


| Basic Information | |
|---|---|
| Family ID | F102674 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 101 |
| Average Sequence Length | 41 residues |
| Representative Sequence | YRTFETEVNLLANQKSEVKTELVKGSIEQAGPEIKQPQ |
| Number of Associated Samples | 85 |
| Number of Associated Scaffolds | 101 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.02 % |
| % of genes from short scaffolds (< 2000 bps) | 92.08 % |
| Associated GOLD sequencing projects | 84 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.32 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (85.149 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (18.812 % of family members) |
| Environment Ontology (ENVO) | Unclassified (42.574 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (60.396 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 101 Family Scaffolds |
|---|---|---|
| PF02274 | ADI | 14.85 |
| PF00005 | ABC_tran | 10.89 |
| PF00144 | Beta-lactamase | 5.94 |
| PF08308 | PEGA | 3.96 |
| PF13561 | adh_short_C2 | 1.98 |
| PF00092 | VWA | 1.98 |
| PF09900 | DUF2127 | 1.98 |
| PF08240 | ADH_N | 1.98 |
| PF02391 | MoaE | 0.99 |
| PF00072 | Response_reg | 0.99 |
| PF13519 | VWA_2 | 0.99 |
| PF13857 | Ank_5 | 0.99 |
| PF08281 | Sigma70_r4_2 | 0.99 |
| PF00107 | ADH_zinc_N | 0.99 |
| PF01546 | Peptidase_M20 | 0.99 |
| PF05721 | PhyH | 0.99 |
| PF04024 | PspC | 0.99 |
| PF00486 | Trans_reg_C | 0.99 |
| PF03544 | TonB_C | 0.99 |
| PF06537 | DHOR | 0.99 |
| PF14031 | D-ser_dehydrat | 0.99 |
| PF00563 | EAL | 0.99 |
| PF02405 | MlaE | 0.99 |
| PF00248 | Aldo_ket_red | 0.99 |
| PF01381 | HTH_3 | 0.99 |
| PF03030 | H_PPase | 0.99 |
| PF07676 | PD40 | 0.99 |
| PF00082 | Peptidase_S8 | 0.99 |
| PF08530 | PepX_C | 0.99 |
| PF10518 | TAT_signal | 0.99 |
| PF01425 | Amidase | 0.99 |
| COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
|---|---|---|---|
| COG1834 | N-Dimethylarginine dimethylaminohydrolase | Amino acid transport and metabolism [E] | 14.85 |
| COG2235 | Arginine deiminase | Amino acid transport and metabolism [E] | 14.85 |
| COG4874 | Uncharacterized conserved protein | Function unknown [S] | 14.85 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 5.94 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 5.94 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 5.94 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.99 |
| COG0314 | Molybdopterin synthase catalytic subunit MoaE | Coenzyme transport and metabolism [H] | 0.99 |
| COG0767 | Permease subunit MlaE of the ABC-type intermembrane phospholipid transporter Mla | Cell wall/membrane/envelope biogenesis [M] | 0.99 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.99 |
| COG2200 | EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant) | Signal transduction mechanisms [T] | 0.99 |
| COG2936 | Predicted acyl esterase | General function prediction only [R] | 0.99 |
| COG3434 | c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domains | Signal transduction mechanisms [T] | 0.99 |
| COG3488 | Uncharacterized conserved protein with two CxxC motifs, DUF1111 family | General function prediction only [R] | 0.99 |
| COG3808 | Na+ or H+-translocating membrane pyrophosphatase | Energy production and conversion [C] | 0.99 |
| COG4943 | Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domains | Signal transduction mechanisms [T] | 0.99 |
| COG5001 | Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domain | Signal transduction mechanisms [T] | 0.99 |
| COG5285 | Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.99 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 86.14 % |
