


| Basic Information | |
|---|---|
| Family ID | F101944 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 102 |
| Average Sequence Length | 47 residues |
| Representative Sequence | VENMDEVLKIALTYEPTPLLNNQEEVPFRPPVSGDGDLQESVMN |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.98 % |
| % of genes near scaffold ends (potentially truncated) | 98.04 % |
| % of genes from short scaffolds (< 2000 bps) | 90.20 % |
| Associated GOLD sequencing projects | 90 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.28 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.020 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil (21.569 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.314 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (58.824 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 13.89% β-sheet: 0.00% Coil/Unstructured: 86.11% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.28 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF01926 | MMR_HSR1 | 42.16 |
| PF07498 | Rho_N | 20.59 |
| PF04995 | CcmD | 0.98 |
| PF00009 | GTP_EFTU | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG3114 | Heme exporter protein D | Intracellular trafficking, secretion, and vesicular transport [U] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.02 % |
| Unclassified | root | N/A | 0.98 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_101612141 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300002562|JGI25382J37095_10024108 | All Organisms → cellular organisms → Bacteria | 2375 | Open in IMG/M |
| 3300004133|Ga0058892_1303698 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300004267|Ga0066396_10117701 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300004479|Ga0062595_100914872 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300005180|Ga0066685_10055364 | All Organisms → cellular organisms → Bacteria | 2558 | Open in IMG/M |
| 3300005184|Ga0066671_10405319 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales | 873 | Open in IMG/M |
| 3300005294|Ga0065705_10529005 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
| 3300005329|Ga0070683_102095323 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300005332|Ga0066388_102475360 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 943 | Open in IMG/M |
| 3300005332|Ga0066388_107312849 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300005434|Ga0070709_10774356 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 751 | Open in IMG/M |
| 3300005446|Ga0066686_10880750 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
| 3300005518|Ga0070699_102211839 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300005557|Ga0066704_10091846 | All Organisms → cellular organisms → Bacteria | 1982 | Open in IMG/M |
| 3300005558|Ga0066698_10731806 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 648 | Open in IMG/M |
| 3300005577|Ga0068857_100685625 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
| 3300005764|Ga0066903_102716973 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
| 3300006049|Ga0075417_10018939 | All Organisms → cellular organisms → Bacteria | 2715 | Open in IMG/M |
| 3300006163|Ga0070715_10591392 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300006196|Ga0075422_10305230 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300006791|Ga0066653_10380151 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300006794|Ga0066658_10841170 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300006845|Ga0075421_101207091 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300006852|Ga0075433_11149070 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 675 | Open in IMG/M |
