


| Basic Information | |
|---|---|
| Family ID | F102734 |
| Family Type | Metagenome |
| Number of Sequences | 101 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MNQMTRRAFGAAGFALLLATSASFAQQPPPVRVRGTIEAVD |
| Number of Associated Samples | 88 |
| Number of Associated Scaffolds | 101 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 96.04 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 92.08 % |
| Associated GOLD sequencing projects | 86 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (56.436 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (12.871 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.743 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.485 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 33.33% β-sheet: 0.00% Coil/Unstructured: 66.67% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 101 Family Scaffolds |
|---|---|---|
| PF13561 | adh_short_C2 | 45.54 |
| PF02826 | 2-Hacid_dh_C | 4.95 |
| PF00389 | 2-Hacid_dh | 1.98 |
| PF13531 | SBP_bac_11 | 0.99 |
| PF00106 | adh_short | 0.99 |
| PF00196 | GerE | 0.99 |
| PF09694 | Gcw_chp | 0.99 |
| PF13426 | PAS_9 | 0.99 |
| PF02945 | Endonuclease_7 | 0.99 |
| PF00480 | ROK | 0.99 |
| PF00941 | FAD_binding_5 | 0.99 |
| PF01799 | Fer2_2 | 0.99 |
| PF11306 | DUF3108 | 0.99 |
| COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
|---|---|---|---|
| COG1940 | Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain | Transcription [K] | 1.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 56.44 % |
| All Organisms | root | All Organisms | 43.56 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2228664022|INPgaii200_c0901462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 675 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c0494043 | Not Available | 566 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_100355844 | Not Available | 585 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101922334 | Not Available | 882 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10145470 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 572 | Open in IMG/M |
| 3300000655|AF_2010_repII_A100DRAFT_1008144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2007 | Open in IMG/M |
| 3300000793|AF_2010_repII_A001DRAFT_10127236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 532 | Open in IMG/M |
| 3300000837|AP72_2010_repI_A100DRAFT_1063693 | Not Available | 523 | Open in IMG/M |
| 3300000893|AP72_2010_repI_A001DRAFT_1026559 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 921 | Open in IMG/M |
| 3300000893|AP72_2010_repI_A001DRAFT_1029492 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 870 | Open in IMG/M |
| 3300000893|AP72_2010_repI_A001DRAFT_1036592 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 771 | Open in IMG/M |
| 3300000956|JGI10216J12902_119442066 | Not Available | 566 | Open in IMG/M |
| 3300004070|Ga0055488_10060487 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 846 | Open in IMG/M |
| 3300004268|Ga0066398_10066964 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 766 | Open in IMG/M |
| 3300005332|Ga0066388_103926453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 758 | Open in IMG/M |
| 3300005364|Ga0070673_101511956 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 633 | Open in IMG/M |