| Unclassified | root | N/A | 13.86 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459013|GO6OHWN02GDON6 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101992882 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300002560|JGI25383J37093_10180272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Microbispora → unclassified Microbispora → Microbispora sp. GKU 823 | 556 | Open in IMG/M |
| 3300004080|Ga0062385_10042116 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1917 | Open in IMG/M |
| 3300004080|Ga0062385_10817128 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300004091|Ga0062387_101652907 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
| 3300005163|Ga0066823_10038554 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 822 | Open in IMG/M |
| 3300005177|Ga0066690_10516931 | Not Available | 802 | Open in IMG/M |
| 3300005343|Ga0070687_100847624 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300005536|Ga0070697_100002013 | All Organisms → cellular organisms → Bacteria | 15582 | Open in IMG/M |
| 3300005556|Ga0066707_10786348 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300005557|Ga0066704_10049036 | All Organisms → cellular organisms → Bacteria | 2660 | Open in IMG/M |
| 3300005560|Ga0066670_10471822 | Not Available | 773 | Open in IMG/M |
| 3300005591|Ga0070761_10716536 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300005610|Ga0070763_10904971 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300006031|Ga0066651_10441151 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 691 | Open in IMG/M |
| 3300006034|Ga0066656_10708087 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300006893|Ga0073928_10065138 | All Organisms → cellular organisms → Bacteria | 3193 | Open in IMG/M |
| 3300006893|Ga0073928_10210306 | All Organisms → cellular organisms → Bacteria | 1516 | Open in IMG/M |
| 3300009012|Ga0066710_100520474 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1796 | Open in IMG/M |
| 3300009038|Ga0099829_10233867 | All Organisms → cellular organisms → Bacteria | 1495 | Open in IMG/M |
| 3300009089|Ga0099828_10368715 | Not Available | 1294 | Open in IMG/M |
| 3300009545|Ga0105237_10143737 | All Organisms → cellular organisms → Bacteria | 2380 | Open in IMG/M |
| 3300010046|Ga0126384_11857351 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300010048|Ga0126373_10940485 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 929 | Open in IMG/M |
| 3300010111|Ga0127491_1064738 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 642 | Open in IMG/M |
| 3300010303|Ga0134082_10559311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 504 | Open in IMG/M |
| 3300010358|Ga0126370_10308199 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1259 | Open in IMG/M |
| 3300010360|Ga0126372_10950862 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 866 | Open in IMG/M |
| 3300010360|Ga0126372_11959206 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300010360|Ga0126372_12556469 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 562 | Open in IMG/M |
| 3300010362|Ga0126377_10933749 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
| 3300010362|Ga0126377_11487660 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300010362|Ga0126377_11900458 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300010362|Ga0126377_13343115 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300010366|Ga0126379_12690851 | Not Available | 594 | Open in IMG/M |
