


| Basic Information | |
|---|---|
| Family ID | F101928 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 102 |
| Average Sequence Length | 47 residues |
| Representative Sequence | LLRKAKAVCMISRAITVPQTLEPTVETGKVPVEGWSNQDAVVKLGV |
| Number of Associated Samples | 91 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.02 % |
| % of genes from short scaffolds (< 2000 bps) | 93.14 % |
| Associated GOLD sequencing projects | 84 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.20 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil (14.706 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.333 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (59.804 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 28.38% β-sheet: 0.00% Coil/Unstructured: 71.62% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.20 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF02550 | AcetylCoA_hydro | 28.43 |
| PF13336 | AcetylCoA_hyd_C | 5.88 |
| PF01855 | POR_N | 1.96 |
| PF02566 | OsmC | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG0427 | Propionyl CoA:succinate CoA transferase | Energy production and conversion [C] | 28.43 |
| COG0674 | Pyruvate:ferredoxin oxidoreductase or related 2-oxoacid:ferredoxin oxidoreductase, alpha subunit | Energy production and conversion [C] | 1.96 |
| COG4231 | TPP-dependent indolepyruvate ferredoxin oxidoreductase, alpha subunit | Energy production and conversion [C] | 1.96 |
| COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 0.98 |
| COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004476|Ga0068966_1378692 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 563 | Open in IMG/M |
| 3300004597|Ga0068947_1158296 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 716 | Open in IMG/M |
| 3300004600|Ga0068964_1201102 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 774 | Open in IMG/M |
| 3300004601|Ga0068934_1280332 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 668 | Open in IMG/M |
| 3300004607|Ga0068948_1270967 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300004611|Ga0068925_1239175 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300004617|Ga0068955_1012982 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 823 | Open in IMG/M |
| 3300004973|Ga0072322_1331082 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 787 | Open in IMG/M |
| 3300005434|Ga0070709_10040390 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2868 | Open in IMG/M |
| 3300005436|Ga0070713_102178007 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
| 3300005437|Ga0070710_10975656 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 616 | Open in IMG/M |
| 3300005471|Ga0070698_100097674 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2913 | Open in IMG/M |
| 3300005535|Ga0070684_100364283 | All Organisms → cellular organisms → Bacteria | 1330 | Open in IMG/M |
| 3300005541|Ga0070733_10880150 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
| 3300005542|Ga0070732_10197033 | All Organisms → cellular organisms → Bacteria | 1203 | Open in IMG/M |
| 3300005542|Ga0070732_10270207 | All Organisms → cellular organisms → Bacteria | 1019 | Open in IMG/M |
| 3300005542|Ga0070732_10815734 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
| 3300005566|Ga0066693_10489832 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
| 3300005764|Ga0066903_101956631 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
| 3300006059|Ga0075017_100458451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales | 963 | Open in IMG/M |
| 3300006086|Ga0075019_10488041 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 763 | Open in IMG/M |
| 3300006102|Ga0075015_100152403 | All Organisms → cellular organisms → Bacteria | 1203 | Open in IMG/M |
