soil | AMTVPAIAALAALAGVWITLHAYELIWWRAERAEVREQRLPASASWR* |
| Ga0134064_102418373 | 3300010325 | Grasslands Soil | WALVTLALVAGVWVALHAYELIWWRAERTELRAQRA* |
| Ga0126370_119144911 | 3300010358 | Tropical Forest Soil | AALAALTGVWIALHAYELIWWRAERAEVREQRLPASASWR* |
| Ga0126381_1043189742 | 3300010376 | Tropical Forest Soil | VPALAALALVAGVWVALHVYELVWWRDERAEARAQQYLSA* |
| Ga0134126_121734631 | 3300010396 | Terrestrial Soil | ALVTAVWVALHAYELIWWRAARAELRAQREPASAS* |
| Ga0126383_123452421 | 3300010398 | Tropical Forest Soil | IVALALVATAWIGLHGYELIWWRAARAEARALRPSV* |
| Ga0134121_101211481 | 3300010401 | Terrestrial Soil | LVAAVWVALHAYEIIWWREARAETRALRAPVSAS* |
| Ga0137382_105226721 | 3300012200 | Vadose Zone Soil | PAIVALALVTTVWVALHAYELIWWRAARAEVRAQRVSASAS* |
| Ga0137374_103471391 | 3300012204 | Vadose Zone Soil | ALVALSLVAAVWIALHAYEIIWWREARARTRALRVPASVSETGGHA* |
| Ga0137362_109525481 | 3300012205 | Vadose Zone Soil | LVVPALVALALVAAVWVALHAYEIIWWREARARTRALRAPASAS* |
| Ga0137367_109432663 | 3300012353 | Vadose Zone Soil | ALVALTLVAAIWVALHAYELIWWREARADARAQRA* |
| Ga0137361_100134898 | 3300012362 | Vadose Zone Soil | VPALAALALVTAVWVALHAYEIIWWREARARTRAQRLASAS* |
| Ga0157297_101851311 | 3300012914 | Soil | ALVALTLVAAVWVALHAYEIIWWREARARTRALRLPASA* |
| Ga0164301_101229352 | 3300012960 | Soil | ALALVALVWVALHASEIISWREARAQTRAMRAPASAS* |
| Ga0164302_117035981 | 3300012961 | Soil | AFIAAVWVALHTYEIIWWREARAEARGLRVPASTA* |
| Ga0157375_132975871 | 3300013308 | Miscanthus Rhizosphere | APAIAALAALTAVWVALHAYELIWWREARAEVREQRVPASAS* |
| Ga0134078_102672491 | 3300014157 | Grasslands Soil | LVTAVWIALHAYELIWWRAARADVRAQRVSASAS* |
| Ga0157377_115180171 | 3300014745 | Miscanthus Rhizosphere | ALIALTLVTIVWLGLHAYEIIWWREARAEARALRAPAA* |
| Ga0132258_106946551 | 3300015371 | Arabidopsis Rhizosphere | ALVAGVWVGLHAYELIWWREARAEARMHRSPSPS* |
| Ga0132258_119741872 | 3300015371 | Arabidopsis Rhizosphere | ALVALTLVAAVWVGLHAYEIVWWREARAEARALRLPA* |
| Ga0132256_1024071612 | 3300015372 | Arabidopsis Rhizosphere | ALVVPAFVALTLVAIAWVGLHAYELIWWRDARTQTRALRV* |
| Ga0132256_1038767781 | 3300015372 | Arabidopsis Rhizosphere | TAVPALAALAIVAAVWIALHAYELIWWREARAQTRALRMPA* |
| Ga0184605_101561453 | 3300018027 | Groundwater Sediment | LIAVVWVALHAYEFVWWREARAETRALRLPPSASEQA |
| Ga0184605_105219241 | 3300018027 | Groundwater Sediment | LTLVAAVWVAFHAYEFIWWREARARTRALRLPASAS |
| Ga0184621_100543352 | 3300018054 | Groundwater Sediment | ALALVAAVWVALHAYEIIWWREARAETRALRAPLSAS |
| Ga0184621_103528112 | 3300018054 | Groundwater Sediment | AVPALVALALTAAVWIALHAYEIIWWREARAQTRALRVPASAS |
| Ga0184624_103548282 | 3300018073 | Groundwater Sediment | ALVVPALVALALVASVWVVLHAYELIWWREARAQTRAGRAPAPAS |
| Ga0066667_102537841 | 3300018433 | Grasslands Soil | VALALVAAVWVALHAYEIIWWREARAQARALRAPVSAS |
| Ga0066669_105568951 | 3300018482 | Grasslands Soil | PAIAALSFLAAVWVVLHAYELIWWRGARTETRAQREMASVSSP |
| Ga0066669_115111102 | 3300018482 | Grasslands Soil | VAVVGPALIALALVATVWVALHSYEIIWWREARAQTRALRVTAAS |
| Ga0184644_10909061 | 3300019269 | Groundwater Sediment | VAMSVPALVALALVAAVWVALHAYEIIWWREARAETRALRAPLSAS |
| Ga0184642_16190961 | 3300019279 | Groundwater Sediment | LVVPALVALTLMAAVWVSLHAYEIIWWREARARTRALRLPASVS |
| Ga0190267_105534572 | 3300019767 | Soil | VAVPALAALALATLVWVLLHAYEFVWWREARAATRALRLTANS |
| Ga0193719_102824731 | 3300021344 | Soil | ALALVTAVWVVLHAYELIWWRAARAELRAERAPASAS |
| Ga0179589_105794512 | 3300024288 | Vadose Zone Soil | PALAALALVAAVWVALHVYEIVWWRDARAQTRALRAPASAS |
