


| Basic Information | |
|---|---|
| Family ID | F101949 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 102 |
| Average Sequence Length | 38 residues |
| Representative Sequence | PVAPVVETVAVEVIEQPAPGVITVTEVEETEVRKAS |
| Number of Associated Samples | 70 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 3.12 % |
| % of genes near scaffold ends (potentially truncated) | 91.18 % |
| % of genes from short scaffolds (< 2000 bps) | 86.27 % |
| Associated GOLD sequencing projects | 64 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.17 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (58.824 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (29.412 % of family members) |
| Environment Ontology (ENVO) | Unclassified (54.902 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.863 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.17 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF00656 | Peptidase_C14 | 2.94 |
| PF01523 | PmbA_TldD | 1.96 |
| PF01161 | PBP | 1.96 |
| PF00239 | Resolvase | 1.96 |
| PF13410 | GST_C_2 | 0.98 |
| PF04226 | Transgly_assoc | 0.98 |
| PF13515 | FUSC_2 | 0.98 |
| PF13975 | gag-asp_proteas | 0.98 |
| PF00589 | Phage_integrase | 0.98 |
| PF13581 | HATPase_c_2 | 0.98 |
| PF02979 | NHase_alpha | 0.98 |
| PF01381 | HTH_3 | 0.98 |
| PF02518 | HATPase_c | 0.98 |
| PF16861 | Carbam_trans_C | 0.98 |
| PF02012 | BNR | 0.98 |
| PF03330 | DPBB_1 | 0.98 |
| PF13340 | DUF4096 | 0.98 |
| PF07508 | Recombinase | 0.98 |
| PF08734 | GYD | 0.98 |
| PF02769 | AIRS_C | 0.98 |
| PF13185 | GAF_2 | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 2.94 |
| COG4249 | Uncharacterized conserved protein, contains caspase domain | General function prediction only [R] | 2.94 |
| COG0312 | Zn-dependent protease PmbA/TldA or its inactivated homolog | General function prediction only [R] | 1.96 |
| COG1881 | Uncharacterized conserved protein, phosphatidylethanolamine-binding protein (PEBP) family | General function prediction only [R] | 1.96 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 1.96 |
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 0.98 |
| COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 58.82 % |
| All Organisms | root | All Organisms | 41.18 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005332|Ga0066388_100310952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2221 | Open in IMG/M |
| 3300005764|Ga0066903_106611887 | Not Available | 603 | Open in IMG/M |
| 3300005764|Ga0066903_107578097 | Not Available | 559 | Open in IMG/M |
| 3300006102|Ga0075015_100239368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 980 | Open in IMG/M |
| 3300006102|Ga0075015_100830004 | Not Available | 557 | Open in IMG/M |
| 3300006163|Ga0070715_10553245 | Not Available | 667 | Open in IMG/M |
| 3300006172|Ga0075018_10206023 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
| 3300010359|Ga0126376_10145251 | All Organisms → cellular organisms → Bacteria | 1891 | Open in IMG/M |