| 3300011120|Ga0150983_11187732 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300011270|Ga0137391_10960987 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300012205|Ga0137362_10176786 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1833 | Open in IMG/M |
| 3300012206|Ga0137380_10559512 | All Organisms → cellular organisms → Bacteria | 1003 | Open in IMG/M |
| 3300012209|Ga0137379_11427817 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300012362|Ga0137361_11544471 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300012929|Ga0137404_11004061 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300012929|Ga0137404_12308819 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
| 3300012971|Ga0126369_10005000 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 9757 | Open in IMG/M |
| 3300012971|Ga0126369_10339812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales | 1519 | Open in IMG/M |
| 3300012971|Ga0126369_11019768 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| 3300015242|Ga0137412_10342660 | All Organisms → cellular organisms → Bacteria | 1165 | Open in IMG/M |
| 3300015264|Ga0137403_11614725 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
| 3300016404|Ga0182037_10888121 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300017995|Ga0187816_10125698 | All Organisms → cellular organisms → Bacteria | 1105 | Open in IMG/M |
| 3300019882|Ga0193713_1065578 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1032 | Open in IMG/M |
| 3300019890|Ga0193728_1208426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 815 | Open in IMG/M |
| 3300020002|Ga0193730_1157964 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300020034|Ga0193753_10112386 | All Organisms → cellular organisms → Bacteria | 1344 | Open in IMG/M |
| 3300020579|Ga0210407_10155795 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1762 | Open in IMG/M |
| 3300020579|Ga0210407_11354355 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300020580|Ga0210403_10195167 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → dothideomyceta → Dothideomycetes → Dothideomycetidae → Myriangiales → Elsinoaceae → Elsinoe → Elsinoe australis | 1661 | Open in IMG/M |
| 3300020581|Ga0210399_11190595 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300021088|Ga0210404_10327906 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300021168|Ga0210406_10448461 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
| 3300021168|Ga0210406_10802463 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 716 | Open in IMG/M |
| 3300021168|Ga0210406_11194274 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300021406|Ga0210386_10142652 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1998 | Open in IMG/M |
| 3300021433|Ga0210391_10440352 | All Organisms → cellular organisms → Bacteria | 1023 | Open in IMG/M |
| 3300021478|Ga0210402_10233824 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui | 1695 | Open in IMG/M |
| 3300021559|Ga0210409_11453682 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300021560|Ga0126371_13289474 | Not Available | 546 | Open in IMG/M |
| 3300024178|Ga0247694_1022106 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300025922|Ga0207646_10119991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2362 | Open in IMG/M |
| 3300025928|Ga0207700_12038694 | Not Available | 501 | Open in IMG/M |
| 3300025929|Ga0207664_10857231 | Not Available | 816 | Open in IMG/M |
| 3300025941|Ga0207711_10864708 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
| 3300026331|Ga0209267_1120770 | All Organisms → cellular organisms → Bacteria | 1104 | Open in IMG/M |
