


| Basic Information | |
|---|---|
| Family ID | F101842 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 102 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MMIESIIIAFSIREDMMLRVALGALVVIGLRATKKVLDD |
| Number of Associated Samples | 81 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 24.51 % |
| % of genes near scaffold ends (potentially truncated) | 27.45 % |
| % of genes from short scaffolds (< 2000 bps) | 79.41 % |
| Associated GOLD sequencing projects | 70 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (67.647 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (62.745 % of family members) |
| Environment Ontology (ENVO) | Unclassified (91.176 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (92.157 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.22% β-sheet: 0.00% Coil/Unstructured: 44.78% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF11962 | Peptidase_G2 | 1.96 |
| PF09374 | PG_binding_3 | 1.96 |
| PF13884 | Peptidase_S74 | 1.96 |
| PF06094 | GGACT | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 67.65 % |
| All Organisms | root | All Organisms | 32.35 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10093610 | Not Available | 1276 | Open in IMG/M |
| 3300001450|JGI24006J15134_10007645 | Not Available | 5465 | Open in IMG/M |
| 3300002518|JGI25134J35505_10079448 | Not Available | 750 | Open in IMG/M |
| 3300004460|Ga0066222_1137974 | Not Available | 1976 | Open in IMG/M |
| 3300004637|Ga0066616_1175498 | Not Available | 535 | Open in IMG/M |
| 3300005430|Ga0066849_10002601 | All Organisms → cellular organisms → Bacteria | 7445 | Open in IMG/M |
| 3300005430|Ga0066849_10087343 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Gimesia → unclassified Gimesia → Gimesia sp. | 1243 | Open in IMG/M |
| 3300005514|Ga0066866_10186304 | Not Available | 732 | Open in IMG/M |
| 3300005605|Ga0066850_10182149 | Not Available | 765 | Open in IMG/M |
| 3300006076|Ga0081592_1042160 | All Organisms → Viruses → Predicted Viral | 2164 | Open in IMG/M |
| 3300006166|Ga0066836_10720068 | Not Available | 604 | Open in IMG/M |
| 3300006736|Ga0098033_1024404 | All Organisms → Viruses → Predicted Viral | 1860 | Open in IMG/M |
| 3300006736|Ga0098033_1127848 | Not Available | 717 | Open in IMG/M |
| 3300006738|Ga0098035_1232676 | Not Available | 610 | Open in IMG/M |
| 3300006751|Ga0098040_1021033 | All Organisms → Viruses → Predicted Viral | 2133 | Open in IMG/M |
| 3300006751|Ga0098040_1052567 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Gimesia → unclassified Gimesia → Gimesia sp. | 1264 | Open in IMG/M |
| 3300006751|Ga0098040_1182602 | Not Available | 616 | Open in IMG/M |
| 3300006751|Ga0098040_1198903 | Not Available | 586 | Open in IMG/M |
| 3300006753|Ga0098039_1153247 | Not Available | 787 | Open in IMG/M |
| 3300006754|Ga0098044_1008717 | All Organisms → cellular organisms → Bacteria | 4815 | Open in IMG/M |
| 3300006793|Ga0098055_1232134 | Not Available | 696 | Open in IMG/M |
| 3300006923|Ga0098053_1017153 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Gimesia → unclassified Gimesia → Gimesia sp. | 1592 | Open in IMG/M |
| 3300006925|Ga0098050_1067854 | Not Available | 926 | Open in IMG/M |
| 3300006926|Ga0098057_1043152 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Gimesia → unclassified Gimesia → Gimesia sp. | 1112 | Open in IMG/M |
| 3300006927|Ga0098034_1138747 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Gimesia → unclassified Gimesia → Gimesia sp. | 688 | Open in IMG/M |
| 3300006928|Ga0098041_1139464 | Not Available | 781 | Open in IMG/M |
| 3300007963|Ga0110931_1141886 | Not Available | 722 | Open in IMG/M |
| 3300008050|Ga0098052_1011847 | Not Available | 4455 | Open in IMG/M |
| 3300008050|Ga0098052_1042712 | Not Available | 1992 | Open in IMG/M |
| 3300008050|Ga0098052_1183088 | Not Available | 819 | Open in IMG/M |
| 3300008216|Ga0114898_1025776 | All Organisms → Viruses → Predicted Viral | 2004 | Open in IMG/M |
| 3300008217|Ga0114899_1036115 | All Organisms → Viruses → Predicted Viral | 1821 | Open in IMG/M |
| 3300008217|Ga0114899_1137172 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Gimesia → unclassified Gimesia → Gimesia sp. | 803 | Open in IMG/M |
| 3300008219|Ga0114905_1181312 | Not Available | 687 | Open in IMG/M |
| 3300008221|Ga0114916_1139689 | Not Available | 551 | Open in IMG/M |
| 3300009104|Ga0117902_1235175 | Not Available | 1767 | Open in IMG/M |