| 3300010360|Ga0126372_10858583 | Not Available | 906 | Open in IMG/M |
| 3300010361|Ga0126378_10298278 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1714 | Open in IMG/M |
| 3300010361|Ga0126378_10964308 | Not Available | 957 | Open in IMG/M |
| 3300010361|Ga0126378_11508901 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300010362|Ga0126377_10934949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 931 | Open in IMG/M |
| 3300010366|Ga0126379_11054061 | Not Available | 918 | Open in IMG/M |
| 3300010366|Ga0126379_13079498 | Not Available | 558 | Open in IMG/M |
| 3300010376|Ga0126381_100519578 | Not Available | 1682 | Open in IMG/M |
| 3300010376|Ga0126381_101332501 | All Organisms → cellular organisms → Bacteria | 1038 | Open in IMG/M |
| 3300010376|Ga0126381_103905009 | Not Available | 581 | Open in IMG/M |
| 3300010376|Ga0126381_104033005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 571 | Open in IMG/M |
| 3300010398|Ga0126383_10532269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1238 | Open in IMG/M |
| 3300010398|Ga0126383_12646121 | Not Available | 585 | Open in IMG/M |
| 3300012201|Ga0137365_10459689 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 937 | Open in IMG/M |
| 3300012917|Ga0137395_10970544 | Not Available | 611 | Open in IMG/M |
| 3300012971|Ga0126369_10611739 | Not Available | 1160 | Open in IMG/M |
| 3300012971|Ga0126369_11174584 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 857 | Open in IMG/M |
| 3300014056|Ga0120125_1048280 | Not Available | 933 | Open in IMG/M |
| 3300016294|Ga0182041_10103988 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2093 | Open in IMG/M |
| 3300016294|Ga0182041_10381256 | All Organisms → cellular organisms → Bacteria | 1194 | Open in IMG/M |
| 3300016294|Ga0182041_11108074 | Not Available | 719 | Open in IMG/M |
| 3300016319|Ga0182033_10815091 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300016319|Ga0182033_11772636 | Not Available | 560 | Open in IMG/M |
| 3300016319|Ga0182033_11810823 | Not Available | 554 | Open in IMG/M |
| 3300016341|Ga0182035_11139609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 695 | Open in IMG/M |
| 3300016371|Ga0182034_11077720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 696 | Open in IMG/M |
| 3300016387|Ga0182040_10552943 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 926 | Open in IMG/M |
| 3300016387|Ga0182040_10880208 | Not Available | 742 | Open in IMG/M |
| 3300016387|Ga0182040_10927189 | Not Available | 723 | Open in IMG/M |
| 3300016445|Ga0182038_12083053 | Not Available | 514 | Open in IMG/M |
| 3300017924|Ga0187820_1233526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 585 | Open in IMG/M |
| 3300017994|Ga0187822_10194402 | Not Available | 674 | Open in IMG/M |
| 3300018001|Ga0187815_10054510 | Not Available | 1681 | Open in IMG/M |
| 3300018006|Ga0187804_10538103 | Not Available | 527 | Open in IMG/M |
| 3300020581|Ga0210399_10177315 | All Organisms → cellular organisms → Bacteria | 1768 | Open in IMG/M |
