


| Basic Information | |
|---|---|
| Family ID | F102459 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 101 |
| Average Sequence Length | 40 residues |
| Representative Sequence | VPIVRSVSQISGKLKLNFSANFLLSAALSKDAPRMTAFFRS |
| Number of Associated Samples | 92 |
| Number of Associated Scaffolds | 101 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 20.79 % |
| % of genes near scaffold ends (potentially truncated) | 11.88 % |
| % of genes from short scaffolds (< 2000 bps) | 81.19 % |
| Associated GOLD sequencing projects | 85 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.26 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (21.782 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.624 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (38.614 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 18.84% β-sheet: 0.00% Coil/Unstructured: 81.16% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.26 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 101 Family Scaffolds |
|---|---|---|
| PF00578 | AhpC-TSA | 59.41 |
| PF00296 | Bac_luciferase | 3.96 |
| PF01546 | Peptidase_M20 | 2.97 |
| PF13669 | Glyoxalase_4 | 1.98 |
| PF00171 | Aldedh | 1.98 |
| PF13193 | AMP-binding_C | 1.98 |
| PF00873 | ACR_tran | 0.99 |
| PF00923 | TAL_FSA | 0.99 |
| PF05235 | CHAD | 0.99 |
| PF02424 | ApbE | 0.99 |
| PF01243 | Putative_PNPOx | 0.99 |
| PF02771 | Acyl-CoA_dh_N | 0.99 |
| PF00486 | Trans_reg_C | 0.99 |
| PF03372 | Exo_endo_phos | 0.99 |
| PF07969 | Amidohydro_3 | 0.99 |
| PF10091 | Glycoamylase | 0.99 |
| PF12773 | DZR | 0.99 |
| PF01261 | AP_endonuc_2 | 0.99 |
| PF08534 | Redoxin | 0.99 |
| PF09995 | MPAB_Lcp_cat | 0.99 |
| PF08541 | ACP_syn_III_C | 0.99 |
| PF00753 | Lactamase_B | 0.99 |
| PF02518 | HATPase_c | 0.99 |
| PF13343 | SBP_bac_6 | 0.99 |
| PF00015 | MCPsignal | 0.99 |
| PF06439 | 3keto-disac_hyd | 0.99 |
| PF02515 | CoA_transf_3 | 0.99 |
| COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
|---|---|---|---|
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 3.96 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 1.98 |
| COG0840 | Methyl-accepting chemotaxis protein (MCP) | Signal transduction mechanisms [T] | 1.98 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 1.98 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 1.98 |
| COG0176 | Transaldolase/fructose-6-phosphate aldolase | Carbohydrate transport and metabolism [G] | 0.99 |
| COG1477 | FAD:protein FMN transferase ApbE | Posttranslational modification, protein turnover, chaperones [O] | 0.99 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.99 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.99 |
| COG3025 | Inorganic triphosphatase YgiF, contains CYTH and CHAD domains | Inorganic ion transport and metabolism [P] | 0.99 |
| COG5607 | CHAD domain, binds inorganic polyphosphates | Function unknown [S] | 0.99 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004009|Ga0055437_10256409 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300004025|Ga0055433_10181562 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300005171|Ga0066677_10179272 | All Organisms → cellular organisms → Bacteria | 1176 | Open in IMG/M |
| 3300005183|Ga0068993_10230973 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300005332|Ga0066388_100137681 | All Organisms → cellular organisms → Bacteria | 2999 | Open in IMG/M |
| 3300005332|Ga0066388_102063530 | All Organisms → cellular organisms → Bacteria | 1024 | Open in IMG/M |
| 3300005444|Ga0070694_100005344 | All Organisms → cellular organisms → Bacteria | 7764 | Open in IMG/M |
| 3300005445|Ga0070708_100969543 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 797 | Open in IMG/M |
| 3300005518|Ga0070699_100412614 | All Organisms → cellular organisms → Bacteria | 1222 | Open in IMG/M |