| 3300005457|Ga0070662_101534710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 574 | Open in IMG/M |
| 3300005574|Ga0066694_10194853 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 962 | Open in IMG/M |
| 3300005617|Ga0068859_102470906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 572 | Open in IMG/M |
| 3300005713|Ga0066905_100160832 | All Organisms → cellular organisms → Bacteria | 1631 | Open in IMG/M |
| 3300005713|Ga0066905_101139277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 694 | Open in IMG/M |
| 3300005764|Ga0066903_101730590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1191 | Open in IMG/M |
| 3300005764|Ga0066903_107692384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. WSM1417 | 555 | Open in IMG/M |
| 3300005764|Ga0066903_108391804 | Not Available | 527 | Open in IMG/M |
| 3300005843|Ga0068860_100057555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3695 | Open in IMG/M |
| 3300005921|Ga0070766_11082305 | Not Available | 553 | Open in IMG/M |
| 3300006046|Ga0066652_100012310 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5557 | Open in IMG/M |
| 3300006854|Ga0075425_100773988 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1100 | Open in IMG/M |
| 3300006904|Ga0075424_100089849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3231 | Open in IMG/M |
| 3300006954|Ga0079219_10650421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 787 | Open in IMG/M |
| 3300009100|Ga0075418_11961448 | Not Available | 637 | Open in IMG/M |
| 3300009162|Ga0075423_10091412 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3180 | Open in IMG/M |
| 3300009162|Ga0075423_10601382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1159 | Open in IMG/M |
| 3300009176|Ga0105242_12257683 | Not Available | 590 | Open in IMG/M |
| 3300009792|Ga0126374_11424352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 565 | Open in IMG/M |
| 3300010043|Ga0126380_10495782 | Not Available | 936 | Open in IMG/M |
| 3300010046|Ga0126384_12210302 | Not Available | 530 | Open in IMG/M |
| 3300010335|Ga0134063_10030547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2284 | Open in IMG/M |
| 3300010336|Ga0134071_10219092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 942 | Open in IMG/M |
| 3300010361|Ga0126378_10050425 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3876 | Open in IMG/M |
| 3300010361|Ga0126378_11240634 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 842 | Open in IMG/M |
| 3300010361|Ga0126378_12031715 | Not Available | 655 | Open in IMG/M |
| 3300010361|Ga0126378_12368826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 606 | Open in IMG/M |
| 3300010362|Ga0126377_11833310 | Not Available | 682 | Open in IMG/M |
| 3300010397|Ga0134124_10991794 | Not Available | 851 | Open in IMG/M |
| 3300010399|Ga0134127_12393334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 608 | Open in IMG/M |
| 3300010999|Ga0138505_100025347 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300012199|Ga0137383_10496338 | Not Available | 894 | Open in IMG/M |
| 3300012208|Ga0137376_10165842 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1904 | Open in IMG/M |
| 3300012210|Ga0137378_10964135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 766 | Open in IMG/M |
