


| Basic Information | |
|---|---|
| Family ID | F102096 |
| Family Type | Metagenome |
| Number of Sequences | 102 |
| Average Sequence Length | 45 residues |
| Representative Sequence | ARLMIETARPDSLVGMFSFGGLSHEQVMRSIELFATKVMPALGA |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.98 % |
| % of genes near scaffold ends (potentially truncated) | 94.12 % |
| % of genes from short scaffolds (< 2000 bps) | 93.14 % |
| Associated GOLD sequencing projects | 84 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (93.137 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (7.843 % of family members) |
| Environment Ontology (ENVO) | Unclassified (38.235 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (38.235 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.22% β-sheet: 0.00% Coil/Unstructured: 52.78% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF13472 | Lipase_GDSL_2 | 12.75 |
| PF01425 | Amidase | 7.84 |
| PF05635 | 23S_rRNA_IVP | 6.86 |
| PF09594 | GT87 | 2.94 |
| PF01070 | FMN_dh | 2.94 |
| PF04434 | SWIM | 1.96 |
| PF04909 | Amidohydro_2 | 1.96 |
| PF00408 | PGM_PMM_IV | 1.96 |
| PF00106 | adh_short | 0.98 |
| PF13458 | Peripla_BP_6 | 0.98 |
| PF14606 | Lipase_GDSL_3 | 0.98 |
| PF13379 | NMT1_2 | 0.98 |
| PF09084 | NMT1 | 0.98 |
| PF00535 | Glycos_transf_2 | 0.98 |
| PF02880 | PGM_PMM_III | 0.98 |
| PF13654 | AAA_32 | 0.98 |
| PF04519 | Bactofilin | 0.98 |
| PF03972 | MmgE_PrpD | 0.98 |
| PF13343 | SBP_bac_6 | 0.98 |
| PF01797 | Y1_Tnp | 0.98 |
| PF11846 | Wzy_C_2 | 0.98 |
| PF03807 | F420_oxidored | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 7.84 |
| COG0033 | Phosphoglucomutase/phosphomannomutase | Carbohydrate transport and metabolism [G] | 2.94 |
| COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 2.94 |
| COG1109 | Phosphomannomutase | Carbohydrate transport and metabolism [G] | 2.94 |
| COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 2.94 |
| COG4279 | Uncharacterized protein, contains SWIM-type Zn finger domain | Function unknown [S] | 1.96 |
| COG4715 | Uncharacterized protein, contains SWIM-type Zn finger domain | Function unknown [S] | 1.96 |
| COG5431 | Predicted nucleic acid-binding protein, contains SWIM-type Zn-finger domain | General function prediction only [R] | 1.96 |
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.98 |
| COG1664 | Cytoskeletal protein CcmA, bactofilin family | Cytoskeleton [Z] | 0.98 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.98 |
| COG2079 | 2-methylcitrate dehydratase PrpD | Carbohydrate transport and metabolism [G] | 0.98 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 93.14 % |
| Unclassified | root | N/A | 6.86 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000881|JGI10215J12807_1063876 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300001431|F14TB_103507247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 938 | Open in IMG/M |
| 3300004013|Ga0055465_10234610 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300005294|Ga0065705_10157557 | All Organisms → cellular organisms → Bacteria | 1837 | Open in IMG/M |
| 3300005295|Ga0065707_10550746 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300005295|Ga0065707_10584520 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300005295|Ga0065707_10695139 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300005339|Ga0070660_100427286 | All Organisms → cellular organisms → Bacteria | 1097 | Open in IMG/M |
| 3300005558|Ga0066698_10307449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1098 | Open in IMG/M |
| 3300005713|Ga0066905_101227573 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300005713|Ga0066905_102188714 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300005764|Ga0066903_104550121 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300005764|Ga0066903_109090880 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300005873|Ga0075287_1045970 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Ai1a-2 | 592 | Open in IMG/M |