| 3300006163|Ga0070715_10871870 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| 3300006175|Ga0070712_101212327 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 656 | Open in IMG/M |
| 3300009792|Ga0126374_10745878 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 742 | Open in IMG/M |
| 3300010048|Ga0126373_11254479 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 807 | Open in IMG/M |
| 3300010358|Ga0126370_10657625 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 914 | Open in IMG/M |
| 3300010359|Ga0126376_12346220 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
| 3300010366|Ga0126379_10110877 | All Organisms → cellular organisms → Bacteria | 2466 | Open in IMG/M |
| 3300010376|Ga0126381_100057435 | All Organisms → cellular organisms → Bacteria | 4794 | Open in IMG/M |
| 3300010376|Ga0126381_100088591 | All Organisms → cellular organisms → Bacteria | 3917 | Open in IMG/M |
| 3300010376|Ga0126381_102067391 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 820 | Open in IMG/M |
| 3300010398|Ga0126383_11404170 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 788 | Open in IMG/M |
| 3300011049|Ga0138554_126521 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 713 | Open in IMG/M |
| 3300011050|Ga0138571_118351 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
| 3300011058|Ga0138541_1019457 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 666 | Open in IMG/M |
| 3300011078|Ga0138565_1041380 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 831 | Open in IMG/M |
| 3300011079|Ga0138569_1189136 | All Organisms → cellular organisms → Bacteria | 1282 | Open in IMG/M |
| 3300011087|Ga0138570_1050101 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 724 | Open in IMG/M |
| 3300011090|Ga0138579_1034889 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
| 3300012212|Ga0150985_104423651 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1323 | Open in IMG/M |
| 3300012359|Ga0137385_10978853 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 698 | Open in IMG/M |
| 3300012532|Ga0137373_10947923 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 627 | Open in IMG/M |
| 3300012984|Ga0164309_11383030 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 599 | Open in IMG/M |
| 3300014200|Ga0181526_10048998 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2699 | Open in IMG/M |
| 3300016319|Ga0182033_10588828 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 965 | Open in IMG/M |
| 3300016341|Ga0182035_12098643 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
| 3300016422|Ga0182039_10566832 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 989 | Open in IMG/M |
| 3300016705|Ga0181507_1057832 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 661 | Open in IMG/M |
| 3300017932|Ga0187814_10201031 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 749 | Open in IMG/M |
| 3300017934|Ga0187803_10331009 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 610 | Open in IMG/M |
| 3300017943|Ga0187819_10737731 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
| 3300017955|Ga0187817_11086840 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
| 3300017961|Ga0187778_11127338 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
| 3300017972|Ga0187781_11142283 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
| 3300017975|Ga0187782_10323963 | All Organisms → cellular organisms → Bacteria | 1164 | Open in IMG/M |
| 3300017994|Ga0187822_10293803 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
| 3300018013|Ga0187873_1073255 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1406 | Open in IMG/M |
