


| Basic Information | |
|---|---|
| Family ID | F101906 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 102 |
| Average Sequence Length | 43 residues |
| Representative Sequence | WRTDIDEEFKAVLEGVRQPYLTITGSPMQRVEQILKFIK |
| Number of Associated Samples | 94 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 87.25 % |
| Associated GOLD sequencing projects | 85 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (50.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater (22.549 % of family members) |
| Environment Ontology (ENVO) | Unclassified (57.843 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (96.078 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.30% β-sheet: 0.00% Coil/Unstructured: 59.70% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF14819 | QueF_N | 47.06 |
| PF00565 | SNase | 21.57 |
| PF01223 | Endonuclease_NS | 7.84 |
| PF01503 | PRA-PH | 4.90 |
| PF01612 | DNA_pol_A_exo1 | 3.92 |
| PF12224 | Amidoligase_2 | 1.96 |
| PF02142 | MGS | 1.96 |
| PF00012 | HSP70 | 0.98 |
| PF00583 | Acetyltransf_1 | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG1864 | DNA/RNA endonuclease G, NUC1 | Nucleotide transport and metabolism [F] | 7.84 |
| COG0443 | Molecular chaperone DnaK (HSP70) | Posttranslational modification, protein turnover, chaperones [O] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 50.00 % |
| Unclassified | root | N/A | 50.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300003216|JGI26079J46598_1087764 | Not Available | 575 | Open in IMG/M |
| 3300003617|JGI26082J51739_10066440 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1029 | Open in IMG/M |
| 3300004448|Ga0065861_1070664 | Not Available | 801 | Open in IMG/M |
| 3300004460|Ga0066222_1123377 | All Organisms → cellular organisms → Bacteria | 1243 | Open in IMG/M |
| 3300004460|Ga0066222_1236039 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300005608|Ga0066840_10084870 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300006164|Ga0075441_10032711 | All Organisms → Viruses → Predicted Viral | 2109 | Open in IMG/M |
| 3300006166|Ga0066836_10414034 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
| 3300006190|Ga0075446_10038548 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Marinilabiliaceae → Marinilabilia → Marinilabilia salmonicolor | 1517 | Open in IMG/M |
| 3300006193|Ga0075445_10004685 | Not Available | 6478 | Open in IMG/M |
| 3300006793|Ga0098055_1126307 | Not Available | 992 | Open in IMG/M |
| 3300006874|Ga0075475_10328108 | Not Available | 626 | Open in IMG/M |
| 3300006922|Ga0098045_1115993 | Not Available | 626 | Open in IMG/M |
| 3300006929|Ga0098036_1164847 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300007538|Ga0099851_1025606 | All Organisms → Viruses | 2377 | Open in IMG/M |
| 3300007609|Ga0102945_1092995 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Tevenvirinae → Schizotequatrovirus | 547 | Open in IMG/M |
| 3300007655|Ga0102825_1007046 | All Organisms → Viruses → Predicted Viral | 2367 | Open in IMG/M |
| 3300009000|Ga0102960_1004478 | Not Available | 5334 | Open in IMG/M |
| 3300009000|Ga0102960_1243050 | Not Available | 638 | Open in IMG/M |
| 3300009420|Ga0114994_10017896 | All Organisms → Viruses | 5000 | Open in IMG/M |
| 3300009467|Ga0115565_10382189 | Not Available | 637 | Open in IMG/M |
| 3300009495|Ga0115571_1359450 | Not Available | 573 | Open in IMG/M |
| 3300010150|Ga0098056_1130156 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 853 | Open in IMG/M |
| 3300010300|Ga0129351_1214171 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 744 | Open in IMG/M |