| 3300021405|Ga0210387_11439365 | Not Available | 592 | Open in IMG/M |
| 3300027090|Ga0208604_1017916 | Not Available | 672 | Open in IMG/M |
| 3300027725|Ga0209178_1331279 | Not Available | 566 | Open in IMG/M |
| 3300027874|Ga0209465_10047311 | Not Available | 2053 | Open in IMG/M |
| 3300030730|Ga0307482_1235918 | Not Available | 569 | Open in IMG/M |
| 3300031446|Ga0170820_14263507 | Not Available | 643 | Open in IMG/M |
| 3300031469|Ga0170819_13203796 | Not Available | 891 | Open in IMG/M |
| 3300031543|Ga0318516_10622287 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 616 | Open in IMG/M |
| 3300031572|Ga0318515_10147509 | Not Available | 1253 | Open in IMG/M |
| 3300031640|Ga0318555_10659598 | Not Available | 566 | Open in IMG/M |
| 3300031668|Ga0318542_10539459 | Not Available | 607 | Open in IMG/M |
| 3300031679|Ga0318561_10532008 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 647 | Open in IMG/M |
| 3300031708|Ga0310686_101586467 | Not Available | 684 | Open in IMG/M |
| 3300031713|Ga0318496_10189481 | Not Available | 1129 | Open in IMG/M |
| 3300031744|Ga0306918_10418569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1045 | Open in IMG/M |
| 3300031748|Ga0318492_10824282 | Not Available | 500 | Open in IMG/M |
| 3300031751|Ga0318494_10944820 | Not Available | 506 | Open in IMG/M |
| 3300031754|Ga0307475_10042188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3386 | Open in IMG/M |
| 3300031754|Ga0307475_10925948 | Not Available | 687 | Open in IMG/M |
| 3300031764|Ga0318535_10124831 | Not Available | 1139 | Open in IMG/M |
| 3300031792|Ga0318529_10453155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium centrolobii | 597 | Open in IMG/M |
| 3300031819|Ga0318568_10990933 | Not Available | 519 | Open in IMG/M |
| 3300031879|Ga0306919_10130028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1813 | Open in IMG/M |
| 3300031879|Ga0306919_10388997 | All Organisms → Viruses → Predicted Viral | 1068 | Open in IMG/M |
| 3300031879|Ga0306919_10948380 | Not Available | 659 | Open in IMG/M |
| 3300031897|Ga0318520_10261681 | Not Available | 1035 | Open in IMG/M |
| 3300031910|Ga0306923_10137474 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2782 | Open in IMG/M |
| 3300031910|Ga0306923_10195233 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2313 | Open in IMG/M |
| 3300031910|Ga0306923_10647610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Nitrobacter | 1181 | Open in IMG/M |
| 3300031910|Ga0306923_11032958 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
| 3300031910|Ga0306923_11618391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 672 | Open in IMG/M |
| 3300031910|Ga0306923_12222591 | Not Available | 549 | Open in IMG/M |
| 3300031912|Ga0306921_10928805 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 986 | Open in IMG/M |
| 3300031912|Ga0306921_11322000 | Not Available | 796 | Open in IMG/M |
| 3300031941|Ga0310912_11505888 | Not Available | 506 | Open in IMG/M |