| Ga0207684_102951002 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | ALVALALVAAVSVALHAYEIIWWREARARTRALRLPASASEPGSHV |
| Ga0207693_109758041 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | LIPVATSVPALVALALVAAIWVALHAYEIIWWREARAETRA |
| Ga0207657_108718313 | 3300025919 | Corn Rhizosphere | VVPALVALTLVTIVWLGLHAYEIIWWREARAQTRALRAPAA |
| Ga0207700_103702711 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | IVALALVTAVWVALHAYELIWWRAARAELRAQREPASAS |
| Ga0207665_107631791 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | VVVPALVALALLAAVWVALHAYEIIWWREARARTRAMRAPVSAS |
| Ga0207667_114752261 | 3300025949 | Corn Rhizosphere | LAVQAIVALALVTAVWVALHAYELIWWRAARAELRAQREPASAS |
| Ga0207640_104658701 | 3300025981 | Corn Rhizosphere | AALALVAAVWVGLHAYELIWWREERAQVRALRVPG |
| Ga0207640_107134301 | 3300025981 | Corn Rhizosphere | LAALTAVWVALHAYELIWWREARAEVREQRVPASAS |
| Ga0207708_112894091 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | PVALAVPALGALALITAVWVAFHAYEIIWWREARAEARALRD |
| Ga0207648_109525833 | 3300026089 | Miscanthus Rhizosphere | PAIAALAALAAVWVALHAYELIWWREARAEVREQRVPASAS |
| Ga0207674_121385772 | 3300026116 | Corn Rhizosphere | MRCLLALALVAAVWVALHAYEIIWWREARAETRALRAPASAS |
| Ga0207683_105678511 | 3300026121 | Miscanthus Rhizosphere | TVAALAALALVAAVWIALHAYEIIWWREARAAARALRATT |
| Ga0209027_10446042 | 3300026300 | Grasslands Soil | VTLTVPAIAALSLLAAVWVALHAYELIWWRAARTETRTQREMASVSSP |
| Ga0209376_13868512 | 3300026540 | Soil | PALGALGALAVVWIALHAYELIWWREVRAQTRAQRMPASAS |
| Ga0209874_10416962 | 3300027577 | Groundwater Sand | ALVALTLVAIVWVGLHAYEIIWWREARAQTRALRVPASSPE |
| Ga0207428_111131642 | 3300027907 | Populus Rhizosphere | AALSLLAAVWIALHAYELIWWRAARTEIRTQREMASVSSP |
| Ga0209006_106728641 | 3300027908 | Forest Soil | IALAVPALVTVGLVAAVWVSLHAYELIWWREARAERRAMRAQAS |
| Ga0209006_110596221 | 3300027908 | Forest Soil | AARVVPGLVAVALVAAVFVVLHSYELIWWRDARAELRA |
| Ga0307313_101191722 | 3300028715 | Soil | LIALTLVATVWVALHVYEIIWWREARAQTRALRVPAAS |
| Ga0307311_100812561 | 3300028716 | Soil | LIAVVWVALHTYEFVWWREARAETRALRLPPSASEQA |
| Ga0307298_101576541 | 3300028717 | Soil | VALTLMAAVWVSLHAYEIIWWREARARTRALRLPASVS |
| Ga0307320_101599471 | 3300028771 | Soil | LTLMAADWVSLHAYEIIWWREARARTRALRLPASVS |
| Ga0307287_102420201 | 3300028796 | Soil | LALIAVVWVALHAYEFVWWREARAETRALRLPPSASEQA |
| Ga0307305_102907812 | 3300028807 | Soil | VVPALIALTLVATVWVALHVYEIIWWREARAQTRALRVTAAS |
| Ga0307292_102110471 | 3300028811 | Soil | LVVPALVALALVTAVWVALHAYEIIWWREARARTRALRLPTSAS |
| Ga0307310_105688783 | 3300028824 | Soil | AVVWVALHAYEFVWWREARAETRALRLPPSASEQA |
| Ga0307289_100927941 | 3300028875 | Soil | LALVTAVWVALHAYELIWWRAARAELRAQREPASAS |
| Ga0307286_101772272 | 3300028876 | Soil | PARVPLALVAGVWVALHAYELIWWREARAQLRAQRLPSSS |
| Ga0307278_100292196 | 3300028878 | Soil | PALAALTLVAAVWVALHTYEIIWWREARAQTRALRLPASAS |
| Ga0307278_101052383 | 3300028878 | Soil | TLTLVAAVWVALHAYEIIWWREARAQTRALRLPASAS |
| Ga0307278_102318931 | 3300028878 | Soil | VVVPALVALALLAAVWVALHAYEIIWWREARARTRALRMPASAS |
| Ga0307304_103745781 | 3300028885 | Soil | ALVSLTLVAAVWVALHAYEFIWWREARAQTRALRLRASPPDVTAP |
| Ga0247826_108394671 | 3300030336 | Soil | ALIAVVWVALHTYEFVWWREARAETRALRLPPSASEQA |
| Ga0307473_107902981 | 3300031820 | Hardwood Forest Soil | ALTLVLIVWVGLHAYEVIWWREARAQTRALRVPAS |
| Ga0335082_106983822 | 3300032782 | Soil | VPALAALAPIAAVWVVLHAYELIWWREARAEARALRA |
| Ga0247829_118077942 | 3300033550 | Soil | GALTLVATVWVALHAYELIWWREARAQTRALRLPA |
| ⦗Top⦘ |