| 3300010883|Ga0133547_12191282 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Tevenvirinae → Schizotequatrovirus | 1003 | Open in IMG/M |
| 3300012928|Ga0163110_10043339 | All Organisms → Viruses → Predicted Viral | 2798 | Open in IMG/M |
| 3300012954|Ga0163111_10281864 | All Organisms → cellular organisms → Bacteria | 1469 | Open in IMG/M |
| 3300012954|Ga0163111_12132737 | Not Available | 566 | Open in IMG/M |
| 3300016791|Ga0182095_1184430 | Not Available | 618 | Open in IMG/M |
| 3300017706|Ga0181377_1080342 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Tevenvirinae → Schizotequatrovirus | 582 | Open in IMG/M |
| 3300017726|Ga0181381_1066950 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 775 | Open in IMG/M |
| 3300017731|Ga0181416_1101008 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300017739|Ga0181433_1070444 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
| 3300017743|Ga0181402_1129713 | Not Available | 643 | Open in IMG/M |
| 3300017746|Ga0181389_1186309 | Not Available | 540 | Open in IMG/M |
| 3300017751|Ga0187219_1163292 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 635 | Open in IMG/M |
| 3300017753|Ga0181407_1042617 | All Organisms → cellular organisms → Bacteria | 1200 | Open in IMG/M |
| 3300017757|Ga0181420_1132052 | Not Available | 753 | Open in IMG/M |
| 3300017764|Ga0181385_1244132 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 539 | Open in IMG/M |
| 3300017781|Ga0181423_1270645 | Not Available | 631 | Open in IMG/M |
| 3300017786|Ga0181424_10359518 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 597 | Open in IMG/M |
| 3300018048|Ga0181606_10683306 | Not Available | 521 | Open in IMG/M |
| 3300018418|Ga0181567_10841776 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300018876|Ga0181564_10244931 | Not Available | 1020 | Open in IMG/M |
| 3300019122|Ga0188839_1018537 | Not Available | 736 | Open in IMG/M |
| 3300019459|Ga0181562_10053113 | All Organisms → cellular organisms → Bacteria | 2465 | Open in IMG/M |
| 3300020378|Ga0211527_10121888 | Not Available | 754 | Open in IMG/M |
| 3300020392|Ga0211666_10006936 | All Organisms → Viruses | 6074 | Open in IMG/M |
| 3300020403|Ga0211532_10249943 | Not Available | 693 | Open in IMG/M |
| 3300020420|Ga0211580_10025263 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2591 | Open in IMG/M |
| 3300020429|Ga0211581_10205380 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300021185|Ga0206682_10048612 | All Organisms → Viruses → Predicted Viral | 2333 | Open in IMG/M |
| 3300021350|Ga0206692_1366809 | Not Available | 1749 | Open in IMG/M |
| 3300021368|Ga0213860_10398539 | Not Available | 596 | Open in IMG/M |
| 3300021959|Ga0222716_10688455 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Tevenvirinae → Schizotequatrovirus | 544 | Open in IMG/M |
| 3300021960|Ga0222715_10355400 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 814 | Open in IMG/M |
| 3300021964|Ga0222719_10112758 | Not Available | 1971 | Open in IMG/M |
| 3300021964|Ga0222719_10133381 | Not Available | 1772 | Open in IMG/M |
| 3300022074|Ga0224906_1050927 | Not Available | 1329 | Open in IMG/M |
| 3300022178|Ga0196887_1056995 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 977 | Open in IMG/M |
| 3300024223|Ga0228601_1005573 | Not Available | 1395 | Open in IMG/M |
| 3300024228|Ga0228633_1118450 | Not Available | 605 | Open in IMG/M |
| 3300024231|Ga0233399_1091895 | Not Available | 711 | Open in IMG/M |
| 3300024231|Ga0233399_1095820 | Not Available | 690 | Open in IMG/M |
| 3300024231|Ga0233399_1105279 | Not Available | 645 | Open in IMG/M |
| 3300024266|Ga0228661_1069021 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Tevenvirinae → Schizotequatrovirus | 658 | Open in IMG/M |