| 3300006046|Ga0066652_101569420 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300006845|Ga0075421_101902920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 637 | Open in IMG/M |
| 3300006876|Ga0079217_10105013 | All Organisms → cellular organisms → Bacteria | 1279 | Open in IMG/M |
| 3300006918|Ga0079216_10246946 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
| 3300006969|Ga0075419_10080386 | All Organisms → cellular organisms → Bacteria | 2075 | Open in IMG/M |
| 3300007004|Ga0079218_10499459 | All Organisms → cellular organisms → Bacteria | 1075 | Open in IMG/M |
| 3300007076|Ga0075435_100262881 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1470 | Open in IMG/M |
| 3300009094|Ga0111539_10333587 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1765 | Open in IMG/M |
| 3300009094|Ga0111539_10655528 | All Organisms → cellular organisms → Bacteria | 1222 | Open in IMG/M |
| 3300009157|Ga0105092_10031241 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2824 | Open in IMG/M |
| 3300009157|Ga0105092_10867028 | Not Available | 532 | Open in IMG/M |
| 3300009167|Ga0113563_10415393 | All Organisms → cellular organisms → Bacteria | 1440 | Open in IMG/M |
| 3300009810|Ga0105088_1021080 | Not Available | 1020 | Open in IMG/M |
| 3300009837|Ga0105058_1191324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 509 | Open in IMG/M |
| 3300010043|Ga0126380_11658512 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300010362|Ga0126377_11527084 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300010401|Ga0134121_10413995 | All Organisms → cellular organisms → Bacteria | 1221 | Open in IMG/M |
| 3300011432|Ga0137428_1110148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 788 | Open in IMG/M |
| 3300012038|Ga0137431_1023892 | All Organisms → cellular organisms → Bacteria | 1669 | Open in IMG/M |
| 3300012203|Ga0137399_11688589 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300012355|Ga0137369_10169332 | All Organisms → cellular organisms → Bacteria | 1717 | Open in IMG/M |
| 3300012357|Ga0137384_10646599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 861 | Open in IMG/M |
| 3300012360|Ga0137375_11059362 | Not Available | 633 | Open in IMG/M |
| 3300012501|Ga0157351_1036981 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300012517|Ga0157354_1003217 | All Organisms → cellular organisms → Bacteria | 1300 | Open in IMG/M |
| 3300012519|Ga0157352_1010030 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
| 3300012582|Ga0137358_10323696 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
| 3300012893|Ga0157284_10332085 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300012924|Ga0137413_11044801 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300012929|Ga0137404_12127307 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300012951|Ga0164300_10016667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2457 | Open in IMG/M |
| 3300012976|Ga0134076_10114858 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1079 | Open in IMG/M |
| 3300013308|Ga0157375_12227925 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300013308|Ga0157375_13117401 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300014267|Ga0075313_1101687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 709 | Open in IMG/M |
| 3300015242|Ga0137412_10924889 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300015373|Ga0132257_102049558 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300015373|Ga0132257_103340623 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300015373|Ga0132257_104620494 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300016404|Ga0182037_10164755 | All Organisms → cellular organisms → Bacteria | 1686 | Open in IMG/M |