| 3300007076|Ga0075435_101073943 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300009089|Ga0099828_10928094 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 777 | Open in IMG/M |
| 3300009137|Ga0066709_104131003 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300009148|Ga0105243_10171294 | All Organisms → cellular organisms → Bacteria | 1880 | Open in IMG/M |
| 3300010046|Ga0126384_10429201 | All Organisms → cellular organisms → Bacteria | 1123 | Open in IMG/M |
| 3300010047|Ga0126382_12278164 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300010084|Ga0127461_1072549 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300010093|Ga0127490_1005008 | All Organisms → cellular organisms → Bacteria | 2350 | Open in IMG/M |
| 3300010104|Ga0127446_1023069 | All Organisms → cellular organisms → Bacteria | 1185 | Open in IMG/M |
| 3300010107|Ga0127494_1145090 | All Organisms → cellular organisms → Bacteria | 1650 | Open in IMG/M |
| 3300010108|Ga0127474_1013597 | All Organisms → cellular organisms → Bacteria | 2153 | Open in IMG/M |
| 3300010109|Ga0127497_1056879 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 633 | Open in IMG/M |
| 3300010115|Ga0127495_1140801 | All Organisms → cellular organisms → Bacteria | 1606 | Open in IMG/M |
| 3300010125|Ga0127443_1140615 | All Organisms → cellular organisms → Bacteria | 1750 | Open in IMG/M |
| 3300010132|Ga0127455_1164476 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300010154|Ga0127503_10851398 | All Organisms → cellular organisms → Bacteria | 1089 | Open in IMG/M |
| 3300010323|Ga0134086_10098734 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1030 | Open in IMG/M |
| 3300010366|Ga0126379_10642886 | All Organisms → cellular organisms → Bacteria | 1150 | Open in IMG/M |
| 3300010376|Ga0126381_102684830 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 712 | Open in IMG/M |
| 3300010398|Ga0126383_13144504 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300011120|Ga0150983_12278554 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300011120|Ga0150983_15696514 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300011416|Ga0137422_1044161 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
| 3300012198|Ga0137364_11099436 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300012388|Ga0134031_1138573 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 736 | Open in IMG/M |
| 3300012388|Ga0134031_1193536 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 897 | Open in IMG/M |
| 3300012390|Ga0134054_1079193 | All Organisms → cellular organisms → Bacteria | 1808 | Open in IMG/M |
| 3300012391|Ga0134035_1203728 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1007 | Open in IMG/M |
| 3300012392|Ga0134043_1172376 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300012401|Ga0134055_1090052 | All Organisms → cellular organisms → Bacteria | 1343 | Open in IMG/M |
| 3300012403|Ga0134049_1029058 | All Organisms → cellular organisms → Bacteria | 1501 | Open in IMG/M |
| 3300012404|Ga0134024_1161103 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300012406|Ga0134053_1080669 | All Organisms → cellular organisms → Bacteria | 1263 | Open in IMG/M |
| 3300012469|Ga0150984_110242623 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300012469|Ga0150984_114130902 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300012918|Ga0137396_10998754 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