| 3300005537|Ga0070730_10168728 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1475 | Open in IMG/M |
| 3300005549|Ga0070704_101994128 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300005557|Ga0066704_10547268 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300005713|Ga0066905_100550148 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
| 3300005764|Ga0066903_100666945 | All Organisms → cellular organisms → Bacteria | 1823 | Open in IMG/M |
| 3300005829|Ga0074479_10650973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2176 | Open in IMG/M |
| 3300005876|Ga0075300_1016619 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
| 3300005886|Ga0075286_1035528 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300009012|Ga0066710_100594537 | All Organisms → cellular organisms → Bacteria | 1678 | Open in IMG/M |
| 3300009038|Ga0099829_10140418 | All Organisms → cellular organisms → Bacteria | 1920 | Open in IMG/M |
| 3300009038|Ga0099829_10188536 | All Organisms → cellular organisms → Bacteria | 1663 | Open in IMG/M |
| 3300009038|Ga0099829_10371593 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1179 | Open in IMG/M |
| 3300009078|Ga0105106_10215829 | All Organisms → cellular organisms → Bacteria | 1398 | Open in IMG/M |
| 3300009100|Ga0075418_11873356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 653 | Open in IMG/M |
| 3300009100|Ga0075418_12886737 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300009137|Ga0066709_102930456 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300009156|Ga0111538_11339940 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 903 | Open in IMG/M |
| 3300009805|Ga0105079_1021012 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300010366|Ga0126379_10600250 | All Organisms → cellular organisms → Bacteria | 1186 | Open in IMG/M |
| 3300010401|Ga0134121_11659314 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300011271|Ga0137393_10164343 | All Organisms → cellular organisms → Bacteria | 1861 | Open in IMG/M |
| 3300011271|Ga0137393_11726813 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300012096|Ga0137389_11752491 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300012171|Ga0137342_1071315 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300012174|Ga0137338_1121060 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300012189|Ga0137388_10201284 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 1795 | Open in IMG/M |
| 3300012202|Ga0137363_10001277 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 14399 | Open in IMG/M |
| 3300012204|Ga0137374_10007946 | All Organisms → cellular organisms → Bacteria | 12593 | Open in IMG/M |
| 3300012210|Ga0137378_10100472 | All Organisms → cellular organisms → Bacteria | 2655 | Open in IMG/M |
| 3300012285|Ga0137370_10109356 | All Organisms → cellular organisms → Bacteria | 1564 | Open in IMG/M |
| 3300012349|Ga0137387_10107096 | All Organisms → cellular organisms → Bacteria | 1955 | Open in IMG/M |
| 3300012350|Ga0137372_10698561 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300012353|Ga0137367_10089508 | All Organisms → cellular organisms → Bacteria | 2272 | Open in IMG/M |
| 3300012354|Ga0137366_10491454 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
| 3300012360|Ga0137375_11009285 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300012363|Ga0137390_11646723 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300012409|Ga0134045_1078548 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300012922|Ga0137394_10007140 | All Organisms → cellular organisms → Bacteria | 8616 | Open in IMG/M |
| 3300012930|Ga0137407_10226909 | All Organisms → cellular organisms → Bacteria | 1685 | Open in IMG/M |
| 3300012964|Ga0153916_10013722 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6626 | Open in IMG/M |