| 3300017654|Ga0134069_1111774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 895 | Open in IMG/M |
| 3300017792|Ga0163161_11216327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 652 | Open in IMG/M |
| 3300018000|Ga0184604_10024073 | All Organisms → cellular organisms → Bacteria | 1480 | Open in IMG/M |
| 3300018052|Ga0184638_1051733 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1495 | Open in IMG/M |
| 3300018056|Ga0184623_10239034 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
| 3300018063|Ga0184637_10235505 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1118 | Open in IMG/M |
| 3300018482|Ga0066669_11325608 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300022756|Ga0222622_10101082 | All Organisms → cellular organisms → Bacteria | 1774 | Open in IMG/M |
| 3300025289|Ga0209002_10305598 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
| 3300025322|Ga0209641_10923468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 575 | Open in IMG/M |
| 3300025326|Ga0209342_10304395 | All Organisms → cellular organisms → Bacteria | 1383 | Open in IMG/M |
| 3300025555|Ga0210121_1057897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Desulfobacca → Desulfobacca acetoxidans | 653 | Open in IMG/M |
| 3300025927|Ga0207687_10342413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1216 | Open in IMG/M |
| 3300025932|Ga0207690_11275859 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300025933|Ga0207706_11602788 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300025960|Ga0207651_11416858 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300025960|Ga0207651_11898257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 536 | Open in IMG/M |
| 3300026075|Ga0207708_11528118 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300026116|Ga0207674_11572683 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300026118|Ga0207675_101937378 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300026452|Ga0256821_1010527 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 909 | Open in IMG/M |
| 3300026523|Ga0209808_1121785 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1068 | Open in IMG/M |
| 3300027277|Ga0209846_1021438 | Not Available | 1054 | Open in IMG/M |
| 3300027513|Ga0208685_1085445 | Not Available | 679 | Open in IMG/M |
| 3300027717|Ga0209998_10013746 | All Organisms → cellular organisms → Bacteria | 1686 | Open in IMG/M |
| 3300027722|Ga0209819_10005254 | Not Available | 4114 | Open in IMG/M |
| 3300027835|Ga0209515_10646650 | Not Available | 523 | Open in IMG/M |
| 3300027873|Ga0209814_10035216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2072 | Open in IMG/M |
| 3300027874|Ga0209465_10131014 | All Organisms → cellular organisms → Bacteria | 1240 | Open in IMG/M |
| 3300027880|Ga0209481_10512730 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300027907|Ga0207428_10602498 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300028828|Ga0307312_10326780 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
| 3300030620|Ga0302046_10437484 | All Organisms → cellular organisms → Bacteria | 1073 | Open in IMG/M |
| 3300031847|Ga0310907_10790335 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300031852|Ga0307410_10706267 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300031901|Ga0307406_12048428 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300031911|Ga0307412_10493219 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
| 3300031912|Ga0306921_10404018 | All Organisms → cellular organisms → Bacteria | 1594 | Open in IMG/M |
| 3300031947|Ga0310909_10563318 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