| 3300012211|Ga0137377_10954293 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300012211|Ga0137377_11089672 | Not Available | 729 | Open in IMG/M |
| 3300012357|Ga0137384_10696268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 825 | Open in IMG/M |
| 3300012469|Ga0150984_115877876 | Not Available | 627 | Open in IMG/M |
| 3300012957|Ga0164303_10837522 | Not Available | 637 | Open in IMG/M |
| 3300012987|Ga0164307_10082330 | Not Available | 1960 | Open in IMG/M |
| 3300014315|Ga0075350_1119215 | Not Available | 641 | Open in IMG/M |
| 3300014968|Ga0157379_11689042 | Not Available | 620 | Open in IMG/M |
| 3300014969|Ga0157376_10781078 | Not Available | 966 | Open in IMG/M |
| 3300014969|Ga0157376_11117337 | Not Available | 814 | Open in IMG/M |
| 3300015201|Ga0173478_10751568 | Not Available | 528 | Open in IMG/M |
| 3300016341|Ga0182035_11730807 | Not Available | 565 | Open in IMG/M |
| 3300018055|Ga0184616_10101204 | Not Available | 1028 | Open in IMG/M |
| 3300018076|Ga0184609_10225945 | Not Available | 874 | Open in IMG/M |
| 3300018081|Ga0184625_10211277 | Not Available | 1017 | Open in IMG/M |
| 3300018466|Ga0190268_10323000 | Not Available | 942 | Open in IMG/M |
| 3300018469|Ga0190270_11020643 | Not Available | 855 | Open in IMG/M |
| 3300018476|Ga0190274_11055745 | Not Available | 890 | Open in IMG/M |
| 3300021086|Ga0179596_10458954 | Not Available | 645 | Open in IMG/M |
| 3300021407|Ga0210383_11544699 | Not Available | 548 | Open in IMG/M |
| 3300021415|Ga0193694_1031701 | Not Available | 741 | Open in IMG/M |
| 3300025885|Ga0207653_10187452 | Not Available | 776 | Open in IMG/M |
| 3300025914|Ga0207671_11574300 | Not Available | 506 | Open in IMG/M |
| 3300025972|Ga0207668_10382196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1185 | Open in IMG/M |
| 3300026285|Ga0209438_1182810 | Not Available | 554 | Open in IMG/M |
| 3300026528|Ga0209378_1297382 | Not Available | 516 | Open in IMG/M |
| 3300026548|Ga0209161_10103383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1713 | Open in IMG/M |
| 3300026552|Ga0209577_10064067 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3064 | Open in IMG/M |
| 3300027909|Ga0209382_10729787 | Not Available | 1063 | Open in IMG/M |
| 3300028802|Ga0307503_10167125 | Not Available | 1013 | Open in IMG/M |
| 3300028809|Ga0247824_10218368 | Not Available | 1048 | Open in IMG/M |
| 3300028814|Ga0307302_10343826 | Not Available | 735 | Open in IMG/M |
| 3300028878|Ga0307278_10186629 | Not Available | 925 | Open in IMG/M |
| 3300028878|Ga0307278_10248355 | Not Available | 790 | Open in IMG/M |
| 3300028881|Ga0307277_10046599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1760 | Open in IMG/M |
| 3300031199|Ga0307495_10033192 | Not Available | 964 | Open in IMG/M |
| 3300031680|Ga0318574_10086549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1717 | Open in IMG/M |
| 3300031768|Ga0318509_10334499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 848 | Open in IMG/M |
| 3300031769|Ga0318526_10483640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 506 | Open in IMG/M |
| 3300031782|Ga0318552_10273045 | Not Available | 859 | Open in IMG/M |
| 3300031798|Ga0318523_10154000 | Not Available | 1143 | Open in IMG/M |
