


| Basic Information | |
|---|---|
| Family ID | F101879 |
| Family Type | Metagenome |
| Number of Sequences | 102 |
| Average Sequence Length | 43 residues |
| Representative Sequence | RIQASYKMFSQSDESHVMYRIQGQIHALQALKQLRLKVNANG |
| Number of Associated Samples | 73 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 82.35 % |
| Associated GOLD sequencing projects | 60 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (60.784 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (22.549 % of family members) |
| Environment Ontology (ENVO) | Unclassified (85.294 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (93.137 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 59.52% β-sheet: 0.00% Coil/Unstructured: 40.48% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF05257 | CHAP | 1.96 |
| PF11651 | P22_CoatProtein | 1.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 60.78 % |
| All Organisms | root | All Organisms | 39.22 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000115|DelMOSum2011_c10020828 | All Organisms → Viruses → Predicted Viral | 3115 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10031528 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 2334 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10039885 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1976 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10065186 | All Organisms → Viruses → Predicted Viral | 1346 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10084951 | All Organisms → Viruses → Predicted Viral | 1085 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10022935 | All Organisms → Viruses → Predicted Viral | 3202 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10059687 | Not Available | 1610 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10073065 | All Organisms → Viruses → Predicted Viral | 1372 | Open in IMG/M |
| 3300001450|JGI24006J15134_10100316 | All Organisms → Viruses → Predicted Viral | 1041 | Open in IMG/M |
| 3300001460|JGI24003J15210_10163196 | Not Available | 557 | Open in IMG/M |
| 3300001472|JGI24004J15324_10076550 | Not Available | 917 | Open in IMG/M |
| 3300001589|JGI24005J15628_10151799 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300001589|JGI24005J15628_10174349 | Not Available | 627 | Open in IMG/M |
| 3300004097|Ga0055584_100445139 | All Organisms → Viruses → Predicted Viral | 1344 | Open in IMG/M |
| 3300006029|Ga0075466_1082394 | Not Available | 895 | Open in IMG/M |
| 3300006164|Ga0075441_10184878 | Not Available | 779 | Open in IMG/M |
| 3300006164|Ga0075441_10358479 | Not Available | 529 | Open in IMG/M |
| 3300006165|Ga0075443_10001992 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Puniceispirillum phage HMO-2011 | 8066 | Open in IMG/M |
| 3300006165|Ga0075443_10198625 | Not Available | 718 | Open in IMG/M |
| 3300006752|Ga0098048_1036633 | All Organisms → Viruses → Predicted Viral | 1581 | Open in IMG/M |
| 3300006810|Ga0070754_10026155 | All Organisms → Viruses → Predicted Viral | 3325 | Open in IMG/M |
| 3300006868|Ga0075481_10167461 | Not Available | 795 | Open in IMG/M |
| 3300006916|Ga0070750_10006837 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Puniceispirillum phage HMO-2011 | 6132 | Open in IMG/M |
| 3300006916|Ga0070750_10352999 | Not Available | 620 | Open in IMG/M |
| 3300006920|Ga0070748_1009804 | All Organisms → Viruses → Predicted Viral | 4180 | Open in IMG/M |
| 3300006920|Ga0070748_1051602 | Not Available | 1633 | Open in IMG/M |
| 3300006920|Ga0070748_1090896 | Not Available | 1170 | Open in IMG/M |