| 3300018035|Ga0187875_10205301 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1086 | Open in IMG/M |
| 3300018058|Ga0187766_10551367 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300018060|Ga0187765_10753423 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
| 3300018062|Ga0187784_10120078 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2144 | Open in IMG/M |
| 3300019241|Ga0187793_1296711 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 722 | Open in IMG/M |
| 3300019264|Ga0187796_1560232 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
| 3300019275|Ga0187798_1274923 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 975 | Open in IMG/M |
| 3300019278|Ga0187800_1252646 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1253 | Open in IMG/M |
| 3300019278|Ga0187800_1374238 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 690 | Open in IMG/M |
| 3300019278|Ga0187800_1424238 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 688 | Open in IMG/M |
| 3300020580|Ga0210403_11419067 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300020582|Ga0210395_10618850 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 812 | Open in IMG/M |
| 3300020582|Ga0210395_11086399 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300021170|Ga0210400_10862601 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300021433|Ga0210391_10707554 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 789 | Open in IMG/M |
| 3300021478|Ga0210402_10579074 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1041 | Open in IMG/M |
| 3300023255|Ga0224547_1055369 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| 3300025898|Ga0207692_10247318 | All Organisms → cellular organisms → Bacteria | 1067 | Open in IMG/M |
| 3300025929|Ga0207664_11143673 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 695 | Open in IMG/M |
| 3300025929|Ga0207664_11313048 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 643 | Open in IMG/M |
| 3300025939|Ga0207665_10389465 | All Organisms → cellular organisms → Bacteria | 1059 | Open in IMG/M |
| 3300027313|Ga0207780_1088787 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300027842|Ga0209580_10317758 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 776 | Open in IMG/M |
| 3300027842|Ga0209580_10541439 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
| 3300027874|Ga0209465_10546647 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
| 3300027898|Ga0209067_10639481 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 613 | Open in IMG/M |
| 3300027910|Ga0209583_10435453 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 633 | Open in IMG/M |
| 3300027911|Ga0209698_10949090 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 643 | Open in IMG/M |
| 3300028666|Ga0265336_10106248 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300031247|Ga0265340_10252845 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 785 | Open in IMG/M |
| 3300031668|Ga0318542_10473689 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 650 | Open in IMG/M |
| 3300031679|Ga0318561_10452274 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 707 | Open in IMG/M |
| 3300031823|Ga0307478_10200565 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1605 | Open in IMG/M |
| 3300031912|Ga0306921_10485336 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1438 | Open in IMG/M |
| 3300031942|Ga0310916_10475251 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1065 | Open in IMG/M |
| 3300031954|Ga0306926_10835913 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1107 | Open in IMG/M |
| 3300032076|Ga0306924_10545331 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1317 | Open in IMG/M |