| 3300031799|Ga0318565_10190803 | Not Available | 996 | Open in IMG/M |
| 3300031897|Ga0318520_11019028 | Not Available | 523 | Open in IMG/M |
| 3300031912|Ga0306921_12052934 | Not Available | 607 | Open in IMG/M |
| 3300032013|Ga0310906_10600417 | Not Available | 758 | Open in IMG/M |
| 3300032044|Ga0318558_10367491 | Not Available | 714 | Open in IMG/M |
| 3300032159|Ga0268251_10337110 | Not Available | 636 | Open in IMG/M |
| 3300032180|Ga0307471_103742858 | Not Available | 538 | Open in IMG/M |
| 3300032205|Ga0307472_101666920 | Not Available | 629 | Open in IMG/M |
| 3300032261|Ga0306920_103500969 | Not Available | 580 | Open in IMG/M |
| 3300033289|Ga0310914_10440306 | Not Available | 1179 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 12.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.90% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.92% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.93% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 6.93% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 6.93% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.94% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.97% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.98% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.98% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.98% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.99% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.99% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.99% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.99% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.99% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.99% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.99% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.99% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.99% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.99% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.99% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 0.99% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000655 | Forest soil microbial communities from Amazon forest - 2010 replicate II A100 | Environmental | Open in IMG/M |
| 3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
| 3300000837 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100 | Environmental | Open in IMG/M |
| 3300000893 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A001 | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004070 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010999 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t3i015 | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300014315 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300018055 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_coex | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021415 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s1 | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032159 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e (v2) | Host-Associated | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPgaii200_09014621 | 2228664022 | Soil | MDQMTRRAFGAAGFALLLATSTTLAQQQSPTVRVRGTIEGVDGPM |
| ICChiseqgaiiDRAFT_04940431 | 3300000033 | Soil | MHPMTRRXLCALGLAXLXATSASXAQXPAAVRVRGTI |