| 3300006925|Ga0098050_1016696 | All Organisms → Viruses → Predicted Viral | 2080 | Open in IMG/M |
| 3300006947|Ga0075444_10053791 | Not Available | 1892 | Open in IMG/M |
| 3300006947|Ga0075444_10115017 | Not Available | 1161 | Open in IMG/M |
| 3300007229|Ga0075468_10017376 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Roseobacter phage CRP-9 | 2699 | Open in IMG/M |
| 3300007229|Ga0075468_10039898 | Not Available | 1637 | Open in IMG/M |
| 3300007229|Ga0075468_10095791 | Not Available | 946 | Open in IMG/M |
| 3300007231|Ga0075469_10125100 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 710 | Open in IMG/M |
| 3300007276|Ga0070747_1308159 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 543 | Open in IMG/M |
| 3300007346|Ga0070753_1328301 | Not Available | 542 | Open in IMG/M |
| 3300007640|Ga0070751_1272212 | Not Available | 637 | Open in IMG/M |
| 3300008221|Ga0114916_1060506 | All Organisms → Viruses → Predicted Viral | 1018 | Open in IMG/M |
| 3300009173|Ga0114996_10413502 | Not Available | 1032 | Open in IMG/M |
| 3300009409|Ga0114993_11196641 | Not Available | 535 | Open in IMG/M |
| 3300009414|Ga0114909_1192986 | Not Available | 520 | Open in IMG/M |
| 3300009428|Ga0114915_1024286 | All Organisms → Viruses → Predicted Viral | 2131 | Open in IMG/M |
| 3300009428|Ga0114915_1093817 | Not Available | 900 | Open in IMG/M |
| 3300009428|Ga0114915_1149698 | Not Available | 663 | Open in IMG/M |
| 3300009440|Ga0115561_1254475 | Not Available | 655 | Open in IMG/M |
| 3300009512|Ga0115003_10419889 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium TMED228 | 785 | Open in IMG/M |
| 3300010368|Ga0129324_10068243 | Not Available | 1586 | Open in IMG/M |
| 3300010883|Ga0133547_10892153 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium TMED228 | 1733 | Open in IMG/M |
| 3300010883|Ga0133547_11576653 | Not Available | 1228 | Open in IMG/M |
| 3300011129|Ga0151672_159180 | Not Available | 773 | Open in IMG/M |
| 3300011252|Ga0151674_1018066 | Not Available | 1971 | Open in IMG/M |
| 3300011254|Ga0151675_1168646 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300011258|Ga0151677_1006436 | Not Available | 5362 | Open in IMG/M |
| 3300011258|Ga0151677_1013314 | Not Available | 565 | Open in IMG/M |
| 3300013010|Ga0129327_10052585 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 2033 | Open in IMG/M |
| 3300017697|Ga0180120_10381392 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 555 | Open in IMG/M |
| 3300017728|Ga0181419_1011136 | All Organisms → Viruses → Predicted Viral | 2642 | Open in IMG/M |
| 3300017731|Ga0181416_1136117 | Not Available | 591 | Open in IMG/M |
| 3300017741|Ga0181421_1063308 | Not Available | 975 | Open in IMG/M |
| 3300017748|Ga0181393_1005127 | Not Available | 4232 | Open in IMG/M |
| 3300020347|Ga0211504_1095541 | Not Available | 671 | Open in IMG/M |
| 3300021957|Ga0222717_10048423 | Not Available | 2762 | Open in IMG/M |
| 3300021958|Ga0222718_10235842 | Not Available | 979 | Open in IMG/M |
| 3300021958|Ga0222718_10555371 | Not Available | 546 | Open in IMG/M |
| 3300021959|Ga0222716_10041461 | All Organisms → Viruses → Predicted Viral | 3305 | Open in IMG/M |
| 3300022164|Ga0212022_1011708 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1241 | Open in IMG/M |
| 3300022164|Ga0212022_1025976 | Not Available | 889 | Open in IMG/M |
| 3300022178|Ga0196887_1043560 | Not Available | 1178 | Open in IMG/M |
| 3300022178|Ga0196887_1124146 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 551 | Open in IMG/M |