| 3300024321|Ga0228626_1061805 | Not Available | 875 | Open in IMG/M |
| 3300024322|Ga0228656_1022415 | All Organisms → Viruses → Predicted Viral | 1453 | Open in IMG/M |
| 3300024332|Ga0228659_1020998 | All Organisms → Viruses → Predicted Viral | 1523 | Open in IMG/M |
| 3300024335|Ga0228672_1097883 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 827 | Open in IMG/M |
| 3300024346|Ga0244775_11086738 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 628 | Open in IMG/M |
| 3300025138|Ga0209634_1296831 | Not Available | 558 | Open in IMG/M |
| 3300025483|Ga0209557_1076565 | Not Available | 750 | Open in IMG/M |
| 3300025636|Ga0209136_1111075 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 775 | Open in IMG/M |
| 3300025668|Ga0209251_1079894 | Not Available | 991 | Open in IMG/M |
| 3300025701|Ga0209771_1080038 | Not Available | 1124 | Open in IMG/M |
| 3300025767|Ga0209137_1056126 | All Organisms → Viruses → Predicted Viral | 1827 | Open in IMG/M |
| 3300025840|Ga0208917_1207302 | Not Available | 649 | Open in IMG/M |
| 3300025849|Ga0209603_1072835 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1659 | Open in IMG/M |
| 3300025849|Ga0209603_1229108 | Not Available | 690 | Open in IMG/M |
| 3300025879|Ga0209555_10009029 | Not Available | 5563 | Open in IMG/M |
| 3300025880|Ga0209534_10114112 | Not Available | 1504 | Open in IMG/M |
| 3300026136|Ga0208763_1060460 | Not Available | 547 | Open in IMG/M |
| 3300026321|Ga0208764_10118579 | Not Available | 1356 | Open in IMG/M |
| 3300026449|Ga0247593_1040530 | Not Available | 916 | Open in IMG/M |
| 3300026470|Ga0247599_1070249 | Not Available | 738 | Open in IMG/M |
| 3300026470|Ga0247599_1088101 | Not Available | 651 | Open in IMG/M |
| 3300026471|Ga0247602_1070407 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 948 | Open in IMG/M |
| 3300026503|Ga0247605_1046518 | All Organisms → Viruses → Predicted Viral | 1082 | Open in IMG/M |
| 3300026505|Ga0228647_1061826 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 928 | Open in IMG/M |
| 3300027522|Ga0209384_1117554 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 613 | Open in IMG/M |
| 3300027582|Ga0208971_1140695 | Not Available | 523 | Open in IMG/M |
| 3300027672|Ga0209383_1111325 | Not Available | 900 | Open in IMG/M |
| 3300027704|Ga0209816_1004255 | All Organisms → Viruses | 9518 | Open in IMG/M |
| 3300027714|Ga0209815_1072160 | Not Available | 1196 | Open in IMG/M |
| 3300028106|Ga0247596_1119648 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Tevenvirinae → Schizotequatrovirus | 598 | Open in IMG/M |
| 3300028124|Ga0228621_1040990 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 650 | Open in IMG/M |
| 3300028126|Ga0228648_1012871 | All Organisms → Viruses | 1457 | Open in IMG/M |
| 3300028282|Ga0256413_1344996 | Not Available | 521 | Open in IMG/M |
| 3300028290|Ga0247572_1061544 | Not Available | 905 | Open in IMG/M |
| 3300028338|Ga0247567_1039115 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 1235 | Open in IMG/M |
| 3300032011|Ga0315316_11530959 | Not Available | 523 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 22.55% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 11.76% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 11.76% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 11.76% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 8.82% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 4.90% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 3.92% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 3.92% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 