| 3300012944|Ga0137410_11110256 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300012971|Ga0126369_12447311 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300012972|Ga0134077_10097232 | All Organisms → cellular organisms → Bacteria | 1136 | Open in IMG/M |
| 3300013297|Ga0157378_11032550 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
| 3300013297|Ga0157378_11827792 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300015357|Ga0134072_10378893 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300015359|Ga0134085_10446334 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
| 3300015371|Ga0132258_10884642 | Not Available | 2255 | Open in IMG/M |
| 3300015372|Ga0132256_103640852 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300015373|Ga0132257_101177348 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
| 3300015373|Ga0132257_102014773 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300015374|Ga0132255_100581572 | All Organisms → cellular organisms → Bacteria | 1654 | Open in IMG/M |
| 3300016341|Ga0182035_10629918 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
| 3300016422|Ga0182039_10785514 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 844 | Open in IMG/M |
| 3300017792|Ga0163161_12019261 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300021855|Ga0213854_1035322 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300021855|Ga0213854_1051223 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
| 3300022510|Ga0242652_1009707 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
| 3300022532|Ga0242655_10006325 | All Organisms → cellular organisms → Bacteria | 2079 | Open in IMG/M |
| 3300022532|Ga0242655_10088244 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 833 | Open in IMG/M |
| 3300022533|Ga0242662_10189772 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 642 | Open in IMG/M |
| 3300022724|Ga0242665_10120704 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300026118|Ga0207675_100731120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 1000 | Open in IMG/M |
| 3300026313|Ga0209761_1034803 | All Organisms → cellular organisms → Bacteria | 2981 | Open in IMG/M |
| 3300026536|Ga0209058_1035666 | All Organisms → cellular organisms → Bacteria | 3001 | Open in IMG/M |
| 3300026540|Ga0209376_1033371 | All Organisms → cellular organisms → Bacteria | 3184 | Open in IMG/M |
| 3300026550|Ga0209474_10276739 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1012 | Open in IMG/M |
| 3300028380|Ga0268265_11812784 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
| 3300030939|Ga0138303_1238524 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
| 3300030987|Ga0308155_1026443 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300031093|Ga0308197_10444047 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300031573|Ga0310915_10573044 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300031910|Ga0306923_11291526 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300031954|Ga0306926_11866324 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 680 | Open in IMG/M |
| 3300034662|Ga0314783_027878 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