| 3300031945|Ga0310913_11022261 | Not Available | 579 | Open in IMG/M |
| 3300031954|Ga0306926_11391321 | Not Available | 815 | Open in IMG/M |
| 3300031954|Ga0306926_11909869 | Not Available | 670 | Open in IMG/M |
| 3300031959|Ga0318530_10412618 | Not Available | 560 | Open in IMG/M |
| 3300031962|Ga0307479_10282700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1640 | Open in IMG/M |
| 3300032025|Ga0318507_10346472 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Nitrobacter | 647 | Open in IMG/M |
| 3300032035|Ga0310911_10189554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium centrolobii | 1167 | Open in IMG/M |
| 3300032052|Ga0318506_10398340 | Not Available | 610 | Open in IMG/M |
| 3300032059|Ga0318533_10149063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1654 | Open in IMG/M |
| 3300032059|Ga0318533_10377825 | All Organisms → cellular organisms → Bacteria | 1033 | Open in IMG/M |
| 3300032060|Ga0318505_10421111 | Not Available | 631 | Open in IMG/M |
| 3300032094|Ga0318540_10002583 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6257 | Open in IMG/M |
| 3300032180|Ga0307471_103014899 | Not Available | 597 | Open in IMG/M |
| 3300032205|Ga0307472_100685832 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
| 3300032261|Ga0306920_100020490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 9210 | Open in IMG/M |
| 3300032261|Ga0306920_104379470 | Not Available | 506 | Open in IMG/M |
| 3300033289|Ga0310914_11735809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium centrolobii | 528 | Open in IMG/M |
| 3300033290|Ga0318519_10885498 | Not Available | 551 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 29.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 27.45% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 15.69% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.88% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.90% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.92% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.96% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.96% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.96% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.98% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.98% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.98% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014056 | Permafrost microbial communities from Nunavut, Canada - A20_5cm_0M | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300027090 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF016 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0066388_1003109521 | 3300005332 | Tropical Forest Soil | PKVKQPVAPVVETVAAEVIEQPAPDVVTVTEVEATRQVS* |
| Ga0066903_1037479962 | 3300005764 | Tropical Forest Soil | KAARKVKQPATPVIETVAVEVIEQPAPGVIAVTEVEETEIRKAS* |
| Ga0066903_1066118872 | 3300005764 | Tropical Forest Soil | PVAPAVETVAAEVIEQPAPVIAVTEVEETEIRKAS* |
| Ga0066903_1075780972 | 3300005764 | Tropical Forest Soil | KMKQPVAQVVETAAVEVVEQPAPGVITVTEVEEAEVRKAS* |