| 3300026356|Ga0257150_1047198 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300026551|Ga0209648_10559396 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300027521|Ga0209524_1127135 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300027738|Ga0208989_10160697 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300027745|Ga0209908_10092717 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300027857|Ga0209166_10152514 | All Organisms → cellular organisms → Bacteria | 1260 | Open in IMG/M |
| 3300027889|Ga0209380_10686028 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300028047|Ga0209526_10143345 | Not Available | 1675 | Open in IMG/M |
| 3300028806|Ga0302221_10372441 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300029701|Ga0222748_1059999 | Not Available | 671 | Open in IMG/M |
| 3300030743|Ga0265461_11904894 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300031716|Ga0310813_11723155 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300031720|Ga0307469_11169404 | Not Available | 726 | Open in IMG/M |
| 3300031740|Ga0307468_102537260 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
| 3300031754|Ga0307475_10287674 | All Organisms → cellular organisms → Bacteria | 1319 | Open in IMG/M |
| 3300031754|Ga0307475_11007096 | Not Available | 655 | Open in IMG/M |
| 3300031770|Ga0318521_10169908 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1247 | Open in IMG/M |
| 3300031820|Ga0307473_10071232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Dankookia → Dankookia rubra | 1744 | Open in IMG/M |
| 3300031890|Ga0306925_11643928 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300031912|Ga0306921_12371251 | Not Available | 554 | Open in IMG/M |
| 3300031942|Ga0310916_10511629 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1022 | Open in IMG/M |
| 3300032174|Ga0307470_11600631 | Not Available | 545 | Open in IMG/M |
| 3300032180|Ga0307471_100057678 | All Organisms → cellular organisms → Bacteria | 3253 | Open in IMG/M |
| 3300032180|Ga0307471_100316246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales | 1656 | Open in IMG/M |
| 3300032180|Ga0307471_100932715 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1035 | Open in IMG/M |
| 3300032205|Ga0307472_100260345 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1367 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.81% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 14.85% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.89% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 9.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.95% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.96% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.97% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.97% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.97% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.97% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.98% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.98% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.99% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.99% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.99% |
| Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.99% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.99% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.99% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.99% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.99% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.99% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459013 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis soil at the rocks surface 0-21cm | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005163 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010111 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300020034 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024178 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK35 | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026356 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-A | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027745 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2M | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028806 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300029701 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| N57_00150110 | 2170459013 | Grass Soil | VELPAYRTFETEVNLLANQESEVKTELVKGSIEQNTPLIKKPDEKQQRIP |
| INPhiseqgaiiFebDRAFT_1019928823 | 3300000364 | Soil | KHRIKVELPGYRTFETEVNLLPRQKSKVETDLVVGSILQAGPLIKEQ* |
| JGI25383J37093_101802722 | 3300002560 | Grasslands Soil | KVELPGYRTFETEVNLLPTQKSKVETELIPGSILQAGPLIKEQ* |
| Ga0062385_100421162 | 3300004080 | Bog Forest Soil | LPGYRTFETEVSLLAGQKPEVKTEVARGSIEQASPDIKPAQ* |
| Ga0062385_108171282 | 3300004080 | Bog Forest Soil | KVELPGYRTFETEVDLLAGQKSEVKTELVKGSIEQASPDIKPPQ* |
| Ga0062387_1016529071 | 3300004091 | Bog Forest Soil | ELPGYRTFETEVDLLAGQKSEVKTELVKGSIEQASPDIKPPQ* |
| Ga0066823_100385541 | 3300005163 | Soil | EVNLLADQETEVKTELVKGSIEQNTPLIKKPEANTQPHS* |
| Ga0066690_105169311 | 3300005177 | Soil | HHVRIALPGYRTFETDVVLLAAQKSEVKTELVKGSIEQATVEIKKPE* |
| Ga0070687_1008476241 | 3300005343 | Switchgrass Rhizosphere | KVELPGYRSFDTEVNLLPGQKSEVKTELVKGSIEQASPEIKQPQ* |
| Ga0070697_1000020131 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | ELPGYRTFETDVEIVERQKSEVKTELVKGSIEQAGSEIKQPQ* |
| Ga0066707_107863482 | 3300005556 | Soil | PGYRTFETEVNLLPRQKSKVETELVAGSILQAGPLIKEQ* |
| Ga0066704_100490361 | 3300005557 | Soil | PGYRTFEMEVNLAAGQKSEIKTELVKGSVEQASPLIKQVKQP* |
| Ga0066670_104718222 | 3300005560 | Soil | VRIALPGYRTFETDVALLAGQKSEVKTELVKGSIEQATAEIKKPE* |
| Ga0070761_107165361 | 3300005591 | Soil | KVELPGYRTFETEVNLLVNQKSEVKTELVKGSIEQAGPEIKQPQ* |
| Ga0070763_109049711 | 3300005610 | Soil | ELPGYRTFETEVNLLAGQKSEVKTELVKGSIEQAGTEIKPQQ* |
| Ga0066651_104411511 | 3300006031 | Soil | GYRTFETEVGLLAGQKSEVKTELVKGSIEQASPEIKEVKEIKNQQ* |
| Ga0066656_107080871 | 3300006034 | Soil | FDTEINLLANQESEVKTELVPGSIEQNSPLIKKPN* |
| Ga0073928_100651381 | 3300006893 | Iron-Sulfur Acid Spring | TYDTEINLLAGQKTEVKTVLVPGSIEQAGPLIKKPD* |
| Ga0073928_102103063 | 3300006893 | Iron-Sulfur Acid Spring | PGYRTYDTEIDLLAGQKTEVKTVLVPGSIEQAGPLIKKPD* |
| Ga0066710_1005204743 | 3300009012 | Grasslands Soil | LPGYRTFDTEINLLANQESEVKTELDPGSIEQNSPLIKKPDTRQ |
| Ga0099829_102338674 | 3300009038 | Vadose Zone Soil | ETEVNLLAGQKSEVKTELVKGSIKQASPDIKQPR* |
| Ga0099828_103687151 | 3300009089 | Vadose Zone Soil | KVGLPGYRTFETELNLLAGQKSEVKTELVKGSIKQATPDIKQPR* |
| Ga0105237_101437373 | 3300009545 | Corn Rhizosphere | YRTFETEVNLLANQKSEVKTELVKGSIEQAGPEIKQPQ* |
| Ga0126384_118573511 | 3300010046 | Tropical Forest Soil | ELPGYRTFETEVNLLPKQKSKVETDLVVGSILQAGPLIKEQ* |
| Ga0126373_109404852 | 3300010048 | Tropical Forest Soil | YRTFETEVTLLAGQKSEVKTELVKGSVEQGSSDIRKNP* |
| Ga0127491_10647381 | 3300010111 | Grasslands Soil | VKVELPGYRTFETEVNLLPTQKSKVETELIPGSILQAGPLIKEQ* |
| Ga0134082_105593111 | 3300010303 | Grasslands Soil | KVELPGYRTFETEVNLLPNQKSKVETELIPGSILQAGPLIKEQ* |