3.92% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 2.94% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 2.94% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 2.94% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 1.96% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 0.98% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.98% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.98% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.98% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.98% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003216 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNA | Environmental | Open in IMG/M |
| 3300003617 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_105LU_22_DNA | Environmental | Open in IMG/M |
| 3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004460 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300005608 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302PF84A | Environmental | Open in IMG/M |
| 3300006164 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA | Environmental | Open in IMG/M |
| 3300006166 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV91 | Environmental | Open in IMG/M |
| 3300006190 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA | Environmental | Open in IMG/M |
| 3300006193 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006874 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006922 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007609 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2_restored_H2O_MG | Environmental | Open in IMG/M |
| 3300007655 | Estuarine microbial communities from the Columbia River estuary - High salinity metaG S.579 | Environmental | Open in IMG/M |
| 3300009000 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300009467 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530 | Environmental | Open in IMG/M |
| 3300009495 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
| 3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
| 3300016791 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041412BS metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017706 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaG | Environmental | Open in IMG/M |
| 3300017726 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 | Environmental | Open in IMG/M |
| 3300017731 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16 | Environmental | Open in IMG/M |
| 3300017739 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 | Environmental | Open in IMG/M |
| 3300017743 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17 | Environmental | Open in IMG/M |
| 3300017746 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 | Environmental | Open in IMG/M |
| 3300017751 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2) | Environmental | Open in IMG/M |
| 3300017753 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26 | Environmental | Open in IMG/M |
| 3300017757 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22 | Environmental | Open in IMG/M |
| 3300017764 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11 | Environmental | Open in IMG/M |
| 3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300018048 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018418 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018876 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019122 | Metatranscriptome of marine microbial communities from Baltic Sea - GS677_0p1 | Environmental | Open in IMG/M |