| 3300031965|Ga0326597_10010543 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 12295 | Open in IMG/M |
| 3300031965|Ga0326597_10016016 | All Organisms → cellular organisms → Bacteria | 9783 | Open in IMG/M |
| 3300031965|Ga0326597_10341215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1687 | Open in IMG/M |
| 3300031965|Ga0326597_11083348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 801 | Open in IMG/M |
| 3300031995|Ga0307409_100513558 | All Organisms → cellular organisms → Bacteria | 1169 | Open in IMG/M |
| 3300032017|Ga0310899_10245575 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300032828|Ga0335080_11117903 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300033414|Ga0316619_12217759 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300033551|Ga0247830_10825002 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.84% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.84% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.84% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.90% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.92% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.92% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 3.92% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.94% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.94% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 2.94% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.94% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 2.94% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.94% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.96% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 1.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.96% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.98% |
| Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment | 0.98% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.98% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.98% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.98% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.98% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.98% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.98% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.98% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.98% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000881 | Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soil | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300004013 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005873 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_301 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300009810 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 | Environmental | Open in IMG/M |
| 3300009837 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011432 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT718_2 | Environmental | Open in IMG/M |
| 3300012038 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT800_2 | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012501 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.170610 | Environmental | Open in IMG/M |
| 3300012517 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.6.yng.070610 | Environmental | Open in IMG/M |
| 3300012519 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610 | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012893 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1 | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014267 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1 | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025289 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 2 | Environmental | Open in IMG/M |