| 3300034664|Ga0314786_128490 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300034665|Ga0314787_117198 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300034669|Ga0314794_159803 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300034669|Ga0314794_167853 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300034670|Ga0314795_112982 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300034676|Ga0314801_047073 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 21.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 6.86% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.88% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.90% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.92% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.92% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.92% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.94% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.94% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.94% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.96% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.96% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.98% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.98% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.98% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.98% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.98% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004133 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF220 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004267 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010084 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010093 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010104 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010107 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010108 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010109 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_0_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010115 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010125 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010132 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011416 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT551_2 | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012388 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012390 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012391 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012392 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012401 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012403 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012404 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012406 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300021855 | Metatranscriptome of freshwater sediment microbial communities from pre-fracked creek in Pennsylvania, United States - G-2016_18 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022510 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300030939 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A9_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300030987 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_144 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300034662 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034664 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034665 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034669 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034670 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034676 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1016121412 | 3300000364 | Soil | RDEFTVHLVENMDXVLKIALTHEPRPLLXNEEAVAXRPAVGGDGDLQESVMN* |
| JGI25382J37095_100241081 | 3300002562 | Grasslands Soil | HFVENMDEVLKVALTYKPTPLVEDAAGAVPFRPPVGGDGDLQESIMH* |
| Ga0058892_13036982 | 3300004133 | Forest Soil | LVECMDEVLKVALTYAPTPILEDGPEVTFRPPIGTDGGDLQESIMN* |
| Ga0066396_101177011 | 3300004267 | Tropical Forest Soil | MDEVLKIALTHEPRPLLDNEEAVAFRPAVGGDGDLQESVMN* |
| Ga0062595_1009148723 | 3300004479 | Soil | HLVETMDEVLKVALTRQPIPLLERPEDVTFQPPIGGDGDLQESVMN* |
| Ga0066685_100553641 | 3300005180 | Soil | VENMDEVLKVALTHEPIPLIEEGAQEVPFRPPVDGDGDRQESIMN* |
| Ga0066671_104053191 | 3300005184 | Soil | IRDEFSVHLVENMDEVLKVALTQQPTPLLQDATEVPFQPPIGGDSDLQESVMN* |
| Ga0065705_105290051 | 3300005294 | Switchgrass Rhizosphere | VENMDEVLKIALTYEPTPLLNNQEEVPFRPPVSGDGDLQESVMN* |
| Ga0070683_1020953231 | 3300005329 | Corn Rhizosphere | NMDEVLKIALTHPPTPILTTPEEVPFRPPIDGDGDLQESVMN* |
| Ga0066388_1024753602 | 3300005332 | Tropical Forest Soil | MDEVLKVALTHEPTPLAEDAAGTVPFRPPVGGDGDLQESIMH* |
| Ga0066388_1073128491 | 3300005332 | Tropical Forest Soil | VENMDEVLKIALTHEPRPLLENQETVPFRPTVSGEGDLQESVMN* |
| Ga0070709_107743561 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | ADIPANIKDEFTVHLVESMDEVLKVALTHQPTPIAEGPEEVPFQPPIGGDPDLQESVMN* |
| Ga0066686_108807502 | 3300005446 | Soil | ENMDEVLKVALTQAPTPLAEDAAGAVPFRPPVGGDGDLQESIMN* |
| Ga0070699_1022118392 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | NMDEVLKIALTHAPTPLIDDGSDELPFRPPVGGDDNLQESIMH* |
| Ga0066704_100918461 | 3300005557 | Soil | VALTHKPTPLVEDAAGAVPFRPPVGGDGDLQESIMH* |
| Ga0066698_107318062 | 3300005558 | Soil | ENMDEVLKVALTQEPTPLIEDGAQGVAFRPPVDGDGDLQESIMH* |
| Ga0068857_1006856253 | 3300005577 | Corn Rhizosphere | LVESMDEVLKIALAYAPTPLLKNQDEVPFRPPVSGDGDLQESVMN* |
| Ga0066903_1027169731 | 3300005764 | Tropical Forest Soil | HLVENMDEVLKIALTREPRPLLEAEEAVAFRPAVSGEGDLQESVMN* |
| Ga0075417_100189391 | 3300006049 | Populus Rhizosphere | NMDEVLKIALTHEPCPLLDNEEAVAFRPAVGGDGDLQESVMN* |
| Ga0070715_105913922 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | VENMDEVLKIALTHAPTPLIDDGAEVPFQTPVGTGGDLQESIMN* |
| Ga0075422_103052302 | 3300006196 | Populus Rhizosphere | VHLVENMDEVLKIALAYAPTPLLMNQEEVPFRPPVSGDGDLQESVMN* |
| Ga0066653_103801511 | 3300006791 | Soil | NIKDEFTVHLVESMDEVLKVALTYAPTPILEDVPEVTFRPPIGEDGDLQESIMN* |
| Ga0066658_108411702 | 3300006794 | Soil | VECMDEVLKVALTHEPIPLLQDGPNALTFRTPVGSGGDLQESIMH* |
| Ga0075421_1012070911 | 3300006845 | Populus Rhizosphere | PNIKDDFTVHLVENMDEVLKIALAHEPTPLMEEGAEVAFPAPIGTDGDLQESIMH* |
| Ga0075433_111490702 | 3300006852 | Populus Rhizosphere | FTVHLVENMDEVLKIALTREPRPLLESEEAVAFRPTVGGDGDLQESVMN* |
| Ga0075435_1010739431 | 3300007076 | Populus Rhizosphere | ADIPANIRDEFTVHLVENMDEVLKIALTHEPRPLLENEEAVAFRPAVGGDGDLQESVMN* |
| Ga0099828_109280942 | 3300009089 | Vadose Zone Soil | PANIKDEFTIHFVENMDEVLKVALTYAPTPLLEDGSEEVPFRPPVGGDGDLQESIMH* |
| Ga0066709_1041310031 | 3300009137 | Grasslands Soil | VLKIALTHAPTPLIDDGDELPFRPPVGGDGLQESIMH* |
| Ga0105243_101712941 | 3300009148 | Miscanthus Rhizosphere | VLKIALTRQPIPLLSGAEEVPFRPPIGGDGDLQESIMH* |
| Ga0126384_104292011 | 3300010046 | Tropical Forest Soil | HLVENMDEVLKIALTHQPTPILTKEEVPFRPPIDGDGDLQESVMN* |
| Ga0126382_122781641 | 3300010047 | Tropical Forest Soil | EVLKVALAHEPTPLLEGQEEVAFQPPVNGDRDLQESVMN* |
| Ga0127461_10725491 | 3300010084 | Grasslands Soil | NDIPANIRDEFTVHLVENMDEVLKIALTHEPTPLLEGQGEVPFRPPVAGNGDLQESVMN* |
| Ga0127490_10050083 | 3300010093 | Grasslands Soil | EEFTIHFVENMDEVLKVALTQEPTPLAEDAAGAVPFRPPVGGDGDLQESIMN* |
| Ga0127446_10230693 | 3300010104 | Grasslands Soil | VALTQEPTPLAEDAAGAVPFRPPVGGDGDLQESIMN* |