| Ga0075015_1002393683 | 3300006102 | Watersheds | MKQPVAPAVDTVAVEVIEQSASGVITVTEVEETEVRQAS* |
| Ga0075015_1008300041 | 3300006102 | Watersheds | PVTPVVETVAVEVIEQPAPGVITVTEIEETRKAS* |
| Ga0070715_105532451 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | KQPIAPVVETVAVEVIEQPAPGVITVTEVEETEIRKAS* |
| Ga0075018_102060231 | 3300006172 | Watersheds | KVARKVRQPVAPVVEIVAAEVIEQPAPNVITVTEVEETRKAS* |
| Ga0126376_101452512 | 3300010359 | Tropical Forest Soil | MKKAARPVAPAVETVAVEVIEQPAPDVITVTEVEETELRQAS* |
| Ga0126372_108585831 | 3300010360 | Tropical Forest Soil | KVKQPIAPVVETVASEVIEHPATGVITEVGETEIRKAS* |
| Ga0126378_102982783 | 3300010361 | Tropical Forest Soil | AQTRADEKAALPVAPSETVAVEVIEQPAPGVIAVTEVEETELRQAS* |
| Ga0126378_109643081 | 3300010361 | Tropical Forest Soil | PVAQVVETAAVEVVEQPAPGVITVTEVEEAEVRKAS* |
| Ga0126378_115089012 | 3300010361 | Tropical Forest Soil | APVVETVAVGVIEQPAPGVISVTEVEETEIRKAS* |
| Ga0126377_109349491 | 3300010362 | Tropical Forest Soil | APVAPVVETVAVEVIEQPAPDVITVTEVEETEIRKAS* |
| Ga0126379_110540613 | 3300010366 | Tropical Forest Soil | PVAPVVETVAVEVIGQPAPDVITVTEVEETEVRKAS* |
| Ga0126379_130794981 | 3300010366 | Tropical Forest Soil | KPPAAPAIETAAVEVTELPAPGVITVSEVEETEVRKAS* |
| Ga0126381_1005195781 | 3300010376 | Tropical Forest Soil | IEQPVVTAVETVAVEVIERPAPDVITVTEVEETRKAS* |
| Ga0126381_1013325011 | 3300010376 | Tropical Forest Soil | PVAPAVETVAVEVIEQPAPGVITVTEVEETEVRQVS* |
| Ga0126381_1039050091 | 3300010376 | Tropical Forest Soil | PVTPVIEIAAVEVIAKPAPDVITVTEVEANEVRKAS* |
| Ga0126381_1040330052 | 3300010376 | Tropical Forest Soil | ARPVAPVVETVAVEVIEQPAPGVITVMEVEETEVRQAS* |
| Ga0126383_105322694 | 3300010398 | Tropical Forest Soil | KVKRPVAPVVETVAVEVIGQPAPDVITVTEVGEAEVRKAS* |
| Ga0126383_126461211 | 3300010398 | Tropical Forest Soil | QPVAPAVETVAAEVIEQPAPGVITVTEVEETEIRKAS* |
| Ga0137365_104596891 | 3300012201 | Vadose Zone Soil | KAARKVKQAVTPVVETVAVEVLEQPAPTVTEVEETRKAS* |
| Ga0137395_109705441 | 3300012917 | Vadose Zone Soil | KVKQAVTPVVETVAVDVIEQPAPTVTEVEETRKAS* |
| Ga0126369_106117391 | 3300012971 | Tropical Forest Soil | KVKPPAAPAIETVAVEVIEQPAPVITVTEVEEAEIRKAS* |
| Ga0126369_111745841 | 3300012971 | Tropical Forest Soil | PVKKAARPVAPVVGTVAVEVIEQPAPGVITVTEVEETEVR* |
| Ga0120125_10482802 | 3300014056 | Permafrost | VKQPTAPVVETVAVEVIEQPVAVMEVEETLVREVSPDDPQ* |
| Ga0182036_109554322 | 3300016270 | Soil | ARKVKRPVAPVGEIVAAEVMEQAAPGQITVTEIEETEVRKAS |
| Ga0182041_101039881 | 3300016294 | Soil | RPVAPAVETVAVEVIEQPAPGVITVTEVEETEVRQAS |
| Ga0182041_103812561 | 3300016294 | Soil | PVAPAVETVTVEVIEQPVPAVTATEVEETEIRQVS |
| Ga0182041_111080741 | 3300016294 | Soil | ARPVAPAVETVAVEVIEQPAPGVITVTEVEETEVRQAS |
| Ga0182033_108150911 | 3300016319 | Soil | IKQPIVAAVETVAVEVIEQPPPVIAVTEVEETEVRKAS |
| Ga0182033_117726361 | 3300016319 | Soil | AARPVAPVVGTVAVEVIEQPAPGVITVAEVEETEVRQAS |
| Ga0182033_118108231 | 3300016319 | Soil | RRIKQPVAPAVETVAAEVIEQPAPVIAVTGVEETEIRKAS |
| Ga0182035_111396091 | 3300016341 | Soil | AARKVKQPVAPVVETVAVEVIEQPAPSVITVTEVEETRQVS |