| 3300032076|Ga0306924_12276802 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
| 3300032770|Ga0335085_10555128 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1301 | Open in IMG/M |
| 3300032770|Ga0335085_12048117 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
| 3300032828|Ga0335080_10706374 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
| 3300032829|Ga0335070_10638903 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 999 | Open in IMG/M |
| 3300032954|Ga0335083_10318713 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1358 | Open in IMG/M |
| 3300033289|Ga0310914_11654137 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 14.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.80% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.82% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.84% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.86% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 5.88% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 5.88% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 5.88% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.88% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.90% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.90% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.94% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.94% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.96% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.96% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.96% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.98% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.98% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.98% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.98% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004476 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 58 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004597 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 35 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004600 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 56 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004601 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 22 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004607 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 36 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004611 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 10 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004617 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 47 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004973 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 19 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011049 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 35 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011050 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 56 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011058 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 22 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011078 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 50 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011079 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 54 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011087 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 55 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011090 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 69 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016705 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300019241 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019264 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019275 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019278 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300023255 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 10-14 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027313 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 45 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Host-Associated | Open in IMG/M |
| 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Host-Associated | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0068966_13786921 | 3300004476 | Peatlands Soil | REAGLTLLRRAKALCMISRAITIPQTLEPCVETVKVPLEGWVSQDAELKIGV* |
| Ga0068947_11582961 | 3300004597 | Peatlands Soil | RRAKLGCMISRAITIPQTLEPCVETGKVPVEGWSSTDAELKIGV* |
| Ga0068964_12011021 | 3300004600 | Peatlands Soil | LLRRAKLGCMISRAITIPQTLEPCVETGKVPVEGWSSTDAELKIGV* |
| Ga0068934_12803321 | 3300004601 | Peatlands Soil | ALCMISRAISIPQTLEPTVETGKVPVEGWSNQDAAAKVGV* |
| Ga0068948_12709671 | 3300004607 | Peatlands Soil | EAGLALLRRAKALCMISRAITIPQTLEPCVETVKVPLEGWVSQDAELKIGV* |
| Ga0068925_12391751 | 3300004611 | Peatlands Soil | EEQREAGFTLLRNTKAVCMISRAITVPQTLEPSVETGKVPVEGWSNQDAGVKVGV* |
| Ga0068955_10129822 | 3300004617 | Peatlands Soil | AGLALLRRAKLGCMISRAITIPQTLEPCVEAGKVPVEGWSSTDAELKIGV* |
| Ga0072322_13310822 | 3300004973 | Peatlands Soil | VCMISRAISAPQTLEPWVETGKVPVEGWSNQDTAVVKLGV* |
| Ga0070709_100403905 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | LRETGLSLLRRTKSVCMISRAITVPQTLEAVVETVRVPVEGWANDDAVVKLGV* |
| Ga0070713_1021780072 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | GLALLRRTKSLCMISRAITIPQTMEPTVETPKVPVEGWSNEDAVVKLGV* |
| Ga0070710_109756561 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | RKTKAVCMISRAITVPQTLEPTVETGKIPVEGWSNQDAVLKLGV* |
| Ga0070698_1000976741 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | QCEAGLNLLRRTKAVCMISRAITVPQTLEPTVETGKVPVEGWSNQDAVVKLGV* |
| Ga0070684_1003642831 | 3300005535 | Corn Rhizosphere | GLRETGLSLLRRTKSVCMISRAITVPQTLEAVVETVRVPVEGWANDDAVVKLGV* |
| Ga0070733_108801502 | 3300005541 | Surface Soil | SACMISRAITVPQTLEPVVETVKMPVEGWTVQDAAVKIGV* |
| Ga0070732_101970333 | 3300005542 | Surface Soil | LRKAKAQCMISRAITVPQTLETYVEAGKVPVEGWSNQDVAKVGV* |
| Ga0070732_102702071 | 3300005542 | Surface Soil | LRKTKAVCMISRAITVPQTLEPTVETGKVPVEGWSNQDAVMKLGV* |
| Ga0070732_108157342 | 3300005542 | Surface Soil | LCEAGLNLLRRAKSVCMISRAITVPQTLEPVVETVKLPVEGWVGQDAVVKLGV* |
| Ga0066693_104898322 | 3300005566 | Soil | LALLRRTKSVCMISRAITIPQTMEPTVEIIKVPVEGWDNEDAVLKLGV* |
| Ga0066903_1019566311 | 3300005764 | Tropical Forest Soil | TLLRCVKSVCMISRAITVPQTLEPTVESVKIPVEGWTNQEVVAKLGV* |
| Ga0075017_1004584511 | 3300006059 | Watersheds | RRAKALCMISRAITVPQTLEPCVETVKVPLEGWTSQDAVLKIGV* |
| Ga0075019_104880412 | 3300006086 | Watersheds | VEVGLTLLRRTKSVCMISRAITVPQTMEPTVESVKIPVEGWSTQDAAVKLGV* |
| Ga0075015_1001524033 | 3300006102 | Watersheds | CMISRAITVPQTMEPMVETVKMPVEGWTNQDAVVKLGV* |
| Ga0070715_108718701 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | TKSVCMISRAITVPQTMEPVVESVKLPVEGWINQDAVVKLGV* |
| Ga0070712_1012123272 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | PSDGLRETGLSLLRRTKSVCMISRAITVPQTLEAVVETVRVPVEGWANDDAVVKLGV* |
| Ga0126374_107458781 | 3300009792 | Tropical Forest Soil | LLRRTKSVCMISRAITVPQTMEPTVERVKLPVEGWTNQEVVAKLGV* |
| Ga0126373_112544793 | 3300010048 | Tropical Forest Soil | HSEEQCEAGLQLLRRTKSICMISRAITVPQTLEPVVEIVKVPVEGWTAQDAAVKIGV* |
| Ga0126370_106576251 | 3300010358 | Tropical Forest Soil | EDQCEAGLALLRRTKSICMISRAITVPQTLEPTVETIKMPVEGWTSQDAMVKLGV* |
| Ga0126376_123462201 | 3300010359 | Tropical Forest Soil | ICMISRAITVPQTLEPVVEIVKVPVEGWTARDAAVKIGV* |
| Ga0126379_101108771 | 3300010366 | Tropical Forest Soil | EAGLALLRRTKSVCMISRAITVPQTMEPTVETLKMPVEVWTNQDAVVKRGV* |