| 3300013306|Ga0163162_12815567 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300014882|Ga0180069_1164755 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300014883|Ga0180086_1133854 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300014884|Ga0180104_1128297 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300014885|Ga0180063_1025611 | All Organisms → cellular organisms → Bacteria | 1629 | Open in IMG/M |
| 3300015264|Ga0137403_10005167 | All Organisms → cellular organisms → Bacteria | 15167 | Open in IMG/M |
| 3300015371|Ga0132258_10012592 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 17823 | Open in IMG/M |
| 3300015371|Ga0132258_10247387 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4356 | Open in IMG/M |
| 3300015371|Ga0132258_13236865 | All Organisms → cellular organisms → Bacteria | 1122 | Open in IMG/M |
| 3300015372|Ga0132256_103499516 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300015373|Ga0132257_103424649 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300015374|Ga0132255_102835213 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 741 | Open in IMG/M |
| 3300017974|Ga0187777_10664726 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300017994|Ga0187822_10016324 | All Organisms → cellular organisms → Bacteria | 1855 | Open in IMG/M |
| 3300018031|Ga0184634_10004969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 4424 | Open in IMG/M |
| 3300018063|Ga0184637_10590318 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300018082|Ga0184639_10164046 | All Organisms → cellular organisms → Bacteria | 1180 | Open in IMG/M |
| 3300021081|Ga0210379_10264849 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300025318|Ga0209519_10450472 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300025535|Ga0207423_1039671 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300025535|Ga0207423_1041480 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300025569|Ga0210073_1002867 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3326 | Open in IMG/M |
| 3300025580|Ga0210138_1003066 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3016 | Open in IMG/M |
| 3300025922|Ga0207646_10201378 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1798 | Open in IMG/M |
| 3300026015|Ga0208286_1010405 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300026023|Ga0207677_10553927 | All Organisms → cellular organisms → Bacteria | 1003 | Open in IMG/M |
| 3300026469|Ga0257169_1033823 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300026480|Ga0257177_1003993 | All Organisms → cellular organisms → Bacteria | 1714 | Open in IMG/M |
| 3300026507|Ga0257165_1030644 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 937 | Open in IMG/M |
| 3300026532|Ga0209160_1188276 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 836 | Open in IMG/M |
| 3300027577|Ga0209874_1159952 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300027857|Ga0209166_10120808 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1447 | Open in IMG/M |
| 3300027862|Ga0209701_10016879 | All Organisms → cellular organisms → Bacteria | 4776 | Open in IMG/M |
| 3300027875|Ga0209283_10143090 | All Organisms → cellular organisms → Bacteria | 1584 | Open in IMG/M |
| 3300027909|Ga0209382_10697000 | All Organisms → cellular organisms → Bacteria | 1093 | Open in IMG/M |
| 3300027979|Ga0209705_10180190 | All Organisms → cellular organisms → Bacteria | 1118 | Open in IMG/M |
| 3300028803|Ga0307281_10276791 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 622 | Open in IMG/M |
| 3300028872|Ga0307314_10304619 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300028878|Ga0307278_10170769 | All Organisms → cellular organisms → Bacteria | 972 | Open in IMG/M |
| 3300030006|Ga0299907_10078014 | All Organisms → cellular organisms → Bacteria | 2689 | Open in IMG/M |