| 3300024326|Ga0228652_1136008 | Not Available | 534 | Open in IMG/M |
| 3300024346|Ga0244775_11375714 | Not Available | 544 | Open in IMG/M |
| 3300025048|Ga0207905_1067479 | Not Available | 527 | Open in IMG/M |
| 3300025071|Ga0207896_1054124 | Not Available | 652 | Open in IMG/M |
| 3300025071|Ga0207896_1065438 | Not Available | 574 | Open in IMG/M |
| 3300025079|Ga0207890_1011936 | All Organisms → Viruses → Predicted Viral | 1806 | Open in IMG/M |
| 3300025085|Ga0208792_1032240 | Not Available | 1034 | Open in IMG/M |
| 3300025098|Ga0208434_1076738 | Not Available | 685 | Open in IMG/M |
| 3300025120|Ga0209535_1019779 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 3442 | Open in IMG/M |
| 3300025120|Ga0209535_1182207 | Not Available | 617 | Open in IMG/M |
| 3300025137|Ga0209336_10081362 | Not Available | 944 | Open in IMG/M |
| 3300025138|Ga0209634_1065891 | All Organisms → Viruses → Predicted Viral | 1723 | Open in IMG/M |
| 3300025138|Ga0209634_1319014 | Not Available | 525 | Open in IMG/M |
| 3300025237|Ga0208031_1010924 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1242 | Open in IMG/M |
| 3300025266|Ga0208032_1028403 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium TMED228 | 1509 | Open in IMG/M |
| 3300025276|Ga0208814_1022977 | All Organisms → Viruses → Predicted Viral | 2061 | Open in IMG/M |
| 3300025276|Ga0208814_1069041 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 970 | Open in IMG/M |
| 3300025276|Ga0208814_1069369 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 967 | Open in IMG/M |
| 3300025543|Ga0208303_1040673 | All Organisms → Viruses → Predicted Viral | 1180 | Open in IMG/M |
| 3300025570|Ga0208660_1030855 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 1473 | Open in IMG/M |
| 3300025645|Ga0208643_1037931 | Not Available | 1546 | Open in IMG/M |
| 3300027672|Ga0209383_1158849 | Not Available | 694 | Open in IMG/M |
| 3300027714|Ga0209815_1047153 | Not Available | 1584 | Open in IMG/M |
| 3300029448|Ga0183755_1041939 | Not Available | 1228 | Open in IMG/M |
| 3300029448|Ga0183755_1051195 | Not Available | 1037 | Open in IMG/M |
| 3300029448|Ga0183755_1077346 | Not Available | 722 | Open in IMG/M |
| 3300031510|Ga0308010_1181880 | Not Available | 769 | Open in IMG/M |
| 3300031598|Ga0308019_10309193 | Not Available | 586 | Open in IMG/M |
| 3300031599|Ga0308007_10053347 | Not Available | 1526 | Open in IMG/M |
| 3300031630|Ga0308004_10191338 | Not Available | 836 | Open in IMG/M |
| 3300031659|Ga0307986_10151493 | Not Available | 1076 | Open in IMG/M |
| 3300033742|Ga0314858_122961 | Not Available | 663 | Open in IMG/M |
| 3300034374|Ga0348335_188066 | Not Available | 516 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 22.55% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 22.55% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 11.76% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 9.80% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 7.84% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 4.90% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 4.90% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 3.92% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 3.92% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 2.94% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.98% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 0.98% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.98% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 0.98% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