| Ga0126381_1000574356 | 3300010376 | Tropical Forest Soil | GLTLLRRTKSVCMISRAITVPQTMEPTVERVKLPVEGWTNQEVVAKLGV* |
| Ga0126381_1000885916 | 3300010376 | Tropical Forest Soil | HSEDQCEAGLQLLRRTKSICMISRAITVPQTLEPIVETVKVPVEGWTAQDTAVKIGV* |
| Ga0126381_1020673911 | 3300010376 | Tropical Forest Soil | RTKSICMISRAITVPQTLEPVVEIVKVPVEGWTAQDAAVKIGV* |
| Ga0126383_114041701 | 3300010398 | Tropical Forest Soil | TKSVCMISRAITVPLKLEPTVETAKVLIEGWSAEDTALELGV* |
| Ga0138554_1265211 | 3300011049 | Peatlands Soil | RAKLGCMISRAITIPQTLEPCVETGKVPVEGWSSTDAELKIGV* |
| Ga0138571_1183513 | 3300011050 | Peatlands Soil | LLRRTKALCMISRAISVPQTLEPTVETGKVPVEGWSNQDVAAKVGV* |
| Ga0138541_10194572 | 3300011058 | Peatlands Soil | LCMISRAISIPQTLEPTVETGKVPVEGWSNQDAAAKVGV* |
| Ga0138565_10413801 | 3300011078 | Peatlands Soil | MISRAITVPQTLEPAVETGKVPVEGWTNQETAAKLGV* |
| Ga0138569_11891363 | 3300011079 | Peatlands Soil | AGFNLLRKTKAVCMISRAITVPQTLEPSVETGKVPVEGWSNQDAGVKVGV* |
| Ga0138570_10501012 | 3300011087 | Peatlands Soil | AVCLISRAITVPQTLEPSVETTRTPVEGWTEDAAVKVGV* |
| Ga0138579_10348891 | 3300011090 | Peatlands Soil | MISRAISVPQTLEPTVETGKVPVEGWSNQDVAAKVGV* |
| Ga0150985_1044236513 | 3300012212 | Avena Fatua Rhizosphere | ASEDRREAGLALLRRTKSVCMISRAITVPQTMEPTVEIIKVPVEGWANEDAVLKLGV* |
| Ga0137385_109788531 | 3300012359 | Vadose Zone Soil | KTKAICMISRAITVPQTLEPSVETGKVPVEGWNNQDAGVKLLV* |
| Ga0137373_109479232 | 3300012532 | Vadose Zone Soil | GLNLLRKTKAICMISRAITVPQTLEPSVETGKVPVEGWNNQDAGVKLLV* |
| Ga0164309_113830302 | 3300012984 | Soil | QCEAGLALLRRTKSICMISRAITVPQTMEPTVETTKMPVEGWTSQDAMVKLGV* |
| Ga0181526_100489985 | 3300014200 | Bog | LALLRKAKAQCMISRAISAPQTLEPWVETGKVPVEGWSNQDSAVKVGV* |
| Ga0182033_105888281 | 3300016319 | Soil | SVCMVSRAITVPQTLEPTVETAKVPVEGWSAQDMEVKPGV |
| Ga0182035_120986432 | 3300016341 | Soil | VHSEDMCEAGLALLRRAKSICMISRAITVPQTMEPTVETVKLPVEGWSNQDAAVKIGV |
| Ga0182039_105668323 | 3300016422 | Soil | CMISRAITVPQTMEPTVETVKLPVEGWSNQDAAVKIGV |
| Ga0181507_10578321 | 3300016705 | Peatland | SEDLCEAGLALLRKAKAQCMISRAISAPQTLEPWVETGKVPVEGWSNQDSAAKVGV |
| Ga0187814_102010313 | 3300017932 | Freshwater Sediment | ISRAISVPQTMEPTVETVKMPVEGWREQDAVADIKIGV |
| Ga0187803_103310091 | 3300017934 | Freshwater Sediment | QCEAGLGLLRKTKALCMISRAITVPQTLEPSVEHGKVPVEGWSNQDAGVKVGA |
| Ga0187819_107377311 | 3300017943 | Freshwater Sediment | EDQREIGLGLLRRAKAVCMISRAITIPQTLEPFVEAGKVPVEGWSNQEATLKLGV |
| Ga0187817_110868402 | 3300017955 | Freshwater Sediment | EIGLGLLRRAKAVCMISRAITIPQTLEPFVETGKVPVEGWNNQDATVKLGV |
| Ga0187778_111273382 | 3300017961 | Tropical Peatland | ISRAITVPQTLEPCIEAGKVPVEGWSNQDAELKIGV |
| Ga0187781_111422831 | 3300017972 | Tropical Peatland | TGLALLRRTKALCLISRAVTVPQTLEPVVEATRAPVEGWSDHEAAVKLGV |
| Ga0187782_103239633 | 3300017975 | Tropical Peatland | MISRAITVPQTLEPVVETVKVPVEGWTEHDATVKLGA |
| Ga0187822_102938032 | 3300017994 | Freshwater Sediment | ETGLSLLRRTKSVCMISRAITVPQTLEAVVETVRVPVEGWANDDAVVKLGV |
| Ga0187873_10732553 | 3300018013 | Peatland | CEAGLALLRKAKAQCMISRAISAPQTLEPWVETGKVPVEGWSNQDSAVKVGV |
| Ga0187875_102053011 | 3300018035 | Peatland | EDLCEAGLALLRKAKAQCMISRAISAPQTLEPWVETGKVPVEGWSNQDSAAKVGV |
| Ga0187766_105513671 | 3300018058 | Tropical Peatland | CMISRAITIPQTLEPFVEAGKIPAEGWSNPEATLKLGV |
| Ga0187765_107534231 | 3300018060 | Tropical Peatland | CMISRAITVPQTLEPTVETAKLPVEGWHEQDADVKIGV |
| Ga0187784_101200784 | 3300018062 | Tropical Peatland | SEEHREMGLGLLRRAKAVCMISRAITIPQTLEPTVEVVKVPVEGWNNQDATVKLGA |
| Ga0187793_12967113 | 3300019241 | Peatland | RKAKAVCLISRVITVPQTFEPRVEAGKMPPEGWAEDSVVKLGA |
| Ga0187796_15602323 | 3300019264 | Peatland | RRAKAVCMISRAITVPQTLEPVVETVKVPVEGWADHDATVKLGA |