| 3300025322 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025326 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025555 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqB_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026452 | Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 7-17 PU4 | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300027277 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027513 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 (SPAdes) | Environmental | Open in IMG/M |
| 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027722 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027835 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW60B uncontaminated upgradient, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300033414 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_B | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10215J12807_10638761 | 3300000881 | Soil | DTVIKKARQMITTAKPDSLVGMFQFGALKHEQVMHSLELFGAKVMPVLGD* |
| F14TB_1035072471 | 3300001431 | Soil | DCLVGMFSFGGLKHEQVMRSIELFATKVMPALGA* |
| Ga0055465_102346101 | 3300004013 | Natural And Restored Wetlands | RAMMETAKPDSLVGMFSFGGLSHDQVTRSIELFATKVKPALGL* |
| Ga0065705_101575573 | 3300005294 | Switchgrass Rhizosphere | PETVIKKARMMIETAKPDSLVGMFQFGGLKHEQVMHSLELFGTKVMPALGA* |
| Ga0065707_105507461 | 3300005295 | Switchgrass Rhizosphere | LMIETARPDSLVGMFSFGGLSHEQVMRSIELFGTKVMPALGD* |
| Ga0065707_105845201 | 3300005295 | Switchgrass Rhizosphere | ARLMIETARPDSLVGMFSFGGLSHEQVMRSIELFATKVMPALGA* |
| Ga0065707_106951392 | 3300005295 | Switchgrass Rhizosphere | KKARSMIETARPDSLVGMFSFGGLSHEQVMRSIELFATKVMPALGA* |
| Ga0070660_1004272861 | 3300005339 | Corn Rhizosphere | AKAREMIAIARPDTLVGMFSFGGLQHEQVMRSIELFATKVIPALGM* |
| Ga0066698_103074492 | 3300005558 | Soil | ARPDCLVGMFSFGGLNHEQVMRSIELFATKVMPALGA* |
| Ga0066905_1012275731 | 3300005713 | Tropical Forest Soil | KARVMIETARPDCLVGMFSFGGLTHEQIAHSIKLFGTKVMPALGA* |
| Ga0066905_1021887142 | 3300005713 | Tropical Forest Soil | RLMIETARPDSLVGMFSFGGLSHEQVMRSIELFATKVMPALGA* |
| Ga0066903_1045501213 | 3300005764 | Tropical Forest Soil | EAARPDCLVGMFSFGGLSHEQVTRSIELFATKVMPALG* |
| Ga0066903_1090908802 | 3300005764 | Tropical Forest Soil | VVKKARLMIETARPDSLVGMFSFGGLSHEQVMRSIELFATQVMPALGN* |
| Ga0075287_10459701 | 3300005873 | Rice Paddy Soil | TARPDCLVGMFSFGGLKHEQVMRSIELFATKVMPALGA* |
| Ga0066652_1015694202 | 3300006046 | Soil | SPDTVIKKARVMIETARPDTLVGMFSFGGLHHEQVMHSIELFATKVIPALGA* |
| Ga0075421_1019029201 | 3300006845 | Populus Rhizosphere | LTVKRLDEWGTSLIGSPATVISKARAMIETAKPDSLVGMFQFGGLKHEQVMHSLELFGNKVIPALGS* |
| Ga0079217_101050132 | 3300006876 | Agricultural Soil | TAKPDCLVGMFSFGGLRHEQVMRSIELFGTKVMPVLGA* |
| Ga0079216_102469461 | 3300006918 | Agricultural Soil | TVIKKARQMIETAKPDCLVGMFSFGGLKHEQVMHSIELFGTKVMPVLGA* |
| Ga0075419_100803861 | 3300006969 | Populus Rhizosphere | PETVIKKARSMIETARPDSLVGMFSFGGLSHEQVMRSIELFATKVMPALGA* |
| Ga0079218_104994593 | 3300007004 | Agricultural Soil | DTAKPDCLVGMFSFGGLRHEQVMRSIELFGTKVMPVLGA* |
| Ga0075435_1002628811 | 3300007076 | Populus Rhizosphere | ARPDTLVGMFSFGGLRHEQVMRSIELFATKVMPALEM* |
| Ga0111539_103335871 | 3300009094 | Populus Rhizosphere | REMIAIARPDTLVGMFSFGGLRHEQVMRSIELFATKVMPALGM* |
| Ga0111539_106555281 | 3300009094 | Populus Rhizosphere | SARPDSLVGMFSFGGLKHEQVMHSIDLFATKVMPALGA* |
| Ga0105092_100312413 | 3300009157 | Freshwater Sediment | SPETVIKKARAMIETARPDSLVGMFRFGGLSHTQVTRSIELFGTKVMPALGA* |
| Ga0105092_108670282 | 3300009157 | Freshwater Sediment | ETARPDSLVGMFSFGGLSHAQVSRSIELFGAKVMPVLGA* |
| Ga0113563_104153933 | 3300009167 | Freshwater Wetlands | ITTAKPDSLVGMFQFGALKHEQVMHSLGLFGAKVMPALGDW* |
| Ga0105088_10210801 | 3300009810 | Groundwater Sand | PDSLVGMFSFGGLSHQQVTRSIELFGTKVMPALGV* |
| Ga0105058_11913241 | 3300009837 | Groundwater Sand | IETAKPDSLVGMFSFGGLKHEQVMHSLELFGSKVMPALGA* |