| 3300019459 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020378 | Marine microbial communities from Tara Oceans - TARA_B100000066 (ERX556006-ERR599102) | Environmental | Open in IMG/M |
| 3300020392 | Marine microbial communities from Tara Oceans - TARA_B100000963 (ERX555916-ERR599163) | Environmental | Open in IMG/M |
| 3300020403 | Marine microbial communities from Tara Oceans - TARA_B100000085 (ERX556015-ERR599145) | Environmental | Open in IMG/M |
| 3300020420 | Marine microbial communities from Tara Oceans - TARA_B100001248 (ERX556094-ERR599142) | Environmental | Open in IMG/M |
| 3300020429 | Marine microbial communities from Tara Oceans - TARA_B100000614 (ERX556134-ERR599032) | Environmental | Open in IMG/M |
| 3300021185 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 | Environmental | Open in IMG/M |
| 3300021350 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021368 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550 | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300022178 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3) | Environmental | Open in IMG/M |
| 3300024223 | Seawater microbial communities from Monterey Bay, California, United States - 1D | Environmental | Open in IMG/M |
| 3300024228 | Seawater microbial communities from Monterey Bay, California, United States - 41D | Environmental | Open in IMG/M |
| 3300024231 | Seawater microbial communities from Monterey Bay, California, United States - 43D | Environmental | Open in IMG/M |
| 3300024266 | Seawater microbial communities from Monterey Bay, California, United States - 75D | Environmental | Open in IMG/M |
| 3300024321 | Seawater microbial communities from Monterey Bay, California, United States - 31D | Environmental | Open in IMG/M |
| 3300024322 | Seawater microbial communities from Monterey Bay, California, United States - 68D | Environmental | Open in IMG/M |
| 3300024332 | Seawater microbial communities from Monterey Bay, California, United States - 73D | Environmental | Open in IMG/M |
| 3300024335 | Seawater microbial communities from Monterey Bay, California, United States - 90D | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025483 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI074_LV_120m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025636 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_90LU_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025668 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI073_LV_100m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025701 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025767 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_105LU_22_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025840 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025849 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 (SPAdes) | Environmental | Open in IMG/M |
| 3300025879 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_85LU_5_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025880 | Pelagic Microbial community sample from North Sea - COGITO 998_met_07 (SPAdes) | Environmental | Open in IMG/M |
| 3300026136 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF45B (SPAdes) | Environmental | Open in IMG/M |
| 3300026321 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV91 (SPAdes) | Environmental | Open in IMG/M |
| 3300026449 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 56R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026470 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 73R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026471 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 77R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026503 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 91R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026505 | Seawater microbial communities from Monterey Bay, California, United States - 59D | Environmental | Open in IMG/M |