| Ga0126370_103081993 | 3300010358 | Tropical Forest Soil | KVGLPGYRTFETEVNLLAGQKTEVKTELVKGSIKQASPDIKRP* |
| Ga0126372_109508622 | 3300010360 | Tropical Forest Soil | VELPGYRTFVTEVDLLANQETEVKTELQVGSIEQNSPMIKRPD* |
| Ga0126372_119592062 | 3300010360 | Tropical Forest Soil | FETEVNLLAGQKSEVRTELVKGSIEQAGPEIKEIKQQQKQ* |
| Ga0126372_125564692 | 3300010360 | Tropical Forest Soil | ELPGYRTFETEVNLLAGQKAEVKTELFKGSIEQASTDIKAPPRQ* |
| Ga0126377_109337493 | 3300010362 | Tropical Forest Soil | TFETEVNLLPSQKSKVETELVPGSILQAGPLIKEQ* |
| Ga0126377_114876602 | 3300010362 | Tropical Forest Soil | PGYRSFETEVSLLPGQKSEVKTELVKGSIEQATTDIKKPE* |
| Ga0126377_119004581 | 3300010362 | Tropical Forest Soil | LPGYRTFVTDVDLLVDQETEIKTELVAGSIQQNSPVIKKPD* |
| Ga0126377_133431152 | 3300010362 | Tropical Forest Soil | GYRTFDTEVNLLADQTTEVKTELVVGSIQQNTPLIKKPDQKPQ* |
| Ga0126379_126908511 | 3300010366 | Tropical Forest Soil | YRTFETEVNLLAGQKSEVKTELVKGSIKQASSDIKQPH* |
| Ga0150983_111877321 | 3300011120 | Forest Soil | YRTFETDVDVLVGQKSEMKTELVKGSIEQADTEIRKPQ* |
| Ga0137391_109609872 | 3300011270 | Vadose Zone Soil | RIKVTLPGYQTFETEVNLLPRQKSTIKTELVHGSITQADPLIKKQ* |
| Ga0137362_101767863 | 3300012205 | Vadose Zone Soil | EINLLANQESEVKTELVPGSIEQNSPLIKKPDARR* |
| Ga0137380_105595123 | 3300012206 | Vadose Zone Soil | PGYRTFETEVNLLPTQKSKVETELIPGSILQAGPLIKEQ* |
| Ga0137379_114278172 | 3300012209 | Vadose Zone Soil | ELPGYRTFDTEMNLLANQESEVKTELVPGSIEQNSPLIKKPDIRQ* |
| Ga0137361_115444712 | 3300012362 | Vadose Zone Soil | ELPAYRTFETGVNLVEKQESEIKTELEKGSIEQNTPLIKKPDDKPQQKPEQK* |
| Ga0137404_110040611 | 3300012929 | Vadose Zone Soil | TFDTEINLLANQESEVKTELVPGSIEQNSPLIKKPDARH* |
| Ga0137404_123088191 | 3300012929 | Vadose Zone Soil | TFDTEINLLANQESEVKTELVPGSIEQNSPLIKKPDIRQ* |
| Ga0126369_100050001 | 3300012971 | Tropical Forest Soil | RTFLTEVDLLANQETEVKTELIPGSIQQNTPIIKKPD* |
| Ga0126369_103398121 | 3300012971 | Tropical Forest Soil | RTFETEVNLVAGQKSEVKTELVKGSIQQASPDIKKPQ* |
| Ga0126369_110197682 | 3300012971 | Tropical Forest Soil | ETEVNLLPNQKSEVKTELVKGSIEQASPEIKQPQ* |
| Ga0137412_103426602 | 3300015242 | Vadose Zone Soil | YRTFETEVNLLVNQKSEVKTELVKGSIEQAGPEIKQPQ* |
| Ga0137403_116147252 | 3300015264 | Vadose Zone Soil | RVELPGYRTFDTEMNLLANQESEVKTELVPGSIEQNSPLIKKPDIRQ* |
| Ga0182037_108881211 | 3300016404 | Soil | PGYRTFLTEVDLLANQETEVKTELVPGSIEQNTPIIKKPDAQ |
| Ga0187816_101256981 | 3300017995 | Freshwater Sediment | ELAGYRTFDTDVTLIAGQKSEVKTELVKGSIEDAGSEIKKH |
| Ga0193713_10655782 | 3300019882 | Soil | LPAYRTFETEVNLLANQESEIKTELVKGSIEQNTPLIKKPDDKPQQKPEQK |
| Ga0193728_12084263 | 3300019890 | Soil | YRTYETEINLLAGQKTEVKTELVKGSIEQAGPLIKKPN |
| Ga0193730_11579642 | 3300020002 | Soil | LPGYRTYDTEINLLAGQKTEVKTVLVPGSIEQAGPLIKKPN |
| Ga0193753_101123861 | 3300020034 | Soil | LPAYRTFETEVNLLANQESEIKTELVKGSIEQNTPLIKKPDDQPQQKPGQEQ |
| Ga0210407_101557951 | 3300020579 | Soil | PGYRTYETEVDVLAGQKAEVKTELVKGSIEQAGSDIKKPQ |
| Ga0210407_113543551 | 3300020579 | Soil | LPGYRTFETDVDVLVGQKSEMKTELVKGSIEQADTEIKKPQ |
| Ga0210403_101951671 | 3300020580 | Soil | YRTFETEVNLLRGQKSEVKTELVKGSIEQGGPDIKPPQ |
| Ga0210399_111905951 | 3300020581 | Soil | TYETDVNVVVGQKSEMKTELVKGSIEQADTEIKKPQ |
| Ga0210404_103279062 | 3300021088 | Soil | YRTYDTEINLLAGQKTEVKTVLVPGSIEQAGPLIKKPD |
| Ga0210406_104484611 | 3300021168 | Soil | GYRTYETEVDVLAGQKAEVKTELVKGSIEQAGSDIKKPQ |
| Ga0210406_108024631 | 3300021168 | Soil | FDTVVDLLPKQKSEVKTELAKGSIEQASPDIKPPQ |
| Ga0210406_111942741 | 3300021168 | Soil | FETDVDVLVGQKSEMKTELVKGSIEQADTEIKKPQ |
| Ga0210386_101426523 | 3300021406 | Soil | RTFETEVNLLQGQKSEVKTELVKGSIEQSGPDVKPPQ |