| Ga0126380_116585122 | 3300010043 | Tropical Forest Soil | RPDCLVGMFSFGGLSHEQIMHSLELFGTKVIPAIG* |
| Ga0126377_115270841 | 3300010362 | Tropical Forest Soil | ETARPDSLVGMFSFGGLSHEQVMRSIELFGTKVMPALGLDTRKK* |
| Ga0134121_104139951 | 3300010401 | Terrestrial Soil | SARPDTLVGMFSFGGLQHQQVMRSIENFGTKIIPALGM* |
| Ga0137428_11101481 | 3300011432 | Soil | KKARMMIETARPDCLVGMCSFGGLSHEQVMRSIELFGTHVIAALKNKPAAL* |
| Ga0137431_10238921 | 3300012038 | Soil | RAMIETAKPDSLVGMFSFGGLKHEQVMHSLELFGSKVIPALGA* |
| Ga0137399_116885892 | 3300012203 | Vadose Zone Soil | NTVIKKARVMIETARPDSLVGMFSFGGLKHEQVMHSIELFATKVMPALGA* |
| Ga0137369_101693321 | 3300012355 | Vadose Zone Soil | TARPDCLVGMFSFGGLKHEQVMRSIELFATKVMPALGG* |
| Ga0137384_106465991 | 3300012357 | Vadose Zone Soil | TVLKKARQMIETARPDCLVGMFSFGGLSNEQVMRSIELLATKVKPFLDGI* |
| Ga0137375_110593621 | 3300012360 | Vadose Zone Soil | LIGMFQFGGPRHDQVMHSIELFAERVIPALAAEVAAPAI* |
| Ga0157351_10369811 | 3300012501 | Unplanted Soil | TVIKKARAMIETARPDSLVGMFSFGGLSHQQVTRSIELFGTQVMPALGRVT* |
| Ga0157354_10032171 | 3300012517 | Unplanted Soil | KARVMIESARPDSLVGMFSFGGLKHEQVMHSIDLFATKVMPALGA* |
| Ga0157352_10100301 | 3300012519 | Unplanted Soil | IGSPQTVIEKAREMIAITRPDTLVGMFSFGGLQHQQVMRSIENFGTKVIPALGM* |
| Ga0137358_103236961 | 3300012582 | Vadose Zone Soil | PETVLKKARSMIDTARPDSLVGMFSFGGLSHAQVTRSIELFGTKVMLALGD* |
| Ga0157284_103320851 | 3300012893 | Soil | REMIAIARPDTLVGMFSFGGLQHEQVMRSIELFATKVIPALGM* |
| Ga0137413_110448012 | 3300012924 | Vadose Zone Soil | IESARPDSLVGMFSFGGLKQEQVMHSIELFATKVMPALGA* |
| Ga0137404_121273071 | 3300012929 | Vadose Zone Soil | KARQMIETAKPDSLVGMFSFGGLSHQQVMRSIELFGTKVMPALGA* |
| Ga0164300_100166674 | 3300012951 | Soil | TSLIGSPQTVIAKAREMIAIARPDTLVGMFSFGGLQHQQAMRSIENFGTKVIPALGM* |
| Ga0134076_101148582 | 3300012976 | Grasslands Soil | DCLVGMFSFGGLNHEQVMRSIELFATKVMPALGA* |
| Ga0157375_122279251 | 3300013308 | Miscanthus Rhizosphere | AKPDSLVGMFSFGGLKHEQVMHSIELFASKVMPALGA* |
| Ga0157375_131174011 | 3300013308 | Miscanthus Rhizosphere | PDTLVGMFSFGGLQHEQVMRSIELFATKVIPTLGM* |
| Ga0075313_11016872 | 3300014267 | Natural And Restored Wetlands | RPDSLVGMFSFGGLSHQQVTRSIELFATQVMPALGA* |
| Ga0137412_109248891 | 3300015242 | Vadose Zone Soil | DSLVGMFSFGGLKHEQVMHSIELFATRVMPALGA* |
| Ga0132257_1020495581 | 3300015373 | Arabidopsis Rhizosphere | RVMIESARPDSLVGMFSFGGLKHEQVMHSIDLFATKVMPALGA* |
| Ga0132257_1033406232 | 3300015373 | Arabidopsis Rhizosphere | ARPDSLVGMFSFGGLKHEQVMHSIDLFATKVMPALGA* |
| Ga0132257_1046204941 | 3300015373 | Arabidopsis Rhizosphere | KAREMIAIARPDTLVGMFSFGGLQHQQVMRSIENFGTKVIPALGM* |
| Ga0182037_101647553 | 3300016404 | Soil | REMIAIARPDTLVGMFSFGGLRHEQVMHSIELFATKVMPALGM |
| Ga0134069_11117743 | 3300017654 | Grasslands Soil | RPDCLVGMFSFGGLSHEQVMRSIELFATKVKPFLDGI |
| Ga0163161_112163271 | 3300017792 | Switchgrass Rhizosphere | PDTVIKKARQMITTAKPDSLVGMFQFGALKHEQVMHSLELFGAKVMPALGD |
| Ga0184604_100240732 | 3300018000 | Groundwater Sediment | PETVLKKARSMIETAKPDSLVGMFSFGGLKHEQVMHSIELFASKVMPALGA |
| Ga0184638_10517331 | 3300018052 | Groundwater Sediment | KARMMIETARPDCLVGMCSFGGLSHEQVSRSIELFGTKVIPALKNECAGK |
| Ga0184623_102390343 | 3300018056 | Groundwater Sediment | MIETARPDCLVGMFSFGGLSHEQITHSIELFGTKVMPALGG |
| Ga0184637_102355053 | 3300018063 | Groundwater Sediment | PDSLVGMFSFGGLSHEQVMRSIELFGTKVMPALGR |
| Ga0066669_113256081 | 3300018482 | Grasslands Soil | MIETARPDSLVGMFSFGGLKHEQVMHSIELFATKVMPALGA |
| Ga0222622_101010822 | 3300022756 | Groundwater Sediment | MIETARPDSLVGMFSFGGLKHEQVMHSIDLFATKVMPALGA |
| Ga0209002_103055982 | 3300025289 | Soil | MIATAKPDSLVGMFSFGGLSHEQVMRSIELFATKVMPALGG |
| Ga0209641_109234683 | 3300025322 | Soil | HRGGQGAAVVSHGIVARAMIATAKPDSLVGMFSFGGLSHEQVMRSIELFATKVMPALGG |
| Ga0209342_103043951 | 3300025326 | Soil | VSHGIVARAMIATAKPDSLVGMFSFGGLSHEQVMRSIELFATKVMPALGG |