| 3300027522 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027582 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_18_M0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027672 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027704 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027714 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300028106 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 66R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028124 | Seawater microbial communities from Monterey Bay, California, United States - 25D | Environmental | Open in IMG/M |
| 3300028126 | Seawater microbial communities from Monterey Bay, California, United States - 60D | Environmental | Open in IMG/M |
| 3300028282 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028290 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 25R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028338 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 15R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032011 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI26079J46598_10877641 | 3300003216 | Marine | WRKDIDLQFQNLLEGVRQPYLTVTGSPLQRVEQILDFIK* |
| JGI26082J51739_100664403 | 3300003617 | Marine | RSVNEEWRKDIDLQFQNLLEGVRQPYLTVTGSPLQRVEQILDFIK* |
| Ga0065861_10706643 | 3300004448 | Marine | SVDEEWREKIDNEFKLLLEDVRQPYLTVTGSPLQRVEQILKYIG* |
| Ga0066222_11233773 | 3300004460 | Marine | DDGVRSVNEEWRRKIDNTFQDFLEGVGKPYLTVTGSPMQRVNQVLKYVQ* |
| Ga0066222_12360392 | 3300004460 | Marine | DDGVRSVNEKWRVDIDEEFKAVLEGVRQPYLTITGSPMQRVEQILNFINV* |
| Ga0066840_100848701 | 3300005608 | Marine | DGVRSIDEEWRTKIDNEFKAILSGVRQPYLTVTGSPMQRVEQIMKFIDV* |
| Ga0075441_100327111 | 3300006164 | Marine | VDDGVRSVNEKWRTDIDEEFKNVLEGVRQPYLTITGSPMQRVEQILNYINV* |
| Ga0066836_104140343 | 3300006166 | Marine | DGVRSVNEDWRTKVDNEFKAVLEGVRQPYLTITGSPMQRVDQILNFIK* |
| Ga0075446_100385483 | 3300006190 | Marine | DIDEEFKAVLEGVRQPYLTITGSPMQRVEQILKFIK* |
| Ga0075445_100046859 | 3300006193 | Marine | KWRTDIDEEFKNVLEGVRQPYLTITGSPMQRVDQILEFIQ* |
| Ga0098055_11263071 | 3300006793 | Marine | VRSVNEEWRVKIDDEFKAVLEGVRQPYLTISGSPMQRVEQILKFIDV* |
| Ga0075475_103281082 | 3300006874 | Aqueous | WRKTIDQEFQNILGDLDQPYLTVTGSPLQRVEQILNFIK* |
| Ga0098045_11159932 | 3300006922 | Marine | EEWRVKIDDEFKAVLEGVRQPYLTITGSPMQRVEQILKFIDV* |
| Ga0098036_11648472 | 3300006929 | Marine | DGVRSVDETWRKDIDDEFKAVLGGVRKPYLTVTGSPLQRVEQILKFINE* |
| Ga0099851_10256061 | 3300007538 | Aqueous | RSINEEWRENIDKAFKEELDKLDTPYLTVTGSPLQRVEQILNYIK* |
| Ga0102945_10929953 | 3300007609 | Pond Water | RSINEEWREKIDKAFKQELDNLDQPYLTVTGSPLQRVNQILNLLINYVRS* |
| Ga0102825_10070461 | 3300007655 | Estuarine | KEVDEEFKAVLEGVRQPYLTITGSPMQRVEQIMNFIK* |
| Ga0102960_10044781 | 3300009000 | Pond Water | VNEDWRKKVDGLFQDVLEGVRQPYLTITGSPMQRVEQILDFIK* |
| Ga0102960_12430501 | 3300009000 | Pond Water | VDEEFKAVLEGVRHPYLTITGSPMQRVEQIMNFIK* |
| Ga0114994_100178967 | 3300009420 | Marine | VRSVNEEWRRKIDNTFQDFLEGVDKPYLTVTGSPMQRVNQVLKYVQ* |
| Ga0115565_103821891 | 3300009467 | Pelagic Marine | RSVNEEWRDKIDSEFKRLLKEVKTPYLSVTGSPMQRVEQILKFIK* |
| Ga0115571_13594501 | 3300009495 | Pelagic Marine | RSTNEEWRKTIDQEFQNILGDLDQPYLTVTGSPLQRVEQILNFIK* |
| Ga0098056_11301562 | 3300010150 | Marine | DGVRSINEEWRVKIDDEFKAVLEGVRQPYLTITGSPMQRVEQILKFIDV* |
| Ga0129351_12141711 | 3300010300 | Freshwater To Marine Saline Gradient | SVNEEWREKIDEEFRAVLSGTRRTYLEVTGSPMQRVDQILDFIR* |