| 3300031548|Ga0307408_100078066 | All Organisms → cellular organisms → Bacteria | 2467 | Open in IMG/M |
| 3300031740|Ga0307468_100079847 | All Organisms → cellular organisms → Bacteria | 1859 | Open in IMG/M |
| 3300031903|Ga0307407_11165093 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300031949|Ga0214473_10424889 | All Organisms → cellular organisms → Bacteria | 1496 | Open in IMG/M |
| 3300032002|Ga0307416_100916860 | All Organisms → cellular organisms → Bacteria | 977 | Open in IMG/M |
| 3300032180|Ga0307471_100916990 | All Organisms → cellular organisms → Bacteria | 1043 | Open in IMG/M |
| 3300032256|Ga0315271_11859351 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300032770|Ga0335085_10039996 | All Organisms → cellular organisms → Bacteria | 6445 | Open in IMG/M |
| 3300032770|Ga0335085_11016448 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
| 3300032782|Ga0335082_10768530 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300032829|Ga0335070_10352764 | All Organisms → cellular organisms → Bacteria | 1415 | Open in IMG/M |
| 3300034178|Ga0364934_0113526 | All Organisms → cellular organisms → Bacteria | 1021 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 21.78% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 6.93% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 5.94% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.95% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 4.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.96% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.96% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.96% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.97% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 2.97% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.97% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.98% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.98% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.98% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.98% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.98% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.99% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.99% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.99% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.99% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.99% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.99% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.99% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.99% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.99% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.99% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.99% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.99% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.99% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004009 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300004025 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D1 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005183 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005829 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC | Environmental | Open in IMG/M |
| 3300005876 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_401 | Environmental | Open in IMG/M |
| 3300005886 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_205 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009805 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_0_10 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012171 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT466_2 | Environmental | Open in IMG/M |
| 3300012174 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT366_2 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012409 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014882 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231B'_16_10D | Environmental | Open in IMG/M |