| Ga0127494_11450903 | 3300010107 | Grasslands Soil | FVESMDEVLKVALTHAPTPLIDNGSEEIPFRPTVAGNGDLQESIMH* |
| Ga0127474_10135971 | 3300010108 | Grasslands Soil | IKNEFTIHFVESMDEVLKVALTHAPTPLIDNGSEEVPFRPPVDGDGDLQESIMH* |
| Ga0127497_10568791 | 3300010109 | Grasslands Soil | IHFVESMDEVLKIALTSAPTPILDDAADDVAFRPPVGGGGDLQESIMH* |
| Ga0127495_11408013 | 3300010115 | Grasslands Soil | ANIKDEFTVHLVESMDEVLKVALTSQPTPILEENQEEIPFQSGVGKDGDLHQESIMH* |
| Ga0127443_11406153 | 3300010125 | Grasslands Soil | ANIKDEFTIHFVESMDEVLKVALTHAPTPLIDNGSEEVPFRPPVDSDGDLQESIMH* |
| Ga0127455_11644762 | 3300010132 | Grasslands Soil | KVALVQEPTPLIENPEEVPFRPPVGNGDLQESIMN* |
| Ga0127503_108513981 | 3300010154 | Soil | FVENMDEVLKIALTHAPTPLIDDGAEVPFQTPVGTGGDLQESIMN* |
| Ga0134086_100987341 | 3300010323 | Grasslands Soil | TIHFVENMDEVLKVALTQEPTPLAEDAAGAVPFRPPVGGDGDLQESIMN* |
| Ga0126379_106428861 | 3300010366 | Tropical Forest Soil | KVALTQQPTPLLQTDAVPFQPPIDGDGDLQESVMN* |
| Ga0126381_1026848301 | 3300010376 | Tropical Forest Soil | DEFTVHLVESMDEVLKVALTHQPTPLPKGQEEVPFQPPISGDPDLQESVMN* |
| Ga0126383_131445041 | 3300010398 | Tropical Forest Soil | ENMDEVLKIALTRQPTPLLDTEVPFRPPVNDGGDLQESVMN* |
| Ga0150983_122785542 | 3300011120 | Forest Soil | AIKDEFTIHFVENMDEVLKVALTHAPIPLIDDGDEVSFRPPADGDGGLQESIMH* |
| Ga0150983_156965141 | 3300011120 | Forest Soil | VHLVECMDEVLKVALTYAPTPILEDGPEVTFRPPIGTDGGDLQESIMN* |
| Ga0137422_10441611 | 3300011416 | Soil | ENMDEVLKIALTHPPTPLVENQDEVPFRPPVSSDGDLQESVMN* |
| Ga0137364_110994362 | 3300012198 | Vadose Zone Soil | KIALTHAPTPLIDDGSDELPFRPPVGGDDNLQESIMH* |
| Ga0134031_11385731 | 3300012388 | Grasslands Soil | HFVENMDEVLKVALTHAPTPLIDNGSEEVPFRPPVDSDGDLQESIMH* |
| Ga0134031_11935361 | 3300012388 | Grasslands Soil | PANIKDEFTIHFVESMDEVLKVALTYAPTPLRDNGSDEVPFRPVAGDGDLQESIMH* |
| Ga0134054_10791934 | 3300012390 | Grasslands Soil | KDEFTIHFVESMDEVLKVALTHAPTPLIDNGSEEIPFRPTVAGNGDLQESIMH* |
| Ga0134035_12037281 | 3300012391 | Grasslands Soil | NIKEEFTIHFVENMDEVLKVALTHQPTPLVEDAAGAVPFRPPVGGDGDLQESIMH* |
| Ga0134043_11723762 | 3300012392 | Grasslands Soil | VENMDEVLKVALTHEPTPLLQEARPEQVPFRPPIEGDGDLQESIMN* |
| Ga0134055_10900523 | 3300012401 | Grasslands Soil | ANIKDEFTIHFVENMDEVLKVALTHKPTPLVEDAAGAVPFRPPVGGDGDLQESIMH* |
| Ga0134049_10290581 | 3300012403 | Grasslands Soil | ESMDEVLKIALTHEPTPLLEGQGEVPFRPPVAGNGDLQESVMN* |
| Ga0134024_11611032 | 3300012404 | Grasslands Soil | ANIRDEFTVHLVECMDEVLKVALTHEPIPLLQDGPNALTFRTPVGSGGDLQESIMH* |
| Ga0134053_10806693 | 3300012406 | Grasslands Soil | DIPANIKDEFTIHFVENMDEVLKVALTQEPTPLIEEGAQGVPFRPPVDGDGDLQESIMH* |
| Ga0150984_1102426231 | 3300012469 | Avena Fatua Rhizosphere | KNEFTVHLVENMDEVLKIALTYAPTPLLEDAEVTFRPPIGQGGNLQEPVMH* |
| Ga0150984_1141309021 | 3300012469 | Avena Fatua Rhizosphere | ENMDEVLKVALARQPIPILEAQDEVPFQPPVGGDRDLQESVMN* |
| Ga0137396_109987541 | 3300012918 | Vadose Zone Soil | LTIAPTPLLDDAADELAFRPPVGGGGDLQESIMH* |
| Ga0137410_111102562 | 3300012944 | Vadose Zone Soil | VENMDEVLKIALTHAPTPLIDDGDEVSFRPPMDGDGGLQESIMH* |
| Ga0126369_124473111 | 3300012971 | Tropical Forest Soil | MDEVLKVALTHQPTPLLTGPEEVAFQPAIGTDGDLQESVMN* |
| Ga0134077_100972321 | 3300012972 | Grasslands Soil | FTIHFVENMDEVLKVALTHKPTPLVEDAAGAVPFRPPVGGDGDLQESIMH* |
| Ga0157378_110325502 | 3300013297 | Miscanthus Rhizosphere | VENMDEVLKIALTHEPTPLSEHDDVPFQPPASADGNLQESVMN* |
| Ga0157378_118277921 | 3300013297 | Miscanthus Rhizosphere | MDEVLKVALTRQPIPRLERPEDVTFQPPIGGDGDLQESVMN* |
| Ga0134072_103788931 | 3300015357 | Grasslands Soil | PANIKEEFTIHFVENMDEVLKVALTHQPKPLVEDAAGAVPFRPPVGGDGDLQESIMH* |