| INPhiseqgaiiFebDRAFT_1003558441 | 3300000364 | Soil | MHGITRRMFCAVAXXLLAATSVSLAQQPETVRVRGTVE |
| INPhiseqgaiiFebDRAFT_1019223341 | 3300000364 | Soil | MNQMTRRVFAVAGFTLLLATSASFAQQPPPVRVRGTVE |
| AF_2010_repII_A1DRAFT_101454702 | 3300000597 | Forest Soil | MNQITRRAFGAAGFALLLVTSASFAQQPPPVRVRGTVEA |
| AF_2010_repII_A100DRAFT_10081441 | 3300000655 | Forest Soil | MKQMTRRIFGMAGFALLLATSASFAQQPPQTVRIRGQIEKVEGDV |
| AF_2010_repII_A001DRAFT_101272361 | 3300000793 | Forest Soil | MNQMTRRVFAVAGFTLLLATSASFAQQPPPVRVRGTVEG |
| AP72_2010_repI_A100DRAFT_10636931 | 3300000837 | Forest Soil | MKAVIRGVFAVAGVALLLGTAASFAQQPALVRVRGTVEAVD |
| AP72_2010_repI_A001DRAFT_10265591 | 3300000893 | Forest Soil | MNHITRRAFGAAGFALLLVTSASFAQQPPPVRVRGTVE |
| AP72_2010_repI_A001DRAFT_10294922 | 3300000893 | Forest Soil | MNQITRRAFGAAGFALLLVTSASFAQQPPPVRVRGTVE |
| AP72_2010_repI_A001DRAFT_10365922 | 3300000893 | Forest Soil | MKQMTRRVFGVAGFALLLATSASFAQQPPPVRIRGQIEK |
| JGI10216J12902_1194420661 | 3300000956 | Soil | MDQMTRRAFGAAGFAVLLATSTTFAEQQSSTVRMRGTVEGADGPMLTV |
| Ga0055488_100604872 | 3300004070 | Natural And Restored Wetlands | MNKLTRRALGVAGFALILATSASFAQQPPVRIRGDIVKADGDVFEIKTRGGET |
| Ga0066398_100669642 | 3300004268 | Tropical Forest Soil | MNQITRRAFGVGGFALLLATSESFAQQSPPVRVRGTIEAFDNGVLT |
| Ga0066388_1039264532 | 3300005332 | Tropical Forest Soil | MNQTTRRAFGAAGFALLLATSVSFAQQPPPVRVRGTVEAVDGP |
| Ga0070673_1015119562 | 3300005364 | Switchgrass Rhizosphere | MNQTTRRVFGVAGFALLLATSASFAQQPAPVRVRGTVEAVDGPMLTV |
| Ga0070662_1015347102 | 3300005457 | Corn Rhizosphere | MNQTTRRIFGVAGFALLLATSASFAQQPAPVRVRGTVEAVDG |
| Ga0066694_101948532 | 3300005574 | Soil | MNQMTRRFFGVAGFALLLATSASFAQQQPPTVRIRGQIEKV |
| Ga0068859_1024709061 | 3300005617 | Switchgrass Rhizosphere | MHGMTRRVLCALGLALLSATSASLAQQPAAVRVRGTIEAV |
| Ga0066905_1001608321 | 3300005713 | Tropical Forest Soil | MDKMTRRAVDAAGFALLLATSATFAQQQSPTVRVRG |
| Ga0066905_1011392771 | 3300005713 | Tropical Forest Soil | MNHITRRAFGAAGFALLLVTSASFAQQPPPVRVRGTVEAVDGP |
| Ga0066903_1017305901 | 3300005764 | Tropical Forest Soil | MDGITRRAFGAAGFALLLATTTTLAQQQSPTVRVR |
| Ga0066903_1076923841 | 3300005764 | Tropical Forest Soil | VKHVRQRAFCLVTLALASSASFAQEHATVRVRGTIEAVD |
| Ga0066903_1083918043 | 3300005764 | Tropical Forest Soil | MKQMTRRVFGVAGFALLLATSASFAQQPPPVRIRG |
| Ga0068860_1000575555 | 3300005843 | Switchgrass Rhizosphere | MNQTTRRIFGVAGFALLLATSASFAQQPAPVRVRGTVEAVDGPMLTV |
| Ga0070766_110823051 | 3300005921 | Soil | MNKMTRRMFGASSLAVLLASRAGFAQQSPPVRVRGT |
| Ga0066652_1000123106 | 3300006046 | Soil | MKQMTRRVFGVAGFALLLATSASFAQQPPPVRIRGQIEKIEGDVLDIKT |
| Ga0075425_1007739881 | 3300006854 | Populus Rhizosphere | MNQMTRRVFGVAGFALLLATSASFAQQPPPTVRIRGQI |
| Ga0075424_1000898496 | 3300006904 | Populus Rhizosphere | MHPMTRRLLCALGLALLSATPASLAQQPAAVRVRGTIEAVDGAM |
| Ga0079219_106504211 | 3300006954 | Agricultural Soil | MNQMTRRVFGVAGFALLLATSASFAQQPPPTVRIRGQIEKVDG |
| Ga0075418_119614481 | 3300009100 | Populus Rhizosphere | MKQMTRRVFAVAGFTLLLATSASFAQQPPPVRVRGTVEG |
| Ga0075423_100914124 | 3300009162 | Populus Rhizosphere | MNQMTRRVFGVAGFALLLATSASFAQQPPPTVRIRGQIE |
| Ga0075423_106013822 | 3300009162 | Populus Rhizosphere | MKQMTRRVFGVAGFALLLATSASFAQQPPPTVRIRGQIEK |