| 3300014883 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10D | Environmental | Open in IMG/M |
| 3300014884 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_1Da | Environmental | Open in IMG/M |
| 3300014885 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_10D | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300025318 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1 | Environmental | Open in IMG/M |
| 3300025535 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025569 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025580 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026015 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_401 (SPAdes) | Environmental | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026469 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-B | Environmental | Open in IMG/M |
| 3300026480 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-B | Environmental | Open in IMG/M |
| 3300026507 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-B | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300027577 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027979 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
| 3300028872 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300034178 | Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0055437_102564093 | 3300004009 | Natural And Restored Wetlands | MVRSVSQISGKLKLNFSANFLLSAALSKDAPRMTALLRS* |
| Ga0055433_101815621 | 3300004025 | Natural And Restored Wetlands | MVRSVSQIRGKLKWNFSANALFSAGVSKDTPMIAAFFLS* |
| Ga0066677_101792721 | 3300005171 | Soil | VPIVRSVSQISGKLKLNFSAKALFSAGLSNDAPRMTAPLAS* |
| Ga0068993_102309732 | 3300005183 | Natural And Restored Wetlands | MVRSVSQIRGKLKWNFSANALFSAGVSKDTPTIAAFFLS* |
| Ga0066388_1001376814 | 3300005332 | Tropical Forest Soil | MVRSVSQISGKLKLNFSANFLLSAALSKEAPRMTAFLRS* |
| Ga0066388_1020635303 | 3300005332 | Tropical Forest Soil | MERSVSLIRGKLKLNFSANFLLSAWLSKDAPRMTAFLASY* |
| Ga0070694_1000053444 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MARSVSQIRGKLKWNFSANARFSAGVSKETPRMTAFLRS* |
| Ga0070708_1009695431 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VPIVRSVSEISGKLKLNFSANFLLSAALSKDAPRMTAFLRS* |
| Ga0070699_1004126143 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | VPIVRSVSQMSGKLKWYFSAKALFSAGVSNETPTIAAFFRS* |
| Ga0070730_101687283 | 3300005537 | Surface Soil | VSQRSGKLKWNFSANALFSWGVSKETPRMRAFFLS* |
| Ga0070704_1019941281 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MVRSVSQISGKLKLNFSAKALFSAGLSNDAPRMTAPFAS* |
| Ga0066704_105472683 | 3300005557 | Soil | VPIVRSVSQISGKLNWNFSANFLLSAALSKDAPRMTAFFRS* |
| Ga0066905_1005501483 | 3300005713 | Tropical Forest Soil | VSQISGKVKWNFSANFLLSSGVSNETPRMTAFFRS* |
| Ga0066903_1006669451 | 3300005764 | Tropical Forest Soil | VPIVRSVSQINGKLKENFSANFLLSAGESKEMPRIAAFFRS* |
| Ga0074479_106509733 | 3300005829 | Sediment (Intertidal) | MVRSVSQISGKLKLNFSANFLLSATLSKDAPRMTAFLWS* |
| Ga0075300_10166193 | 3300005876 | Rice Paddy Soil | VSQIRGKLKWNFSANARFSAGVSKETPRMTAFLRS* |
| Ga0075286_10355283 | 3300005886 | Rice Paddy Soil | MTRSVSQMSGKLKWNFSANARFSAGVSKETPRMTAFLRS* |
| Ga0066710_1005945373 | 3300009012 | Grasslands Soil | VPIVRSVSQISGKLKLNFSAKALFSAGLSNDAPRMTAPLAS |
| Ga0099829_101404182 | 3300009038 | Vadose Zone Soil | VPIVRSVSQISGKLKLNFSANFLLSAALSKDAPRMTAFFRS* |
| Ga0099829_101885362 | 3300009038 | Vadose Zone Soil | VPILRSVSQISGKLKLNFSANFLLSAALSKDAPRMMAFLRS* |
| Ga0099829_103715933 | 3300009038 | Vadose Zone Soil | VPILRSVSQISGKLKLNFSANFLLSAALSKDAPRMTAFLRS* |
| Ga0105106_102158292 | 3300009078 | Freshwater Sediment | LAGSALAPYAVPIVRSVSQRRGKLKLNFSAKALFAAALSNDAPRMTAPFAS* |
| Ga0075418_118733562 | 3300009100 | Populus Rhizosphere | MARSVSQMSGKLKWCFSAKALFSAGASKEAPRIAAFFRS* |