| Ga0210121_10578972 | 3300025555 | Natural And Restored Wetlands | SPDTVIKKAHAMLATAKPDSLVGMFQFGGLKHEQVRHSLELFGTKVMPALGA |
| Ga0207687_103424134 | 3300025927 | Miscanthus Rhizosphere | TVLAKAREMIAIARPDTLVGMFSFGGLQHEQVMRSIELFATKVIPALGM |
| Ga0207690_112758591 | 3300025932 | Corn Rhizosphere | ARPDTLVGMFSFGGLQHEQVMRSIELFATKVIPALGM |
| Ga0207706_116027881 | 3300025933 | Corn Rhizosphere | PDSLVGMFSFGGLKHEQVMHSIDLFATKVMPALGA |
| Ga0207651_114168581 | 3300025960 | Switchgrass Rhizosphere | VLAKAREMIAIARPDTLVGMFSFGGLQHEQVMRSIELFATKVIPALGM |
| Ga0207651_118982571 | 3300025960 | Switchgrass Rhizosphere | ETVVKKAREMIETARPDCLVGMFSFGGLSHAQVMHSIDLFAKKVMPALRENS |
| Ga0207708_115281182 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | TVLKKARSMIETAKPDSLVGMFSFGGLKHEQVMHSIELFAAKVMPALGA |
| Ga0207674_115726831 | 3300026116 | Corn Rhizosphere | KKARSMIETAKPDSLVGMFSFGGLKHEQVMHSIELFAAKVMPALGA |
| Ga0207675_1019373782 | 3300026118 | Switchgrass Rhizosphere | NTVIKKARVMIESARPDSLVGMFSFGGLKHEQVMHSIDLFATKVMPALGA |
| Ga0256821_10105271 | 3300026452 | Sediment | VVKKAREIIATARPDCLVGMFSFGGLSHAQVTRSIELFGTQVMPRLRAEPLG |
| Ga0209808_11217853 | 3300026523 | Soil | ETARPDCLVGMFSFGGLSHEQVMRSIELFATKVKPFLDGI |
| Ga0209846_10214382 | 3300027277 | Groundwater Sand | TVIKKARSMIETAKPDSLVGMFSFGGLSHEQVMRSIELFGTKVMPALGV |
| Ga0208685_10854452 | 3300027513 | Soil | VIKKARAMIETARPDSLVGMFSFGGLSHQQVTRSIELFATKVMPALGA |
| Ga0209998_100137463 | 3300027717 | Arabidopsis Thaliana Rhizosphere | VATARPDCLVGMFSFGGLKHEQVMRSIELFATKVMPALGS |
| Ga0209819_100052541 | 3300027722 | Freshwater Sediment | KARAMIETARPDSLVGMFSFGGLNHAQVTRSIELFGTKVMPALGA |
| Ga0209515_106466502 | 3300027835 | Groundwater | DSLVGIFSFGGLSHAQVIRSLELFATRVIPALADESVGP |
| Ga0209814_100352161 | 3300027873 | Populus Rhizosphere | PETVIKKARSMIETARPDSLVGMFSFGGLSHEQVMRSIELFATKVMPALGA |
| Ga0209465_101310143 | 3300027874 | Tropical Forest Soil | TARPDSLVGMFSFGGLSHEQVMRSIELFGTKVMPALGA |
| Ga0209481_105127302 | 3300027880 | Populus Rhizosphere | TVIKKARSMIETARPDSLVGMFSFGGLSHEQVMRSIELFATKVMPALGA |
| Ga0207428_106024982 | 3300027907 | Populus Rhizosphere | IAIARPDTLVGMFSFGGLRHEQVMRSIELFATKVMPALGM |
| Ga0307312_103267801 | 3300028828 | Soil | ETARPDTLVGMFSFGGLHHEQVMHSIELFATKVIPALGA |
| Ga0302046_104374841 | 3300030620 | Soil | MARPDCLVGLFSFGGQSHAQVTRSIELFATRVMPFLAD |
| Ga0310907_107903352 | 3300031847 | Soil | LIGSPQTVLAKTRAMIETAKPDSLVGMFSFGGLSHDQVTRSIELFANKVRPALGL |
| Ga0307410_107062671 | 3300031852 | Rhizosphere | MIETAKPDSLVGMFSFGGLSHDQVTRSIELFATEVRPALGS |
| Ga0307406_120484282 | 3300031901 | Rhizosphere | IGSPHTVIKKARMMIAMARPDSLVGMFQFGGLKHEQVMHSIELFGAKVMPALGA |
| Ga0307412_104932191 | 3300031911 | Rhizosphere | HTVIKKARMMIAMARPDSLVGMFQFGGLKHEQVMHSIELFGAKVMPALGA |
| Ga0306921_104040183 | 3300031912 | Soil | AREMIAIARPDTLVGMFSFGGLRHEQVMHSIELFATKVMPALGM |
| Ga0310909_105633182 | 3300031947 | Soil | TSLISSPQTVLAKAREMIAIARPDTLVGMFSFGGLRHEQVMHSIELFATKVMPALGM |
| Ga0326597_100105436 | 3300031965 | Soil | MIATAKPDSLVGMFSFGGCLSHEQVMRSIELFATKVMPGLAG |
| Ga0326597_100160167 | 3300031965 | Soil | MRSWFVLEMIETAKPDSLVSMFSFGGLSHEQVMRSIELFATEVMPALGG |
| Ga0326597_103412151 | 3300031965 | Soil | DTVVKKARAMIETARPDSLVGMFSFGGLKHEQVMHSLELFGGKVMPALGA |
| Ga0326597_110833482 | 3300031965 | Soil | VLETIATAKPDSLVGMFSFGGLSHEQVIRSIELFATKVMPGLGG |
| Ga0307409_1005135581 | 3300031995 | Rhizosphere | DEWGTSLIGSPHTVIKKARMMIAMARPDSLVGMFQFGGLKHEQVMHSIELFGAKVMPALG |
| Ga0310899_102455752 | 3300032017 | Soil | TVIEKVREVIAIARPDTLVGMFSFGGLQHQQVMRSIENFGTKVIPALGM |
| Ga0335080_111179032 | 3300032828 | Soil | PETVIEKARAMIETARPDCLVGMFSFGGLSHEQVMRSIELFATTVMPAIG |
| Ga0316619_122177592 | 3300033414 | Soil | ETVIKKARAMMATAKPDSLVGMFQFGGLKHEQVMHSLELFGTKVMPALGT |
| Ga0247830_108250022 | 3300033551 | Soil | AREMIAIARPDTLVGMFSFGGLQHQQVMRSIENFGTKVIPALGM |
| ⦗Top⦘ |