| Ga0210391_104403522 | 3300021433 | Soil | LPGYRTFETEVNVLAGQKSEVKTELLKGSIEQAGSDIKQPQ |
| Ga0210402_102338243 | 3300021478 | Soil | GYRTFETEVNLLAGQKSEVKTELVKGSIEQAGSEIKPQQ |
| Ga0210409_114536822 | 3300021559 | Soil | TFETEVNLLVGQKSEVKTELVKGSIEQAGPEIKEIKQPN |
| Ga0126371_132894741 | 3300021560 | Tropical Forest Soil | TFETEVNLLANQKSEVKTELVKGSIEQAGPEIKQP |
| Ga0247694_10221061 | 3300024178 | Soil | IKVELPGYRTFETDVEIVERQKSEVKTELVKGSIEQAGSEIKQPQ |
| Ga0207646_101199913 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | DTEINLLANQESEVKTELVPGSIQQNSPLIKKPDARQ |
| Ga0207700_120386942 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | PGYRTFETEVNLLAGQKSEVKTELVKGSIQQATPEIKHL |
| Ga0207664_108572312 | 3300025929 | Agricultural Soil | ETEVNLLAGQKSEIKTELVKGSIEQAGPLIKEPQTVSQNPGR |
| Ga0207711_108647081 | 3300025941 | Switchgrass Rhizosphere | PGYRTFVTEVDLLANQQTEVKTELQVGSIQQNTPIIKKPD |
| Ga0209267_11207701 | 3300026331 | Soil | FETEVSLLAGQKSEVKTELVKGSIEQASPEIKNQE |
| Ga0257150_10471982 | 3300026356 | Soil | AYRTFETEVNLLANQESEIKTELVKGSIEQNTPLIKKPDDKPQQQKQ |
| Ga0209648_105593961 | 3300026551 | Grasslands Soil | PGYRTFETEVDLLQGQKSEVKTELVKGSIEQAGPDMKSPQ |
| Ga0209524_11271352 | 3300027521 | Forest Soil | KVELPGYRTFETEVNLLAGQKSEVKTELVKGSIVQAGPEIKQPN |
| Ga0208989_101606971 | 3300027738 | Forest Soil | TYDTEINLLAGQKTEVKTVLVPGSIEQAGPLIKKKD |
| Ga0209908_100927171 | 3300027745 | Thawing Permafrost | TFETEVNLLVNQKSEVKTELVKGSIEQAGPEIKQPQ |
| Ga0209166_101525143 | 3300027857 | Surface Soil | TFVTEVDLLPNQETQVKTELVAGSIEQNTPIIKKPDTKP |
| Ga0209380_106860282 | 3300027889 | Soil | PGYRTFETEVNLLQGQKSEVKTELVKGSIEQAGPDVKPPQ |
| Ga0209526_101433451 | 3300028047 | Forest Soil | PGYRTFETEVNLLAGQKSEIKTELVKGSIEQAGPLIKEPEKQSENPGR |
| Ga0302221_103724412 | 3300028806 | Palsa | TFDTTVDLLPNQKSEVKTELVKGSIEQAGPEIKQQP |
| Ga0222748_10599992 | 3300029701 | Soil | PGYRTFETEVNLLAGQKSEVKTELAKGSIEQASPDIKAPQ |
| Ga0265461_119048942 | 3300030743 | Soil | LPGYRTFETDVNVLVGQKSEMKTELVKGSIEQAGAEIKKP |
| Ga0310813_117231551 | 3300031716 | Soil | YRTFETEVNLLPRQKSKVETDLVVGSILQAGSLIKEQ |
| Ga0307469_111694041 | 3300031720 | Hardwood Forest Soil | GYQTFETEINLLAHQKSEVKTELVRGSIEQAGALVKQP |
| Ga0307468_1025372601 | 3300031740 | Hardwood Forest Soil | LPGYRTFETEINLLPKQKFTVKTELVKGSITQADPLIKKEEKP |
| Ga0307475_102876741 | 3300031754 | Hardwood Forest Soil | GYRTFETELNLLANQESEIKTELAKGSIEQNTPLIKKPDDKPEQRP |
| Ga0307475_110070962 | 3300031754 | Hardwood Forest Soil | FETEVDLLQGQKSEVKTELVKGSIEQAGPDVKPPQ |
| Ga0318521_101699081 | 3300031770 | Soil | ELPGYRTFETEVTLLAGQKSEVKTELVKGSVEQGSSDIRKNP |
| Ga0307473_100712324 | 3300031820 | Hardwood Forest Soil | TFETEVNLLAGQKSELKTELVKGSIEQASPAIKPPK |
| Ga0306925_116439281 | 3300031890 | Soil | FVTEVDLLANQETEVKTELRVGSIEQNSPVIKKPD |
| Ga0306921_123712511 | 3300031912 | Soil | ELPGYRTFMTEVDLLANQETEVKTELVPGSIEQNTPIIKKPDTK |
| Ga0310916_105116291 | 3300031942 | Soil | VELPGYRTFETEVTLLAGQKSEVKTELVKGSVEQGSSDIRKNP |
| Ga0310909_110768732 | 3300031947 | Soil | ELNLLANQESEIKTELIPGSIEQNSPLIKKPDEKQSQKP |
| Ga0307470_116006312 | 3300032174 | Hardwood Forest Soil | TFDTEVNLLADQETEVKTELKVGSIEQNTPLIKKPDVKQ |
| Ga0307471_1000576781 | 3300032180 | Hardwood Forest Soil | IELPGYRTFETEVNLLAGQKTEVKTELVKGSIQQAGALIKQSS |
| Ga0307471_1003162461 | 3300032180 | Hardwood Forest Soil | LPGYRTFVTEVDLLANQETEVKTELQIGSIEQNSPMIKRPDTD |
| Ga0307471_1009327152 | 3300032180 | Hardwood Forest Soil | PGYRTFETELNLLAGQKSEVKTELVKGSIKQATPDIKQPQ |
| Ga0307472_1002603451 | 3300032205 | Hardwood Forest Soil | YRTYDTEVNLHANQVSEVKTELPKGSIEQNTPLIKKPDDKPEQRP |
| ⦗Top⦘ |