| Ga0133547_121912821 | 3300010883 | Marine | RSVNEDWREKIDKEFQLLLEGVRKPYLTVTGSPLQRVNQILEYIK* |
| Ga0163110_100433391 | 3300012928 | Surface Seawater | IDNEFKKYLDTVRKPFLTVTGSPMQRLEQILDFIK* |
| Ga0163111_102818644 | 3300012954 | Surface Seawater | EEWRTKIDDEFKAVLEGVRKPFLTVTGSPMQRLEQIIKFINE* |
| Ga0163111_121327373 | 3300012954 | Surface Seawater | EEWRKEVDEEFRAVLEGVRQPYLTVTGSPMQRVEQIMKFINV* |
| Ga0182095_11844302 | 3300016791 | Salt Marsh | EDWRKQIDNTFQDFLEGVRKPYLTVTGSPLQRVEQILNFINE |
| Ga0181377_10803421 | 3300017706 | Marine | KIDDEFKAVLEGVRQPYLTITGSPMQRVEQILNFIK |
| Ga0181381_10669501 | 3300017726 | Seawater | WRKKIDDEFKAVLEGVRQPYLTITGSPMQRVEQIMKFIQ |
| Ga0181416_11010081 | 3300017731 | Seawater | DEEFKAVLEGVRQPYLTVTGSPMQRLEQILKFINV |
| Ga0181433_10704441 | 3300017739 | Seawater | SISEVWRKEVDEEFRAVLEGVRQPYLTVTGSPMQRVEQIMKFINV |
| Ga0181402_11297132 | 3300017743 | Seawater | INETWRKDIDDEFKAVLDGVRKPYLTVTGSPMQRVEQILKFINE |
| Ga0181389_11863091 | 3300017746 | Seawater | RKEVDEEFRDVLEGVRQPYLTITGSPKQRVEQIMKFIK |
| Ga0187219_11632921 | 3300017751 | Seawater | GVRSISEEWRKEVDGEFKAVLDGVRQPYLTITGSPMQRVEQIMEFIK |
| Ga0181407_10426171 | 3300017753 | Seawater | RTDIDEEFKAVLEGVRQPYLTITGSPMQRVEQILKFINV |
| Ga0181420_11320523 | 3300017757 | Seawater | VNEDWRKDIDNEFKKYLETVRKPYLTITGSPMQRVNQILEFIK |
| Ga0181385_12441322 | 3300017764 | Seawater | RKEIDSEFKAVLEGVRQPYLTITGSPMQRVEQILNFIK |
| Ga0181423_12706453 | 3300017781 | Seawater | EWRKEVDEEFRDVLEGVRQPYLTVTGSPMQRVEQIMKFINV |
| Ga0181424_103595181 | 3300017786 | Seawater | RKEVDDEFKAVLEGVRQPYLTITGSPMQRVDQIMEFIN |
| Ga0181606_106833062 | 3300018048 | Salt Marsh | VNEDWRKKVDGLFQDVLEGVRQPYLTITGSPMQRVEQILDFIK |
| Ga0181567_108417761 | 3300018418 | Salt Marsh | NEQWRKDIDNEFFEILQDVRQPYLAVTGSPMQRVEQILEYIK |
| Ga0181564_102449312 | 3300018876 | Salt Marsh | RSVNEEWRKDIDLQFQNLLEGVRQPYLTVTGSPLKRVEQILEFIS |
| Ga0188839_10185373 | 3300019122 | Freshwater Lake | VDDGVRSVNEDWRVKIDDEFKDVLEGVRQPYLTITGSPMQRVEQILNFIK |
| Ga0181562_100531131 | 3300019459 | Salt Marsh | DIDLQFQNLLEGVRQPYLTVTGSPLQRVEQILEFIS |
| Ga0211527_101218881 | 3300020378 | Marine | EGWRNTIDKEFQSKLKEVRQPYLTVTGSPMQRVEQILEFIK |
| Ga0211666_100069361 | 3300020392 | Marine | SVDDGVRSVDEGWRTKIDNEFKAILSGVRQPYLTVTGSPMQRVEQILKFINV |
| Ga0211532_102499433 | 3300020403 | Marine | DIDLEFQCILDGVRKPYLTVTGSPMQRLEQILKFIDV |
| Ga0211580_100252637 | 3300020420 | Marine | DGVRSIDEEWRTKIDNEFKAILSGVRQPYLTVTGSPMQRVEQILKFINV |
| Ga0211581_102053803 | 3300020429 | Marine | WMEDIDLEFQCILDGVRKPYLTVTGSPMQRLEQILKFIDV |
| Ga0206682_100486121 | 3300021185 | Seawater | DGGVRSISEEWRKEVDDEFKAVLEGVRQPYLTITGSPMQRVDQIMEFIN |
| Ga0206692_13668094 | 3300021350 | Seawater | EQWRKEIDSEFKAVLEGVRQPYLTITGSPMQRVEQILDFINV |
| Ga0213860_103985392 | 3300021368 | Seawater | RSVNEQWRKDIDDEFFEMLQDVRQPYLTVTGSPMQRVEQILEFIQ |
| Ga0222716_106884552 | 3300021959 | Estuarine Water | DWRVKIDKEFQEKLKGVRQPFLTVTGSPMQRLNQILEFIL |
| Ga0222715_103554001 | 3300021960 | Estuarine Water | WRVKIDKEFQEQLKGVRQPFLTVTGSPMQRLNQILEFIK |
| Ga0222719_101127585 | 3300021964 | Estuarine Water | DDGVRSVNEEWREKVDKEFQLLLDGVGKPYLTVTGSPLQRVEQILEFIK |
| Ga0222719_101333811 | 3300021964 | Estuarine Water | EKIDKEFQLLLEGVRKPYLTVTGSPLQRVEQILNFIK |
| Ga0224906_10509271 | 3300022074 | Seawater | VDDGVRSVNEDWRKDIDNEFKKYLETVRKPYLTITGSPMQRVNQILEFIK |
| Ga0196887_10569954 | 3300022178 | Aqueous | GVRSVDEEWRVKIDKEFKALLNDIRKPYLTITGSPMQRVDQILNFIK |
| Ga0228601_10055734 | 3300024223 | Seawater | VNEEWRVKIDKEFKLLLDGVRKPYLTVTGSPLQRVEQILEYIN |
| Ga0228633_11184503 | 3300024228 | Seawater | DDGVRSVNEKWRTDIDEEFKAVLEGVRQPYLTITGSPMQRVEQILKFINV |
| Ga0233399_10918953 | 3300024231 | Seawater | KEVDEEFRDVLEGVRQPYLTVTGSPMQRVEQIMKFINV |