| Ga0105242_122576832 | 3300009176 | Miscanthus Rhizosphere | MNQTTRRVFGVAGFALLLATSASFAQQPAPVRVRGTVEAVDGP |
| Ga0126374_114243521 | 3300009792 | Tropical Forest Soil | MGFREDDMNQITRRAFGAAGFALLLVTSASFAQQPPPVRVRGTVEAVD |
| Ga0126380_104957822 | 3300010043 | Tropical Forest Soil | MGFREDDMKAVIRGVFAVAGVALLLGTAASFAQQPALVRVRGTVEAV |
| Ga0126384_122103022 | 3300010046 | Tropical Forest Soil | MVMYGLTNRVTRRAFAVAGFALLVATSASFAQQPQMVRVRGTV |
| Ga0134063_100305471 | 3300010335 | Grasslands Soil | MNQMTRRAFGAAGFALLLATSASFAQQPPPVRVRG |
| Ga0134071_102190923 | 3300010336 | Grasslands Soil | MNQMTRRFFGVAGFALLLATSASFAQQQPPTVRIRGQ |
| Ga0126378_100504251 | 3300010361 | Tropical Forest Soil | MNQMTRRIFAMAGFALLLATSASFAQQPPQTVRIRGQIEKVEGDVLDIK |
| Ga0126378_112406341 | 3300010361 | Tropical Forest Soil | MKQMTRRVFGVAGFALLLATSASFAQQPPPVRIRGQIEKIEGDVLDIK |
| Ga0126378_120317152 | 3300010361 | Tropical Forest Soil | MKQMTRRVFGVAGFALLLATSASFAQQPPPVRIRGQIEKIEG |
| Ga0126378_123688261 | 3300010361 | Tropical Forest Soil | MDKMTRRAFGAAGLVLLLSTSAPLAQQQAPSVRVRGTIERIDGSTY |
| Ga0126377_118333102 | 3300010362 | Tropical Forest Soil | MPCLLAPALLLAAGASLAQEPAPVRVRGTIEAVDGAMLTVRSR |
| Ga0134124_109917943 | 3300010397 | Terrestrial Soil | MTRRLLCALGLALLSATPASLAQQPAAVRVRGTIEAVDGAMLTVRS |
| Ga0134127_123933341 | 3300010399 | Terrestrial Soil | MKQMTRRVFGVAGFALLLATSASFAQQPPPTVRIRGQIEKVD |
| Ga0138505_1000253472 | 3300010999 | Soil | MDQMTRRAFGAAGFAVLLATSTTFAEQQSSTVRMRGTVEGADGPMLTVTS |
| Ga0137383_104963381 | 3300012199 | Vadose Zone Soil | MNQMTRRAFGVAGFTVLLVTSASFAQQQPPPVRVRG |
| Ga0137376_101658421 | 3300012208 | Vadose Zone Soil | MDEMTRRAFGAAGFALLLATSATFAQQQSPTVRVRGTVEG |
| Ga0137378_109641351 | 3300012210 | Vadose Zone Soil | MNQMTRRVFGVAGFALLLATSASFAQQQPQTVRIRGQIEKVEGD |
| Ga0137377_109542931 | 3300012211 | Vadose Zone Soil | MDQMTRRVFGAAGFALLLATSTTFAQQQSPTVRVRGTVE |
| Ga0137377_110896721 | 3300012211 | Vadose Zone Soil | MNQMTRRAFGVAGFTVLLVTSASFAQQQPPPVRVR |
| Ga0137384_106962681 | 3300012357 | Vadose Zone Soil | MNQMTRRFFGVAGFALLLATSASFAQQQPPTVRIRGQIEK |
| Ga0150984_1158778762 | 3300012469 | Avena Fatua Rhizosphere | MHSMTRRMLYAAGLFLLGATSVSFAQQTELVRVRGTI |
| Ga0164303_108375221 | 3300012957 | Soil | MNQMIRRASSAAAFALLFVASISFAQQPPQVRVRGTVEAVDGS |
| Ga0164307_100823301 | 3300012987 | Soil | MTRRVFCALGLALLSATSASFAQQPAAVRVRGTIEAVDG |
| Ga0075350_11192152 | 3300014315 | Natural And Restored Wetlands | MNKLTRRALGVAGFALILATSASFAQQPPVRIRGDIVKADGDVFEIKTRGGETVKV |
| Ga0157379_116890422 | 3300014968 | Switchgrass Rhizosphere | MKQTTRRIFGVAGFALLLATSASFAQQPAPVRVRGTVEAVD |
| Ga0157376_107810784 | 3300014969 | Miscanthus Rhizosphere | MHLMTRRMLCALGLALLPVTSVSLAQQSAPVRVRGTIEAV |
| Ga0157376_111173372 | 3300014969 | Miscanthus Rhizosphere | MNQTTRRVFGVAGFALLLATSASFAQQPAPVRVRGTVEAVD |
| Ga0173478_107515682 | 3300015201 | Soil | MNQTTRRVFGVAGFALLLATSASFAQQPAPVRVRGTVEAVDGPML |
| Ga0182035_117308071 | 3300016341 | Soil | MNQITRRALGAAGFALLLATSVSFAQQPPPVRVRGTVE |
| Ga0184616_101012041 | 3300018055 | Groundwater Sediment | MNQTTRRIFGVAGFALLLATSASFAQQPAPVRVRGTVEA |
| Ga0184609_102259451 | 3300018076 | Groundwater Sediment | MNQTTRRVFGVAGFALLLATSASFAQQPAPVRVRGTVEAVDG |
| Ga0184625_102112771 | 3300018081 | Groundwater Sediment | MQGITRRMFCAVALSLLAATSVSLAQQPETVRVRGTIEAVDGAMLT |