| Ga0134085_104463342 | 3300015359 | Grasslands Soil | FTIHFVESMDEVLKIALTHAPTPLIDDGDELPFRPPVGGDDNLQESIMH* |
| Ga0132258_108846421 | 3300015371 | Arabidopsis Rhizosphere | VHLVENMDEVLKIALANQPIPLLAGQDAVPFQPPVSGDGDLQESVMN* |
| Ga0132256_1036408522 | 3300015372 | Arabidopsis Rhizosphere | DEVLKIALTHAPTPLVGDEEVSFRPPVDGDGGLQESIMH* |
| Ga0132257_1011773483 | 3300015373 | Arabidopsis Rhizosphere | DIPANIKDEFTVHLVEGMDEVLKVALVHEPTPLLEGQEEVAFQPPVNGDRDLQESVMN* |
| Ga0132257_1020147731 | 3300015373 | Arabidopsis Rhizosphere | EFTVHLVENMDEVLKVALTHEPRPLLENEEAVAFRPAVGGDGDLQESVMN* |
| Ga0132255_1005815723 | 3300015374 | Arabidopsis Rhizosphere | ANIKDEFTVHLVESMDEVLKIALTHEPTPLAEGQDVVPFQPPAGGDGNLQESVMN* |
| Ga0182035_106299181 | 3300016341 | Soil | KDEFTVHLVESMDEVLKIALTHQPTPILTAEVPFQPPIGGDGDLQESVMN |
| Ga0182039_107855141 | 3300016422 | Soil | SMDEVLKVALTRAPTPLLADGSEAVGFRPPVGGDGDLQESIMH |
| Ga0163161_120192611 | 3300017792 | Switchgrass Rhizosphere | TDIPANIKDEFTVHLVENMDEVLKIALTHEPTPLSEHDDVPFQPPASADGNLQESVMN |
| Ga0213854_10353222 | 3300021855 | Watersheds | FTVHLVECMDDVLKVALTQAPTPILEDGPEIGFTPPIGTDGDLQESIMN |
| Ga0213854_10512233 | 3300021855 | Watersheds | HLVECMDEVLKVALTYAPTPILEDEPEVTFRPPIGTDGDLQESIMN |
| Ga0242652_10097072 | 3300022510 | Soil | FTVHLVECMDEVLKVALTYAPTPILEDEPEVTFRPPIGTDGDLQESIMN |
| Ga0242655_100063253 | 3300022532 | Soil | LVECMDEVLKVALTYAPTPILEDGPEVTFRPPIGTDGGDLQESIMN |
| Ga0242655_100882441 | 3300022532 | Soil | KDEFTIHFVENMDEVLKIALTHAPTPLIDDGDEVSFRPPVDGDGGLQESIMH |
| Ga0242662_101897721 | 3300022533 | Soil | EVLKVALTIAPTPLLDDAAEEVTFRPPVGSDGDLQESIMH |
| Ga0242665_101207042 | 3300022724 | Soil | KIALTHAPKPLIEDGDEVPFRPPVDGDSDLQESIMH |
| Ga0207675_1007311204 | 3300026118 | Switchgrass Rhizosphere | LADIPANIRDEFTLHLVESMDEVLKVALTLQPTPLLQEAAEVRFRPPIGEDGDLQESIMH |
| Ga0209761_10348031 | 3300026313 | Grasslands Soil | TDIPANIKDEFTVHLVESMDEVLKVALTSQPTPILEENQEEIPFQSGVGKDGDLHQESIM |
| Ga0209058_10356661 | 3300026536 | Soil | KDEFTIHFVENMDEVLKVALTHKPTPLVEDAAGAVPFRPPVGGDGDLQESIMH |
| Ga0209376_10333711 | 3300026540 | Soil | EFTIHFVENMDEVLKVALTHEPIPLIEEGAQEVPFRPPVDGDGDRQESIMN |
| Ga0209474_102767393 | 3300026550 | Soil | FTIHFVENMDEVLKVALTHKPTPLVEDAAGVVPFRPPVGGDGDLQESIMH |
| Ga0268265_118127841 | 3300028380 | Switchgrass Rhizosphere | VNIKDEFTVHLVESMDEVLKIALAYAPTPLLKNQDEVPFRPPVSGDGDLQESVMN |
| Ga0138303_12385242 | 3300030939 | Soil | VALTYAPTPILEDGPEVTFRPPIGTDGGDLQESIMN |
| Ga0308155_10264431 | 3300030987 | Soil | LVESMDEVLKVALTLQPTPLLQEGPEEVGFRPPIGEDGDLQESIMH |
| Ga0308197_104440472 | 3300031093 | Soil | EFTVHLVENMDEVLKVALTLQPTPLLQEGPEEVRFRPPIGEDGDLQESIMH |
| Ga0310915_105730442 | 3300031573 | Soil | EVLKIALTHQPTPILAGEEVPFRPPIGGDGDLQESVMN |
| Ga0306923_112915262 | 3300031910 | Soil | EVLKIALTHQPTPILTAEVPFQPPIGGDGDLQESVMN |
| Ga0306926_118663241 | 3300031954 | Soil | VALTHAPTPLLGDGSEAVGFRPPVGGDGDLQESIMH |
| Ga0314783_027878_2_124 | 3300034662 | Soil | DEVLKIALAHAPTPLLAGKDEIPFQPPVHGDGDLQESVMN |
| Ga0314786_128490_455_571 | 3300034664 | Soil | VLKIALTYEPTPLLNNQEEVPFRPPVSGDGDLQESVMN |
| Ga0314787_117198_2_181 | 3300034665 | Soil | TDIPANIKDEFTVHLVENMDEVLKIALAHAPTPLLAGKDEIPFQPPVHGDGDLQESVMN |
| Ga0314794_159803_414_527 | 3300034669 | Soil | LKIALTHQPTPIVTNPDEVPFRPPVSSDGDLQESVMN |
| Ga0314794_167853_404_517 | 3300034669 | Soil | LKIALAHAPTPLLAGKDEIPFQPPVHGDGDLQESVMN |
| Ga0314795_112982_407_532 | 3300034670 | Soil | MDEVLKVALAYAPKPLLKSQEEVPFQPPVSGDGDLQESVMN |
| Ga0314801_047073_1_162 | 3300034676 | Soil | IKDEFTVHLVENMDEVLKIALAHAPTPILAGKDEIPFQPPVHGDGDLQESVMN |
| ⦗Top⦘ |