| 3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
| 3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006164 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA | Environmental | Open in IMG/M |
| 3300006165 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006868 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006925 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG | Environmental | Open in IMG/M |
| 3300006947 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA | Environmental | Open in IMG/M |
| 3300007229 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007231 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
| 3300008221 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_66 | Environmental | Open in IMG/M |
| 3300009173 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 | Environmental | Open in IMG/M |
| 3300009409 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 | Environmental | Open in IMG/M |
| 3300009414 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_906 | Environmental | Open in IMG/M |
| 3300009428 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 | Environmental | Open in IMG/M |
| 3300009440 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110512 | Environmental | Open in IMG/M |
| 3300009512 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300011129 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_4, 0.02 | Environmental | Open in IMG/M |
| 3300011252 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_4, permeate | Environmental | Open in IMG/M |
| 3300011254 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, 0.02 | Environmental | Open in IMG/M |
| 3300011258 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, permeate | Environmental | Open in IMG/M |
| 3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017728 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24 | Environmental | Open in IMG/M |
| 3300017731 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16 | Environmental | Open in IMG/M |
| 3300017741 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19 | Environmental | Open in IMG/M |
| 3300017748 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21 | Environmental | Open in IMG/M |
| 3300020347 | Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994) | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300022164 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v2) | Environmental | Open in IMG/M |
| 3300022178 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3) | Environmental | Open in IMG/M |
| 3300024326 | Seawater microbial communities from Monterey Bay, California, United States - 64D | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025048 | Marine viral communities from the Subarctic Pacific Ocean - LP-49 (SPAdes) | Environmental | Open in IMG/M |
| 3300025071 | Marine viral communities from the Pacific Ocean - LP-36 (SPAdes) | Environmental | Open in IMG/M |
| 3300025079 | Marine viral communities from the Pacific Ocean - LP-48 (SPAdes) | Environmental | Open in IMG/M |
| 3300025085 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025098 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025237 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_38 (SPAdes) | Environmental | Open in IMG/M |
| 3300025266 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_66 (SPAdes) | Environmental | Open in IMG/M |