| Ga0075418_128867371 | 3300009100 | Populus Rhizosphere | LAPYAVPIFRSVSQISGKLKPNFSANALLAAALSNEAPRMTAFLAS* |
| Ga0066709_1029304563 | 3300009137 | Grasslands Soil | VPIVRSVSQISGKLKLNFSAKALLAAGLSNDAPRMTAPLAS* |
| Ga0111538_113399403 | 3300009156 | Populus Rhizosphere | SVSQMSGKLKWYFSAKALFSAGVSKETPRIAAFFRS* |
| Ga0105079_10210122 | 3300009805 | Groundwater Sand | VPIVRSVSQISGKLKLNFSANFLLSAALSKDAPRMTAFLPS* |
| Ga0126379_106002501 | 3300010366 | Tropical Forest Soil | RSVSQISGKVKWNFSANFLLSSGVSNETPRMTAFFRS* |
| Ga0134121_116593143 | 3300010401 | Terrestrial Soil | VSHSSGKLKLNFSANFLLSASLSKDAPTIAAFFRS* |
| Ga0137393_101643434 | 3300011271 | Vadose Zone Soil | VSQISGKLKLNFSANFLLSAALSKDAPRMTAFLRS* |
| Ga0137393_117268133 | 3300011271 | Vadose Zone Soil | VPIVRSVSQISGKLKLNFSANFLLSAALSKDAPRMMAFLRS* |
| Ga0137389_117524913 | 3300012096 | Vadose Zone Soil | VPIVRSVSQISGKLKLNFSANFLLSAALSKDAPRMTAFLRS* |
| Ga0137342_10713153 | 3300012171 | Soil | VPIVRSVSQISGKVKLNFSANFLLSASLSNETPRMTAFFRS* |
| Ga0137338_11210602 | 3300012174 | Soil | VPIVRSVSQISGKLKLNFSANFLLSAALSKDAPRMTQFLRS* |
| Ga0137388_102012842 | 3300012189 | Vadose Zone Soil | VSQISGKLKLNFSANFLLSAALSKDAPRMMAFLRS* |
| Ga0137363_100012775 | 3300012202 | Vadose Zone Soil | VSQISGKLKLNFSANFLLSAALSKDAPRITAFLRS* |
| Ga0137374_1000794611 | 3300012204 | Vadose Zone Soil | VPILRSVSEISGKLKLNFSANFLLSAALSKDAPRMTAFFRS* |
| Ga0137378_101004726 | 3300012210 | Vadose Zone Soil | SVSQIRGKLKLNFSANFLLSAALSKDAPRMTAFFRS* |
| Ga0137370_101093563 | 3300012285 | Vadose Zone Soil | VPIFRSVSQISGKLKLNFSAKALFSAGLSNDAPRMTAPLAS* |
| Ga0137387_101070962 | 3300012349 | Vadose Zone Soil | VPIVRSVSQIRGKLKLNFSANFLLSAALSKDAPRMTAFFRS* |
| Ga0137372_106985611 | 3300012350 | Vadose Zone Soil | VPIVRSVSQISGKLKLNFSANFLLSAALSKDAPRMTAFFRL* |
| Ga0137367_100895084 | 3300012353 | Vadose Zone Soil | VSEISGKLKLNFSANFLLSAALSKDAPRMTAFFRS* |
| Ga0137366_104914543 | 3300012354 | Vadose Zone Soil | VPIVRSVSQIRGKLKLNFSANFLLSAALSKDAPIMTAFFRS* |
| Ga0137375_110092851 | 3300012360 | Vadose Zone Soil | RSVSQRSGKLKPYLSANALLSAGVSKEMPRMTASFLS* |
| Ga0137390_116467233 | 3300012363 | Vadose Zone Soil | VPIVRSVSQISGKLKLNFSAKALFSAGLSNDAPRMTAPFAS* |
| Ga0134045_10785482 | 3300012409 | Grasslands Soil | VPIVRSVSQISGKLKLNFPAKALLAAGLSNDAPRMTAPLAS* |
| Ga0137394_100071403 | 3300012922 | Vadose Zone Soil | VPIVRSVSQISGKLKWNFSAKLLFSAGVSKDTPRITAPFRS* |
| Ga0137407_102269093 | 3300012930 | Vadose Zone Soil | VPIVRSVSQIRGKLKLNFSANFLLSAALSKDAPRMTAFFRP* |
| Ga0153916_100137223 | 3300012964 | Freshwater Wetlands | VPIIRSVSQISGKLKLNFSANFLLSSALSKDAPRMTAFLRS* |
| Ga0163162_128155672 | 3300013306 | Switchgrass Rhizosphere | VPIFRSVSQMSGKLKLNFSANFLLSASLSKDAPTIAAFFRS* |
| Ga0180069_11647553 | 3300014882 | Soil | VPIVRSVSQISGKLKLNFSANFLLSASLSNEAPRMTAFFRS* |
| Ga0180086_11338542 | 3300014883 | Soil | LAPYAVPIVRSVSQISGKLKLNFSANFLLSAALSKDAPRMTAFLRS* |
| Ga0180104_11282972 | 3300014884 | Soil | VPIVRSVSQISGKLKENFSAKALFSAGVSKDAPRMTAFLRS* |
| Ga0180063_10256111 | 3300014885 | Soil | VSQRSGKGKLNFSANFLLSASLSNETPRMTAFFRS* |
| Ga0137403_100051677 | 3300015264 | Vadose Zone Soil | VPIVRSVSQIRGKLKLNFSANFLLSAALSKDAPRMTAFLRS* |
| Ga0132258_100125926 | 3300015371 | Arabidopsis Rhizosphere | VPISRSVSQMSGKLKWYFSAKALFSAGVSKETPRIAAFFRS* |
| Ga0132258_102473876 | 3300015371 | Arabidopsis Rhizosphere | VPIFRSVSQISGKLKWYFSANALFSAGVSNETPTIAALFRS* |
| Ga0132258_132368653 | 3300015371 | Arabidopsis Rhizosphere | VPIFRSVSQISGKLKWNFSAKALFSAGVSNETPTIAAFFRS* |
| Ga0132256_1034995163 | 3300015372 | Arabidopsis Rhizosphere | MLRSVSQISGKLEWNFSANALFSAGVSNDMPTIAAFFRS* |
| Ga0132257_1034246493 | 3300015373 | Arabidopsis Rhizosphere | SVSQSSGKLNPYLSANALLSAGGSKETPMMAAPFLS* |
| Ga0132255_1028352131 | 3300015374 | Arabidopsis Rhizosphere | IFRSVSQISGKLKWYFSPNALFSAGVSKETPTIAALFRS* |