| Ga0187798_12749231 | 3300019275 | Peatland | GLLRRAKAMCMISRAITVPQTLEAAVDVVKVPVEGWNNQDATVKLGA |
| Ga0187800_12526463 | 3300019278 | Peatland | LLRRTKSVCMISRAITVPQVLEPIVETVKTPVEGWSTQDAALKVGV |
| Ga0187800_13742381 | 3300019278 | Peatland | KLGCMISRAITVPQTLEPCVEAGKVPVEGWSSTDAELKIGV |
| Ga0187800_14242381 | 3300019278 | Peatland | EEQREVGLGLLRRAKALCMISRAITVPQTLEPTVETVKVPVEGWTDQDATVKLGA |
| Ga0210403_114190671 | 3300020580 | Soil | RESGMALLRKAKAACLISRAISVPQTMEPRVETGKVPVEGWSNEGATVEVGV |
| Ga0210395_106188501 | 3300020582 | Soil | GLNLLRRAKSVCMISRAITVPQTLEPVVETVKLPVEGWVGQEAVVKLGV |
| Ga0210395_110863991 | 3300020582 | Soil | LLRKAKAVCMISRAITVPQTLEPTVETGKVPVEGWSNQDAVVKLGV |
| Ga0210400_108626011 | 3300021170 | Soil | LRESGMALLRKAKAACLISRAISVPQTMEPRVETGKVPVEGWSNEGATVEVGV |
| Ga0210391_107075541 | 3300021433 | Soil | SSEDMCEAGLGLLRRTKALCMISRAISVPQTMEPTVETGKVPVEGWSQQDADVNLGA |
| Ga0210402_105790741 | 3300021478 | Soil | ACMISRAITVPQTLEPTVESIKMPAEGWSNQDAVVKLGV |
| Ga0224547_10553691 | 3300023255 | Soil | MISRALSVPQTLEPTVESDKMPVEGWSNHDAGMKIGV |
| Ga0207692_102473183 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | KTKAVCMISRAITVPQTLEPGVETGKVPVEGWNNQDAGVKLLV |
| Ga0207664_111436733 | 3300025929 | Agricultural Soil | SRAITVPQTLEAVVEAVRVPVEGWANDDAVVKLGV |
| Ga0207664_113130481 | 3300025929 | Agricultural Soil | VCMISRAITVPQTMEPAVETVKVPVEGWSNDDAAVKVGV |
| Ga0207665_103894651 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | RTKSVCMISRAITVPQTMEPTVETIKVPVEGWDNEDAVVKLGV |
| Ga0207780_10887871 | 3300027313 | Tropical Forest Soil | LLRKTKSACMISRAITVPQTMEPCVETGKVPVEGWSNLDSVVKLGV |
| Ga0209580_103177583 | 3300027842 | Surface Soil | GLTLLRRTKSVCMISRAITVPQTMEPAVETVKVPVEGWSNDDAVVKLGV |
| Ga0209580_105414391 | 3300027842 | Surface Soil | TVQSEDLCEAGLNLLRRAKSVCMISRAITVPQTLEPVVETVKLPVEGWVGQDAVVKLGV |
| Ga0209465_105466471 | 3300027874 | Tropical Forest Soil | AGLTLLRRVKSVCMISRAITVPQTLEPTVESVKIPVEGWTNQEVVAKLGV |
| Ga0209067_106394812 | 3300027898 | Watersheds | GLALLRKAKAQCMISRAITVPQTLETYVEAGKVPVEGWSNQDVEKVGV |
| Ga0209583_104354531 | 3300027910 | Watersheds | EEQREAGLALLRRTKQLCMISRAITVPQTLEPAVETGKVPVEGWTNQESAVKLGV |
| Ga0209698_109490901 | 3300027911 | Watersheds | EAGLTLLRRTKSGCMISRAITVPQTMEPIVESVKMPVEGWSNQDTAVKLGV |
| Ga0265336_101062483 | 3300028666 | Rhizosphere | CMISRAITVPQTLEPSVETGKVPVEGWNNQDVAVKVGV |
| Ga0265340_102528453 | 3300031247 | Rhizosphere | AGLNLLRKTKAVCMISRAITVPQTLEPTVETGKVPVEGWNNQDAAVKLGV |
| Ga0318542_104736892 | 3300031668 | Soil | MCEAGLALLRRAKSICMISRAITVPQTMEPTVETVKLPVEGWSNQDAAVKIGV |
| Ga0318561_104522742 | 3300031679 | Soil | CMISRAITVPQTLEPTVESVKIPVEGWTNQEVVAKLGV |
| Ga0307478_102005653 | 3300031823 | Hardwood Forest Soil | MISRAITVPQTLEATVEAVKMPVEGWAVQETAKLGV |
| Ga0306921_104853361 | 3300031912 | Soil | DQIEAGLTLLRRAKSVCMISRAITVPQTLEPTVESVKIPVEGWTNQEVVAKLGV |
| Ga0310916_104752511 | 3300031942 | Soil | AGLTLLRRAKSVCMISRAITVPQTLEPTVESVKIPVEGWTNQEVVAKLGV |
| Ga0306926_108359133 | 3300031954 | Soil | TKSVCMISRAITVPQTLEPSVESVKIPVEGWTSQDTVVKLGV |
| Ga0306924_105453313 | 3300032076 | Soil | LLRRAKSVCMISRAITVPQTLEPTVESVKIPVEGWTNQEVVAKLGV |
| Ga0306924_122768022 | 3300032076 | Soil | LNLLRRTKSVCMVSRAITVPQTLEPTVETAKVPVEGWSAQDMEVKPGV |
| Ga0335085_105551283 | 3300032770 | Soil | GLTLLRRAKSVCMISRAITVPQTLEPAVETVKVPVEGWVDEAAEAKIGV |
| Ga0335085_120481171 | 3300032770 | Soil | TLLRRTKSVCMISRAITVPQTLEPSVESVKMPVEGWTNQDTVVKLGV |
| Ga0335080_107063741 | 3300032828 | Soil | CMISRAITVPQTMEPLVESVKLPVEGWINQDAVVKIGV |
| Ga0335070_106389031 | 3300032829 | Soil | RTKSVCMISRAITVPQTMEPMVESVKLPVEGWTNQDAVVKIGV |
| Ga0335083_103187131 | 3300032954 | Soil | CLISRAITVPQTLEPAVETIKIPVEGWANQDAAVKVGV |
| Ga0310914_116541371 | 3300033289 | Soil | IEAGLRLLRRTQSGCMISRAITVPQTMEATVESMKMPVAGWTGRDAAAKLDV |
| ⦗Top⦘ |