| 3300025276 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025570 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027672 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027714 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
| 3300031510 | Marine microbial communities from water near the shore, Antarctic Ocean - #129 | Environmental | Open in IMG/M |
| 3300031598 | Marine microbial communities from water near the shore, Antarctic Ocean - #284 | Environmental | Open in IMG/M |
| 3300031599 | Marine microbial communities from water near the shore, Antarctic Ocean - #71 | Environmental | Open in IMG/M |
| 3300031630 | Marine microbial communities from water near the shore, Antarctic Ocean - #38 | Environmental | Open in IMG/M |
| 3300031659 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #82 | Environmental | Open in IMG/M |
| 3300033742 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater | Environmental | Open in IMG/M |
| 3300034374 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2011_100208281 | 3300000115 | Marine | EAELEERIQASYKQFAQSDEQHVMYRVQGQIYALQALKQLRLKVNANGS* |
| DelMOSum2011_100315282 | 3300000115 | Marine | MFSQSDESHVMYRIQGQIHALQALKQLRLKVNAND* |
| DelMOSum2011_100398851 | 3300000115 | Marine | MFSQSDESHVMYRIQGQIHALQALKQLRLKVNANG* |
| DelMOSum2011_100651861 | 3300000115 | Marine | RIQASYKMFSQSDESHVMYRIQGQIHALQALKQLRLKVNANG* |
| DelMOSum2011_100849511 | 3300000115 | Marine | SYKTFSQTDDPIVMNRMQGAVHALTALKQLRLKVNANG* |
| DelMOWin2010_100229351 | 3300000117 | Marine | EERIQSSYKTFSQTDDPIVMNRMQGAVHALTALKQLRLKVNANG* |
| DelMOWin2010_100596871 | 3300000117 | Marine | FSQTEDSNVIYRMQGQVHALQALKQLRLKVNANE* |
| DelMOWin2010_100730651 | 3300000117 | Marine | YKTFSQTDDPIVMNRMQGAVHALTALKQLRLKVNANG* |
| JGI24006J15134_101003162 | 3300001450 | Marine | SYKMFSQTDDPIVMNRMQGAVHALTALKQLRLKVNANG* |
| JGI24003J15210_101631962 | 3300001460 | Marine | QSSYKTFSQTDDPMVMQRMQGAVHALTALKQLRLKVNANG* |
| JGI24004J15324_100765502 | 3300001472 | Marine | RIQNSYKMFSQTDDPIVMNRMQGAVHALTALKQLRLKVNANG* |
| JGI24005J15628_101517991 | 3300001589 | Marine | FSQTEESNVMYRMQGQVHALNALKQLRLKVNADG*DF* |
| JGI24005J15628_101743491 | 3300001589 | Marine | FSQTEESNVMYRMQGQVHALNALKQLRLKVNADG* |
| Ga0055584_1004451392 | 3300004097 | Pelagic Marine | RIQASYKMFSQSDEEHVMYRLQGQVHALNALKQLRLKVNANG* |
| Ga0075466_10823942 | 3300006029 | Aqueous | QASYKMFSQSDESHVMYRIQGQIHALQALKQLRLKVNANG* |
| Ga0075441_101848781 | 3300006164 | Marine | IQLSYKQFSQANEEHVMFRVQGQIYALQALKQLRLKVNADG* |
| Ga0075441_103584792 | 3300006164 | Marine | KQFAQSDEQHVMYRVQGQIYALTALKQLRLKVNANG* |
| Ga0075443_100019928 | 3300006165 | Marine | QLSYKQFSQANEEHVMFRVQGQIYALQALKQLRLKVNADG* |
| Ga0075443_101986251 | 3300006165 | Marine | ELEERIQNSYKMFSQTDDPIVMNRMQGAVHALTALKQLRLKVNANG* |
| Ga0098048_10366331 | 3300006752 | Marine | ASYKMFSQSDESHIMYRIQGQIHALQALKQLRLKVNANG* |
| Ga0070754_100261552 | 3300006810 | Aqueous | RIQSSYKTFSQTDDPIVMNRMQGAVHALTALKQLRLKVNANG* |
| Ga0075481_101674612 | 3300006868 | Aqueous | ERIQASYKMFSQSDESHVMYRIQGQIHALQALKQLRLKVNAND* |
| Ga0070750_100068374 | 3300006916 | Aqueous | FSQTDDPIVMNRMQGAVHALTALKQLRLKVNANG* |
| Ga0070750_103529991 | 3300006916 | Aqueous | FSQTDDPMVMNRMQGAVHALNALKQLRLNVNANG* |
| Ga0070748_10098042 | 3300006920 | Aqueous | AFEAELEERIQSSYKTFSQTDDPIVMNRMQGAVHALTALKQLRLKVNANG* |
| Ga0070748_10516021 | 3300006920 | Aqueous | RMFSQTEDSNVIYRMQGQVHALQALKQLRLKVNANE* |
| Ga0070748_10908962 | 3300006920 | Aqueous | IQASYKMFSQSDESHVMYRIQGQIHALQALKQLRLKVNANG* |
| Ga0098050_10166963 | 3300006925 | Marine | ERIDASYKMFSQSDESHIMYRIQGQIHALQALKQLRLKVNANG* |