| Ga0187777_106647261 | 3300017974 | Tropical Peatland | VPIARSVSQISGKLKWNFSAKALFSAGVSNDAPRMTAFLASY |
| Ga0187822_100163243 | 3300017994 | Freshwater Sediment | MARSVSQISGKLKWNFSANARFSAGVSKETPRIAAFLRS |
| Ga0184634_100049693 | 3300018031 | Groundwater Sediment | VPIFRSVSQISGKLKLYLSANALFSAGVSKETPRMTAPFVS |
| Ga0184637_105903182 | 3300018063 | Groundwater Sediment | VPIFRSVSQISGKLKLNLSAKALFSAGVSKETPRTTAPFAT |
| Ga0184639_101640463 | 3300018082 | Groundwater Sediment | VSQISGKLKLNLSAKALFSAGVSKETTRTTAQFAT |
| Ga0210379_102648492 | 3300021081 | Groundwater Sediment | VPIFRSVSQISGKLKLNLSANALFSAGVSKETPRTTAPFAS |
| Ga0209519_104504723 | 3300025318 | Soil | LAPYAVPIVRSVSQIRGKLKLNFSANFLLSVALSNEAPRMTAFFRS |
| Ga0207423_10396712 | 3300025535 | Natural And Restored Wetlands | MSQISGKLKLNFSANFLLSAALSKDAPRMTAFLRS |
| Ga0207423_10414803 | 3300025535 | Natural And Restored Wetlands | MVRSVSQISGKLKLNFSANFLLSAALSKDAPRMTALLRS |
| Ga0210073_10028674 | 3300025569 | Natural And Restored Wetlands | MSQISGKLKLNFSANFLLSAALSKDAPRMTALLRS |
| Ga0210138_10030667 | 3300025580 | Natural And Restored Wetlands | MVRSVSQISGKLKLNFSANFLLSAALSKDAPRLTALLRS |
| Ga0207646_102013782 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VPIVRSVSEISGKLKLNFSANFLLSAALSKDAPRMTAFLRS |
| Ga0208286_10104053 | 3300026015 | Rice Paddy Soil | MARSVSQIRGKLKWNFSANARFSAGVSKETPRMTAFLRS |
| Ga0207677_105539273 | 3300026023 | Miscanthus Rhizosphere | VSHNRGKLKLNFSAKALFFSGLSKLTPRMTAFFSVY |
| Ga0257169_10338233 | 3300026469 | Soil | VSQISGKLKLNFSANFLLSAALSKDAPRMTAFFRS |
| Ga0257177_10039932 | 3300026480 | Soil | VPIVRSVSQISGKLKLNFSANFLLSAALSKDAPRMTAFFRS |
| Ga0257165_10306443 | 3300026507 | Soil | VPIVRSVSQISGKLKLNFSANFLLSAALSKDAPRMTAFLRS |
| Ga0209160_11882763 | 3300026532 | Soil | VPIVRSVSQISGKLNWNFSANFLLSAALSKDAPRMTAFFRS |
| Ga0209874_11599522 | 3300027577 | Groundwater Sand | VPIVRSVSQISGKLKLNFSANFLLSAALSKDAPRMTAFLPS |
| Ga0209166_101208083 | 3300027857 | Surface Soil | VSQRSGKLKWNFSANALFSWGVSKETPRMRAFFLS |
| Ga0209701_100168797 | 3300027862 | Vadose Zone Soil | VPIVRSVSQISGKLKLNFSANFLLSAALSKDAPRMMAFLRS |
| Ga0209283_101430904 | 3300027875 | Vadose Zone Soil | VSQISGKLNLNFSANFLLSAALSKDAPRMTAFFRS |
| Ga0209382_106970001 | 3300027909 | Populus Rhizosphere | AVPIFRSVSQINGKLKPNFSANALFAAGLSNDAPRMTAFLAS |
| Ga0209705_101801903 | 3300027979 | Freshwater Sediment | LAGSALAPYAVPIVRSVSQRRGKLKLNFSAKALFAAALSNDAPRMTAPFAS |
| Ga0307281_102767912 | 3300028803 | Soil | VPIVRSVSQISGKLKLNLSANALFSAGVSKETPRMTAPFAS |
| Ga0307314_103046191 | 3300028872 | Soil | VVSQRSGKLKPYFSENFLFAAGVSKLTPKISAPLSL |
| Ga0307278_101707693 | 3300028878 | Soil | VSQISGKLKLYLSVNALFSAGVSKETPRMTAPFLS |
| Ga0299907_100780143 | 3300030006 | Soil | MVRSVSQISGKLNWNFSANFLLSAALSKEAPRMTAFLASY |
| Ga0307408_1000780663 | 3300031548 | Rhizosphere | VPIVRSVSQMSGKLKWNFSAKALFSAGLSKDAPRMTAFLRS |
| Ga0307468_1000798473 | 3300031740 | Hardwood Forest Soil | MVRSVSQISGKLKLNFSANFLLSAALSKDAPRMTAFLRS |
| Ga0307407_111650932 | 3300031903 | Rhizosphere | VSERSGKVKLNFSANFLLSAALSKDAPRMTAFLRS |
| Ga0214473_104248893 | 3300031949 | Soil | VPIFRSVSQISGKSKLNFSANALFSAGVSKETPTTAAPFWS |
| Ga0307416_1009168603 | 3300032002 | Rhizosphere | VPIVRSVSQMSGKLKLNFSAKALFSAGLSKDAPRMTAFLRS |
| Ga0307471_1009169903 | 3300032180 | Hardwood Forest Soil | LRSVSQISGKLKWNFSANFLLSSGVSNETPRMTAFFRS |
| Ga0315271_118593512 | 3300032256 | Sediment | VPIVRSVSQSSGKLKPYLSANALLSAGVSKETPRMTASFLS |
| Ga0335085_100399961 | 3300032770 | Soil | VSQISGKLNLNFSANFLLSATLSKDAPRMTAFLRS |
| Ga0335085_110164482 | 3300032770 | Soil | VSQIKGKLKENFSANFLLSAGVSKEIPRIAAFFRS |
| Ga0335082_107685301 | 3300032782 | Soil | VRSVSQRSGKLKWNFSANFLFSAGVSNDTPRITAFFLS |
| Ga0335070_103527643 | 3300032829 | Soil | MVRSVSQISGKLKLNFSANFLLSAAPSKDAPRMTAFLRS |
| Ga0364934_0113526_592_699 | 3300034178 | Sediment | VSQISGKLKLNLAANALFSAGVSKETPRTMAPFAS |
| ⦗Top⦘ |