| Ga0233399_10958203 | 3300024231 | Seawater | SVDEQWRKEIDSEFKAVLEGVRQPYLTITGSPMQRVEQILDFINV |
| Ga0233399_11052793 | 3300024231 | Seawater | IDSEFKAVLDGVRQPYLTITGSPMQRVEQIMEFIK |
| Ga0228661_10690212 | 3300024266 | Seawater | RSVNEEWRVKIDKEFKLLLDGVRKPYLTVTGSPLQRVEQILEYIN |
| Ga0228626_10618051 | 3300024321 | Seawater | DDGVRSISEEWRKEVDDEFKAVLEGVRQPYLTITGSPMQRVEQIMKFINV |
| Ga0228656_10224154 | 3300024322 | Seawater | RKQVDDEFSVVLEGVRQPYLTITGSPMQRVEQILNFIK |
| Ga0228659_10209984 | 3300024332 | Seawater | NEKWRKQVDDEFRVVLEGVRQPYLTITGSPMQRVEQILNFIK |
| Ga0228672_10978831 | 3300024335 | Seawater | EWRKEVDEEFKDVLEGVRQPYLTITGSPMQRVEQIMNFIK |
| Ga0244775_110867381 | 3300024346 | Estuarine | RSVNEEWRKKIDDEFKAVLEGVRQPYLTITGSPMQRVEQIMEFIK |
| Ga0209634_12968313 | 3300025138 | Marine | WRREVDDEFKAVLEGVRQPYLTITGSPMQRVEQIMKFIK |
| Ga0209557_10765653 | 3300025483 | Marine | KDIDNEFKKYLETVRKPYLTITGSPMQRVNQILEFIK |
| Ga0209136_11110753 | 3300025636 | Marine | RSVNEEWRKDIDLQFQNLLEGVRQPYLTVTGSPLQRVEQILEFIGN |
| Ga0209251_10798944 | 3300025668 | Marine | WRKEVDDEFKAVLEGVRQPYLTITGSPMQRVEQIMEFIK |
| Ga0209771_10800381 | 3300025701 | Marine | RSVNEEWRKDIDLQFQNLLEGVRQPYLTVTGSPLQRVEQILDFIS |
| Ga0209137_10561261 | 3300025767 | Marine | RSVNEEWRKDIDLQFQNLLEGVRQPYLTVTGSPLQRVEQILEFIN |
| Ga0208917_12073021 | 3300025840 | Aqueous | ENIDKEFQDLLEGTRKPYLTVTGSPLQRVEQILEYIN |
| Ga0209603_10728354 | 3300025849 | Pelagic Marine | TNEDWRRTIDKEFQNVLGDLGKPYLTVTGSPKQRVNQILEFIK |
| Ga0209603_12291081 | 3300025849 | Pelagic Marine | TIDREFQNVLGDLGKPYLTVTGSPKQRVNQILEFIK |
| Ga0209555_100090291 | 3300025879 | Marine | RSISEEWRKEVDDEFKAVLEGVRQPYLTITGSPMQRVEQIMEFIK |
| Ga0209534_101141124 | 3300025880 | Pelagic Marine | SVNEQWRKEVDEEFKDVLEGVRQPYLTITGSPMQRVDQILNFIK |
| Ga0208763_10604602 | 3300026136 | Marine | DDGVRSVSEEWRVDIDNEFKKYLSGVRQPYLTVNGSPMQRVDQILNFIK |
| Ga0208764_101185794 | 3300026321 | Marine | VRSVNEDWRTKVDNEFKAVLEGVRQPYLTITGSPMQRVDQILNFIK |
| Ga0247593_10405301 | 3300026449 | Seawater | DDGVRSISEEWRKEVDGEFKAVLDGVRQPYLTITGSPMQRVEQIMKFINV |
| Ga0247599_10702491 | 3300026470 | Seawater | QVDDEFRVVLEGVRQPYLTITGSPMQRVEQILNFIK |
| Ga0247599_10881011 | 3300026470 | Seawater | DGVRSISEEWRKEVDEEFRDVLDGVRQPYLTITGSPMQRVEQIMKFIN |
| Ga0247602_10704071 | 3300026471 | Seawater | SVNEEWRVKIDKEFKLLLDGVRKPYLTVTGSPLQRVEQILEYIN |
| Ga0247605_10465181 | 3300026503 | Seawater | SVDDGVRSISEEWRKEVDEEFRDVLEGVRQPYLTITGSPMQRVEQIMKFINV |
| Ga0228647_10618261 | 3300026505 | Seawater | RSTNEDWRRTIDKEFQNVLGDLDKPYLTVTGSPKQRVNQILEFIK |
| Ga0209384_11175541 | 3300027522 | Marine | WRTDIDEEFKAVLEGVRQPYLTITGSPMQRVEQILKFIK |
| Ga0208971_11406951 | 3300027582 | Marine | SVDDGVRSVNEKWRTDIDEEFKAVLEGVRQPYLTITGSPMQRVEQILKFINV |
| Ga0209383_11113253 | 3300027672 | Marine | TDIDEEFKNVLEGVRQPYLTITGSPMQRVEQILKYINV |
| Ga0209816_10042551 | 3300027704 | Marine | VRSVNEKWRTDIDEEFKNVLEGVRQPYLTITGSPMQRVEQILKYINV |
| Ga0209815_10721603 | 3300027714 | Marine | VDDGVRSVNEKWRTDIDEEFKNVLEGVRQPYLTITGSPMQRVEQILNYINV |
| Ga0247596_11196481 | 3300028106 | Seawater | RVKIDKEFKLLLDGVRKPYLTVTGSPLQRVEQILEYIN |
| Ga0228621_10409902 | 3300028124 | Seawater | DGVRSVNEEWRVSIDNEFKVLLEGVRKPYLTVTGSPLQRVNQIIEFIN |
| Ga0228648_10128711 | 3300028126 | Seawater | IDEKWRQDVDQEFYNNLKEINKPYLTITGSPMQRVEQIMEFIK |
| Ga0256413_13449961 | 3300028282 | Seawater | KEVDEEFRAVLEGVRQPYLTVTGSPMQRVEQIMKFINV |
| Ga0247572_10615441 | 3300028290 | Seawater | VDEQWRKEIDSEFKAVLEGVRQPYLTITGSPMQRVEQILNFIK |
| Ga0247567_10391151 | 3300028338 | Seawater | SISEEWRKEVDDEFKAVLEGVRQPYLTITGSPMQRVDQIMEFIN |
| Ga0315316_115309592 | 3300032011 | Seawater | EWRTKIDNEFKAVLEGVRQPYLTVTGSPMQRVEQIMKFIDV |
| ⦗Top⦘ |