| Ga0075444_100537912 | 3300006947 | Marine | IQLSYKQFSQANEEHVMFRVQGQIYALQALKQLRLKVNANG* |
| Ga0075444_101150171 | 3300006947 | Marine | ELNERIQASYKMFSQSDESHVMYRLQGQVHALTALKQLRLKVNANG* |
| Ga0075468_100173762 | 3300007229 | Aqueous | FEAELEERIQSSYKTFSQTDDPIVMNRMQGAVHALTALKQLRLKVNANG* |
| Ga0075468_100398981 | 3300007229 | Aqueous | SYRMFSQTEDSNVIYRMQGQVHALQALKQLRLKVNANE* |
| Ga0075468_100957912 | 3300007229 | Aqueous | QSSYKTFSQTDDPMVMNRMQGAVHALNALKQLRLKVNANG* |
| Ga0075469_101251002 | 3300007231 | Aqueous | ELDERIQASYKMFSQSDESHVMYRLQGQIHALQALKQLRLKVNANG* |
| Ga0070747_13081591 | 3300007276 | Aqueous | IQASYKMFSQSDESHVMYRIQGQIHALQALKQLRLKVNAND* |
| Ga0070753_13283011 | 3300007346 | Aqueous | RIQNSYKTFSQTDDPIVMNRMQGAVHALNALKQLRLKVNANG* |
| Ga0070751_12722121 | 3300007640 | Aqueous | KMFSQSDETHVMYRLQGQVHALNALKQLRLKVNANG* |
| Ga0114916_10605061 | 3300008221 | Deep Ocean | QNSYTMFSQTDDPIVMNRMQGAVHALTALKQLRLKVNANG* |
| Ga0114996_104135021 | 3300009173 | Marine | NERIQASYKMFSQSDEDHVMYRLQGQVHALNALKQLRLKVNANGS* |
| Ga0114993_111966412 | 3300009409 | Marine | ELEERIQASYKQFAQSDEQHVMYRVQGQIYALQALKQLRLKVNANGS* |
| Ga0114909_11929861 | 3300009414 | Deep Ocean | DERIQASYKMFSQSDEEHVMYRLQGQVNALNALKQLRLKVNANG* |
| Ga0114915_10242861 | 3300009428 | Deep Ocean | DAFEAELEERIQNSYTMFSQTDDPIVMNRMQGAVHALTALKQLRLKVNANG* |
| Ga0114915_10938171 | 3300009428 | Deep Ocean | AFEEEIEERIQLSYKQFSQANEEHVMFRVQGQIYALQALKQLRLKVNANG* |
| Ga0114915_11496981 | 3300009428 | Deep Ocean | NAFEAELEERIQSSYKQFAQSDEQHVMYRVQGQIYALQALKQLRLKVNANGS* |
| Ga0115561_12544751 | 3300009440 | Pelagic Marine | SSYKTFSQTDDPIVMNRMQGAVHTLTALKQLRLKVNANG* |
| Ga0115003_104198891 | 3300009512 | Marine | ELEERIQASYKQFAQSDEQHVMYRVQGQIYALQALKQLRLKVNANG* |
| Ga0129324_100682431 | 3300010368 | Freshwater To Marine Saline Gradient | FEAELDERIQASYKMFSQSDESHVMYRLQGQIHALQALKQLRLKVNAND* |
| Ga0133547_108921531 | 3300010883 | Marine | ERIQASYKQFAQSDEQHVMYRVQGQIYALQALKQLRLKVNANG* |
| Ga0133547_115766531 | 3300010883 | Marine | AFETELEERIQLSYKQFSQANEEHVMYRVQGQIYALQALKQLRLKVNADG* |
| Ga0151672_1591802 | 3300011129 | Marine | AFEAELEERIQNSYKMFSQTDDPIVMNRMQGAVHALTALKQLRLKVNANG* |
| Ga0151674_10180661 | 3300011252 | Marine | DAFEAELEERIQSSYKTFSQTDDPIVMNRMQGAVHALTALKQLRLKVNANG* |
| Ga0151675_11686462 | 3300011254 | Marine | MFSQSDEEHVMYRLQGQVHALNALKQLRLKVNANG* |
| Ga0151677_10064361 | 3300011258 | Marine | EAELDERINASYKMFSQSDESHVMYRIQGQIHALQALKQLRLKVNANG* |
| Ga0151677_10133142 | 3300011258 | Marine | EVELDERIQASYKMFSQSDESHVMYRIQGQIHALQALKQLRLKVNANG* |
| Ga0129327_100525851 | 3300013010 | Freshwater To Marine Saline Gradient | QSSYKTFSQTDDPIVMNRMQGAVHALTALKQLRLKVNANG* |
| Ga0180120_103813922 | 3300017697 | Freshwater To Marine Saline Gradient | IQASYKMFSQSDESHVMYRIQGQIHALQALKQLRLKVNAND |
| Ga0181419_10111362 | 3300017728 | Seawater | QSSYKTFSQTDDPMVMNRMQGAVHALTALKQLRLKVNANG |
| Ga0181416_11361172 | 3300017731 | Seawater | YKMFSQSDESHVMYRIQGQIHALQALKQLRLKVNANG |
| Ga0181421_10633081 | 3300017741 | Seawater | KMFSQSDEEHVMYRLQGQVHALNALKQLRLKVNANG |
| Ga0181393_10051272 | 3300017748 | Seawater | ERIDASYKMFSQSDESHVMYRIQGQIHALQALKQLRLKVNANG |
| Ga0211504_10955412 | 3300020347 | Marine | LEDRIQSSYKTFSQTDDPIVMNRMQGAVHALTALKQLRLKVNANG |
| Ga0222717_100484232 | 3300021957 | Estuarine Water | ELDERIQASYKMFSQSDESHVMYRIQGQIHALQALKQLRLKVNANG |
| Ga0222718_102358421 | 3300021958 | Estuarine Water | KAFEVELGERIDASYKMFSQSDESHVMYRIQGQIHALQALKQLRLKVNANG |
| Ga0222718_105553711 | 3300021958 | Estuarine Water | AELEDRIQSSYKTFSQTDDPIVMNRMQGAVHALTALKQLRLKVNANG |