| Ga0190268_103230001 | 3300018466 | Soil | MNQTTRRIFGVAGFALLLATSASFAQQPAPVRVRGTVEAV |
| Ga0190270_110206432 | 3300018469 | Soil | MNQTTRRVFGVAGFALLLATSASFAQQPAPVRVRGTVEAV |
| Ga0190274_110557453 | 3300018476 | Soil | MHPMTRRMFCAIGFALLPVTSVSFAQQPAPVRVRGTI |
| Ga0179596_104589541 | 3300021086 | Vadose Zone Soil | MNKMTRRMFGASSFALLLAGSASYAQQSPPVRVRGTVEGVD |
| Ga0210383_115446992 | 3300021407 | Soil | MNKLTRRMFGASSLAVLLASPFASSAGLAQQSPAVRVRG |
| Ga0193694_10317012 | 3300021415 | Soil | MNQTTRRIFGVAGFALLLAASASFAQQPAPVRVRGTVEAV |
| Ga0207653_101874522 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MNQTTRRIFGVAGFALLLATSASFAQQPAPVRVRGTVEAVDGPMLT |
| Ga0207671_115743001 | 3300025914 | Corn Rhizosphere | MHPMTRRVLCALGLALLSATSASLAQQPAAVRVRGTIEAVD |
| Ga0207668_103821961 | 3300025972 | Switchgrass Rhizosphere | MHLMTRRMLCAVGFALLPVTSVSFAQQPAPVRVRGTIEAVDGAMLTV |
| Ga0209438_11828102 | 3300026285 | Grasslands Soil | MNQTTRRVFGVAGFALLLATSASFAQQPAPVRVRGTVEAVDGPLL |
| Ga0209378_12973822 | 3300026528 | Soil | MNQMTRRAFGAAGFALLLATSASFAQQPPPVRVRGTIEAVD |
| Ga0209161_101033831 | 3300026548 | Soil | MNQMTRRFFGVAGFALLLATSASFAQQQPPTVRIRGQIEKVE |
| Ga0209577_100640674 | 3300026552 | Soil | MKQMTRRVFGVAGFALLLATSASFAQQPPPVRIRGQIE |
| Ga0209382_107297872 | 3300027909 | Populus Rhizosphere | MNQTTRRVVGAAGLALLLLTSASFAQQPAPVRVRGTV |
| Ga0307503_101671251 | 3300028802 | Soil | MNQTTRRIFGVAGFALLLATSASFAQQPAPVRVRG |
| Ga0247824_102183681 | 3300028809 | Soil | MNQTTRRIFGVAGFALLLATSASFAQQPAPVRVRGTVEAVDGQM |
| Ga0307302_103438261 | 3300028814 | Soil | MHGITRRMFCAVVLSLLAVTSVSFAQQPETVRVRGTIEAV |
| Ga0307278_101866292 | 3300028878 | Soil | MNQMTRRAFGVAGFAVLFVTSASFAQQQPPPVRVR |
| Ga0307278_102483551 | 3300028878 | Soil | MDQMTRRAFGAAGFALLLATSATFAQQQSPTVRVRGT |
| Ga0307277_100465993 | 3300028881 | Soil | MNQMTRRAFGVTGFAVLLVTSASFAQQQPPPVRIRGQIDKIEGDVLDIKARNGDMVK |
| Ga0307495_100331921 | 3300031199 | Soil | MHGITRRMFCAVGLSLLAATSVSFAQQPETVRVRGTIEA |
| Ga0318574_100865491 | 3300031680 | Soil | MNQITRRAFGAAGFALLLATSVSFAQQPPPVRVRGTV |
| Ga0318509_103344991 | 3300031768 | Soil | MDGITRRAFGAAGFALLLATTTTLAQQQSPTVRVRGTIEGVDGPMLTVK |
| Ga0318526_104836401 | 3300031769 | Soil | MNHMTRRAFGAAGFVLLLATSASYAQQQPPPVRVLLGIT |
| Ga0318552_102730452 | 3300031782 | Soil | MNQTTRRAFGAAGFALLLATSVSFAQQPPPVRVRGTVEAVDG |
| Ga0318523_101540001 | 3300031798 | Soil | MNQMTRRIFAMAGFALLLATSASFAQQPPQTVRIRGQIEKVEGDVLD |
| Ga0318565_101908032 | 3300031799 | Soil | MNQITRRAFGAAGFALLLATSVSFAQQPPPVRVRGTVEA |
| Ga0318520_110190282 | 3300031897 | Soil | MNQITRRAFGAAGFALLLATSVSFAQQPPPVRVRGTVEAVDGA |
| Ga0306921_120529341 | 3300031912 | Soil | MDKMTRRAFGAAGFVLLLSTSATLAQQQAPTVRLR |
| Ga0310906_106004171 | 3300032013 | Soil | MHPMTRRVLCALGLALLSATSASLAQQPAAVRVRGTIEAVDGAM |
| Ga0318558_103674912 | 3300032044 | Soil | MNQITRRAFGATGFALLLVTSASFAQQPPPVRVRGTVEA |
| Ga0268251_103371101 | 3300032159 | Agave | MNQMTRRVFGVAGFAVLLVTSASFGQQQPPPVRVRGTI |
| Ga0307471_1037428582 | 3300032180 | Hardwood Forest Soil | MNKMTRRMFGASGLALMLASSASFAQQSPPVRVRGTVEGVD |
| Ga0307472_1016669202 | 3300032205 | Hardwood Forest Soil | MNQMTRRVFGVVGFVLLLATSASFAQQPPPVRIRGQIDKVEGDVIDIK |
| Ga0306920_1035009692 | 3300032261 | Soil | MNQIARRALGAAGFALLLATSVSFAQQPPPVRVRGTVEAV |
| Ga0310914_104403063 | 3300033289 | Soil | MNQITRRALGAAGFALLLATSVSFAQQPPPVRVRGT |
| ⦗Top⦘ |