| Ga0182034_110777201 | 3300016371 | Soil | AARKVKEPVAPVVETVAVEVIEQPAPGVITVTEVEETEVRKAS |
| Ga0182040_105529431 | 3300016387 | Soil | VKKAARPVAPVVGTVAVEVIEQPAPGVITVTEVEETEVRQAS |
| Ga0182040_108802081 | 3300016387 | Soil | PIVAAVETVAVEVIEQPPPVIAVTEVEETEVRKAS |
| Ga0182040_109271891 | 3300016387 | Soil | VKQPVAPVVLVETVAAEVTEQPAPGMITVTEIEETEVRKAS |
| Ga0182038_120830532 | 3300016445 | Soil | KQPIAAVVETVAVEAIEQPAPGVITVTEVEETEVRRAG |
| Ga0187820_12335261 | 3300017924 | Freshwater Sediment | TAPAVETVAVEVIEQPAPGVITVTEVEETELRKVS |
| Ga0187822_101944022 | 3300017994 | Freshwater Sediment | VKQPVAPVIETVAVEAIKQPAPDVITVTEAGETEIRKAS |
| Ga0187815_100545101 | 3300018001 | Freshwater Sediment | AARKVKQPAAPVVETVAVEMIEQPAPEVVEVTEVEKPEVRKAS |
| Ga0187804_105381032 | 3300018006 | Freshwater Sediment | AAPTVETVAVEVIEHPAPGVITVTEVEETEVRQAS |
| Ga0210399_101773153 | 3300020581 | Soil | AVRKVKQPVSSVVETVAVEVIEQPAPGVITVTEVEETRKAS |
| Ga0210387_114393651 | 3300021405 | Soil | KPSAPSVETVVVDVIEQPAPNVITVTEVEETRKAS |
| Ga0208604_10179162 | 3300027090 | Forest Soil | KQPAAPVVETVAAEAIEQPAPGVIAVTEVEETEVRKAS |
| Ga0209178_13312791 | 3300027725 | Agricultural Soil | PVAPVVETVAVEVIEQPAPGVITVTEVEETEVRKAS |
| Ga0209465_100473113 | 3300027874 | Tropical Forest Soil | AARRIEQPVVTAVETVAVEMIERPAPDAITVTEVEETRKAS |
| Ga0307482_12359181 | 3300030730 | Hardwood Forest Soil | KVKQPVAPAVETVAVEVVEQPAPGVITVTEVEETRKAS |
| Ga0170820_142635072 | 3300031446 | Forest Soil | KQPVTPVVETVAVEVLEQPASGVITVTEIEETRKAR |
| Ga0170819_132037963 | 3300031469 | Forest Soil | CDLQPAAPVVETVAVEVIEQPAPGLITVTEVEETRQVS |
| Ga0318516_106222872 | 3300031543 | Soil | PVKKAARPVAPVVGTVAVEVIEQPAPGVITVTEVEETEVRQAS |
| Ga0318515_101475093 | 3300031572 | Soil | VKQPVTPVIETAAVEMIEQPAPDVITVTEVEETRQVS |
| Ga0318555_106595981 | 3300031640 | Soil | KQPVAPVVESVAVEVIEQPAPGVITVTEVEETEIRKAS |
| Ga0318542_105394592 | 3300031668 | Soil | VKQPVAPVVETVAAEVIEQPAPVTVSEVEEIRKAS |
| Ga0318561_105320081 | 3300031679 | Soil | AARPVAPAVETVAVEVIEQPAPGVITVTEVEETDVRQAS |
| Ga0310686_1015864671 | 3300031708 | Soil | MKQPPAVETVAVEVVEQPAPGVITVTEVEETELRK |
| Ga0310686_1199038551 | 3300031708 | Soil | SLQQSKNVAVEVIEQPAPGVITVTEVEEAGVRQAS |
| Ga0318496_101894811 | 3300031713 | Soil | KAARKVKQPIAPVVETVAVEVIEQLAPGVITVTEVEETRQVS |
| Ga0306918_104185691 | 3300031744 | Soil | VKQPIAPVVETVATEVIEQPAPGIITVTEVEETEVRKAS |
| Ga0318492_108242822 | 3300031748 | Soil | QPVTPVIETAAVEVIEQPAPDVITVTEVEETEVRKAS |
| Ga0318494_109448202 | 3300031751 | Soil | KKVARKVRQPVTPVIETASVEMIEQPAPDVITVTEVEETRQVS |
| Ga0307475_100421882 | 3300031754 | Hardwood Forest Soil | MKQPIAPVVETVAIEVIEQPAPGVITVTEVEETEVRQVN |
| Ga0307475_109259481 | 3300031754 | Hardwood Forest Soil | RPAAPTVETAAVEVIEQPAPGVITVTEVEETEVRQAS |
| Ga0318535_101248314 | 3300031764 | Soil | KTARKVKQPIAPVVETVAVEVIEQLAPGVIAVTEVEETRQVS |
| Ga0318529_104531552 | 3300031792 | Soil | ERMKQPVAPILETVAAEVIEQPAPGVIAVTEIEETRQVS |
| Ga0318576_105923031 | 3300031796 | Soil | VAPVVETVAAEVIEQPAPGQITVTEIEETEVRKAS |