| Ga0222716_100414611 | 3300021959 | Estuarine Water | IQSSYKTFSQTDDPIVMNRMQGAVHALTALKQLRLKVNANG |
| Ga0212022_10117082 | 3300022164 | Aqueous | QASYKMFSQSDESHVMYRIQGQIHALQALKQLRLKVNANG |
| Ga0212022_10259761 | 3300022164 | Aqueous | EAELDERIQASYRMFSQTEDSNVIYRMQGQVHALQALKQLRLKVNANG |
| Ga0196887_10435602 | 3300022178 | Aqueous | RIQASYKMFSQSDESHVMYRIQGQIHALQALKQLRLKVNANG |
| Ga0196887_11241461 | 3300022178 | Aqueous | ERIQASYKMFSQSDESHVMYRIQGQIHALQALKQLRLKVNAND |
| Ga0228652_11360081 | 3300024326 | Seawater | QASYKMFSQSDEEHVMYRLQGQVHALNALKQLRLKVNADG |
| Ga0244775_113757141 | 3300024346 | Estuarine | DERIQASYKMFSQSDEEHVMYRLQGQVHALNALKQLRLKVNANG |
| Ga0207905_10674791 | 3300025048 | Marine | ERIQNSYKMFSQTDDPIVMNRMQGAVHALTALKQLRLKVNANG |
| Ga0207896_10541242 | 3300025071 | Marine | IQASYKQFAQSDEQHVMYRVQGQIYALQALKQLRLKVNANGS |
| Ga0207896_10654381 | 3300025071 | Marine | RIQASYKMFSQSDESHVMYRIQGQIHALQALKQLRLKVNAND |
| Ga0207890_10119361 | 3300025079 | Marine | KMFSQTDDPIVMNRMQGAVHALTALKQLRLKVNANG |
| Ga0208792_10322402 | 3300025085 | Marine | RIDASYKMFSQSDESHIMYRIQGQIHALQALKQLRLKVNANG |
| Ga0208434_10767382 | 3300025098 | Marine | ASYKMFSQSDESHIMYRIQGQIHALQALKQLRLKVNANG |
| Ga0209535_10197792 | 3300025120 | Marine | AFEAELEERIQASYKQFAQSDEQHVMYRVQGQIYALQALKQLRLKVNANGS |
| Ga0209535_11822072 | 3300025120 | Marine | RIQSSYKTFSQTDDPMVMQRMQGAVHALNALKQLRLKVNANG |
| Ga0209336_100813622 | 3300025137 | Marine | LEERIQNSYKMFSQTDDPIVMNRMQGAVHALTALKQLRLKVNANG |
| Ga0209634_10658911 | 3300025138 | Marine | AFEAELEERIQASYKQFAQSDEQHVMYRVQGQIYALQALKQLRLKVNANG |
| Ga0209634_13190142 | 3300025138 | Marine | DERIQASYKMFSQSDEDHVMYRLQGQVHALNALKQLRLKVNANG |
| Ga0208031_10109241 | 3300025237 | Deep Ocean | AFEEEIEERIQLSYKQFSQANEKHVMFRVQGQIYALQALKQLRLKVNANG |
| Ga0208032_10284032 | 3300025266 | Deep Ocean | QLSYKQFSQANEEHVMFRVQGQIYALQALKQLRLKVNADG |
| Ga0208814_10229772 | 3300025276 | Deep Ocean | EEELEERIQLSYKQFSQANEEHVMFRVQGQIYALQALKQLRLKVNANG |
| Ga0208814_10690412 | 3300025276 | Deep Ocean | EERIQLSYKQFSQANEEHVMFRVQGQIYALQALKQLRLKVNANG |
| Ga0208814_10693692 | 3300025276 | Deep Ocean | KQFSQANEEHVMYRVQGQIYALQALKQLRLKVNADG |
| Ga0208303_10406732 | 3300025543 | Aqueous | RIQASYRMFSQTEDSNVIYRMQGQVHALQALKQLRLKVNANG |
| Ga0208660_10308551 | 3300025570 | Aqueous | NAFEAELDERIQASYKMFSQSDESHVMYRLQGQIHALQALKQLRLKVNANG |
| Ga0208643_10379312 | 3300025645 | Aqueous | IQASYKMFSQSDESHVMYRLQGQIHALQALKQLRLKVNAND |
| Ga0209383_11588491 | 3300027672 | Marine | AFEEELEERIQLSYKQFSQANEEHVMYRVQGQIYALQALKQLRLKVNADG |
| Ga0209815_10471532 | 3300027714 | Marine | YKQFSQANEEHVMFRVQGQIYALQALKQLRLKVNADG |
| Ga0183755_10419391 | 3300029448 | Marine | SSYKTFSQTDDPIVMNRMQGAVHALTALKQLRLKVNANG |
| Ga0183755_10511952 | 3300029448 | Marine | LDERIQASYKMFSQSDEEHVMYRLQGQVHALNALKQLRLKVNANG |
| Ga0183755_10773463 | 3300029448 | Marine | LDERIQASYKMFSQSDEERVMYRLQGQVHALNALKQLRLKVNANG |
| Ga0308010_11818801 | 3300031510 | Marine | NSYKMFSQTDDPMVMQRMQGAVHALTALKQLRLKVNANG |
| Ga0308019_103091932 | 3300031598 | Marine | ERIQNSYKMFSQTDDPMVMQRMQGAVHALTALKQLRLKVNANG |
| Ga0308007_100533472 | 3300031599 | Marine | QFAQSDEQHVMYRVQGQIYALQALKQLRLKVNANGS |
| Ga0308004_101913381 | 3300031630 | Marine | NAFEEELEERIQLSYKQFSQANEEHVMYRVQGQIYALQALKQLRLKVNADG |
| Ga0307986_101514932 | 3300031659 | Marine | ERIQSSYKQFAQSDEQHVMYRVQGQIYALQALKQLRLKVNANGS |
| Ga0314858_122961_509_661 | 3300033742 | Sea-Ice Brine | AFEAELEERIQNSYKMFSQTDDPIVMNRMQGAVHALTALKQLRLKVNANG |
| Ga0348335_188066_1_150 | 3300034374 | Aqueous | FEAELEERIQNSYKTFSQTDDPIVMNRMQGAVHALTALKQLRLKVNANG |
| ⦗Top⦘ |