| Ga0318568_109909331 | 3300031819 | Soil | LPVAPSETVAVEVIEQPAPGVITVTEVEETELRQAS |
| Ga0306919_101300281 | 3300031879 | Soil | RKERMKQPVTAVVETVAADVIEQPAPGVVAVTEVEETEVRKAS |
| Ga0306919_103889971 | 3300031879 | Soil | KQPVTPVIETAAVEMIEQPAPDVITVTEVEETRQVS |
| Ga0306919_109483801 | 3300031879 | Soil | PVTPVIETAAVEMIEQPAPDVITVTEVEKTEVRKAS |
| Ga0318520_102616811 | 3300031897 | Soil | KTARKVKQPIAPVVEGVTAEVIEQSAPDVVTVTEVEAARQVS |
| Ga0306923_101374741 | 3300031910 | Soil | KVKQPIAPVVETVAVEVIEQPAPGVITVTEVEETRQVS |
| Ga0306923_101952331 | 3300031910 | Soil | AARPVAPAVETVAVEVIEQPAPGVITVTEVEETEVRQAS |
| Ga0306923_106476101 | 3300031910 | Soil | AARPVAPVVETVAVEVIEQPAPGVITVTEVEETEVRQAS |
| Ga0306923_110329581 | 3300031910 | Soil | QPIVAAVETVAVEVIEQPPPVIAVTEVEETEVRKAS |
| Ga0306923_116183912 | 3300031910 | Soil | KAARPVAPAVETVAVEVIEQPAPGVITVTEVEETDVRQAS |
| Ga0306923_122225912 | 3300031910 | Soil | PVAPVVETVAVEVIEQPAPGVITVTEVEETEVRQAS |
| Ga0306921_109288051 | 3300031912 | Soil | ALCKSKQPVAPVVETVAAQVIEQPAPGVITVTEVAEISQVS |
| Ga0306921_113220001 | 3300031912 | Soil | RMKQPVAPVVETVAVEVIEQPAPSVMTVTEAEQTRKAS |
| Ga0310912_115058881 | 3300031941 | Soil | RPVAPVVETVAVEVIEQPAPGVITVTEVEETEVRQAS |
| Ga0310913_110222611 | 3300031945 | Soil | GARKVKPPAAPAIETAAVEVIEQPAPGVITVTEVEETEVRKAS |
| Ga0306926_113913211 | 3300031954 | Soil | VKQPATPVIETVAVEVIEQPVTVTEIEQAEIRKAS |
| Ga0306926_119098691 | 3300031954 | Soil | QPAAPAVETVAAEVIEQPAPVIAVTEVEETEIRKAS |
| Ga0318530_104126182 | 3300031959 | Soil | KKATRKERMKQHVAPVVEIVATEVIEQPAANVITVTEVEETRKAS |
| Ga0307479_102827001 | 3300031962 | Hardwood Forest Soil | SVKKATRPVAPAVETVAVEVIEQPAPGVITVTEVVDETQVRQAS |
| Ga0318507_103464722 | 3300032025 | Soil | PVKKAARPVAPVVETVAVEVIEQPAPGVITVTEVEETEVRQAS |
| Ga0310911_101895543 | 3300032035 | Soil | ARKERMKQPVAPILETVAAEVIEQPAPGVIAVTEIEETRQVS |
| Ga0318506_103983401 | 3300032052 | Soil | VKQPVAPVVESVAVEVIEQPAPGVITVTEVEETEIRKAS |
| Ga0318533_101490631 | 3300032059 | Soil | VAPAVETVAVEVIEQPAPGVITVTEVEETEVRQAS |
| Ga0318533_103778251 | 3300032059 | Soil | RKVKQPVTPVIETAAVEMIEQPAPDVITVTEVEETRQVS |
| Ga0318505_104211112 | 3300032060 | Soil | VAPVVETVVVEVVEQPAPGVTTVTEVEETEIRKAS |
| Ga0318505_104285321 | 3300032060 | Soil | KKAAPPVAPAVETAAVEVIEQPAPGVTTVTEVEETRQVT |
| Ga0318540_100025839 | 3300032094 | Soil | KKAALKVKQPIAPVVETVAVEVIEQPAPGVITVTEVEETRQVS |
| Ga0307471_1030148992 | 3300032180 | Hardwood Forest Soil | KVKQPVAPVVETTVAEVIEQPAPDVISVTEVEETDVRKAS |
| Ga0307472_1006858322 | 3300032205 | Hardwood Forest Soil | KVARKVKQAVTPVVETVAVEVIEQPAPGVITVTEIEETRKAS |
| Ga0306920_1000204901 | 3300032261 | Soil | KQPVAPVVETVAAEVIEQPAPDVVTVTEVEATRQVS |
| Ga0306920_1000909961 | 3300032261 | Soil | KQPVAPVVETVAAEVIEQPAPGVVTVTEAEETHQAS |
| Ga0306920_1043794702 | 3300032261 | Soil | VKKVARPVAPAVETVAVEVIEQPAPGVMTVTEVEETEVRQAS |
| Ga0310914_117358091 | 3300033289 | Soil | AARKERMKQPVAPILETVAAEVIEQPAPGVIAVTEIEETRQVS |
| Ga0318519_108854981 | 3300033290 | Soil | KERMKQHVAPVVEIVATEVIEQPAANVITVTEVEETRKAS |
| ⦗Top⦘ |