| 3300009173|Ga0114996_10054459 | All Organisms → Viruses → Predicted Viral | 3587 | Open in IMG/M |
| 3300009173|Ga0114996_10417563 | Not Available | 1026 | Open in IMG/M |
| 3300009409|Ga0114993_10646515 | Not Available | 774 | Open in IMG/M |
| 3300009409|Ga0114993_10760879 | Not Available | 702 | Open in IMG/M |
| 3300009413|Ga0114902_1107422 | Not Available | 738 | Open in IMG/M |
| 3300009425|Ga0114997_10085235 | Not Available | 1953 | Open in IMG/M |
| 3300009481|Ga0114932_10073747 | Not Available | 2150 | Open in IMG/M |
| 3300009481|Ga0114932_10872274 | Not Available | 520 | Open in IMG/M |
| 3300009577|Ga0105230_112898 | Not Available | 554 | Open in IMG/M |
| 3300009604|Ga0114901_1023002 | All Organisms → Viruses → Predicted Viral | 2399 | Open in IMG/M |
| 3300009604|Ga0114901_1053173 | All Organisms → Viruses → Predicted Viral | 1389 | Open in IMG/M |
| 3300009620|Ga0114912_1105233 | Not Available | 675 | Open in IMG/M |
| 3300009786|Ga0114999_10207159 | All Organisms → Viruses → Predicted Viral | 1623 | Open in IMG/M |
| 3300009791|Ga0105235_133264 | Not Available | 539 | Open in IMG/M |
| 3300010149|Ga0098049_1197274 | Not Available | 617 | Open in IMG/M |
| 3300010150|Ga0098056_1014405 | All Organisms → Viruses → Predicted Viral | 2865 | Open in IMG/M |
| 3300010153|Ga0098059_1322312 | Not Available | 589 | Open in IMG/M |
| 3300010155|Ga0098047_10021832 | Not Available | 2572 | Open in IMG/M |
| 3300010883|Ga0133547_11074309 | Not Available | 1550 | Open in IMG/M |
| 3300010883|Ga0133547_11401077 | Not Available | 1319 | Open in IMG/M |
| 3300017704|Ga0181371_1078204 | Not Available | 536 | Open in IMG/M |
| 3300017757|Ga0181420_1071637 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Gimesia → unclassified Gimesia → Gimesia sp. | 1089 | Open in IMG/M |
| 3300017764|Ga0181385_1143504 | Not Available | 726 | Open in IMG/M |
| 3300017764|Ga0181385_1193578 | Not Available | 614 | Open in IMG/M |
| 3300020351|Ga0211601_1023995 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1668 | Open in IMG/M |
| 3300020395|Ga0211705_10208028 | Not Available | 720 | Open in IMG/M |
| 3300020473|Ga0211625_10000204 | All Organisms → cellular organisms → Bacteria | 73528 | Open in IMG/M |
| (restricted) 3300024052|Ga0255050_10125214 | Not Available | 609 | Open in IMG/M |
| 3300025046|Ga0207902_1049418 | Not Available | 526 | Open in IMG/M |
| 3300025050|Ga0207892_1010060 | Not Available | 990 | Open in IMG/M |
| 3300025052|Ga0207906_1036353 | Not Available | 673 | Open in IMG/M |
| 3300025052|Ga0207906_1053322 | Not Available | 539 | Open in IMG/M |
| 3300025066|Ga0208012_1015441 | All Organisms → Viruses → Predicted Viral | 1285 | Open in IMG/M |
| 3300025066|Ga0208012_1021721 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Gimesia → unclassified Gimesia → Gimesia sp. | 1034 | Open in IMG/M |
| 3300025072|Ga0208920_1036516 | Not Available | 1012 | Open in IMG/M |
| 3300025078|Ga0208668_1073381 | Not Available | 613 | Open in IMG/M |
| 3300025082|Ga0208156_1016936 | All Organisms → cellular organisms → Bacteria | 1681 | Open in IMG/M |
| 3300025083|Ga0208791_1028550 | Not Available | 1070 | Open in IMG/M |
| 3300025084|Ga0208298_1049514 | Not Available | 825 | Open in IMG/M |
| 3300025085|Ga0208792_1020123 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Gimesia → unclassified Gimesia → Gimesia sp. | 1396 | Open in IMG/M |
| 3300025097|Ga0208010_1069588 | Not Available | 755 | Open in IMG/M |
| 3300025098|Ga0208434_1016402 | Not Available | 1919 | Open in IMG/M |
| 3300025098|Ga0208434_1107771 | Not Available | 537 | Open in IMG/M |
| 3300025103|Ga0208013_1052597 | All Organisms → Viruses → Predicted Viral | 1102 | Open in IMG/M |
| 3300025112|Ga0209349_1121287 | Not Available | 727 | Open in IMG/M |
| 3300025114|Ga0208433_1080691 | Not Available | 827 | Open in IMG/M |
| 3300025133|Ga0208299_1047613 | Not Available | 1656 | Open in IMG/M |
| 3300025133|Ga0208299_1161128 | Not Available | 696 | Open in IMG/M |
| 3300025141|Ga0209756_1026757 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 3184 | Open in IMG/M |
| 3300025141|Ga0209756_1253763 | Not Available | 643 | Open in IMG/M |
| 3300025168|Ga0209337_1001816 | Not Available | 15871 | Open in IMG/M |
| 3300025251|Ga0208182_1006385 | All Organisms → Viruses → Predicted Viral | 3715 | Open in IMG/M |
| 3300025251|Ga0208182_1007207 | All Organisms → Viruses → Predicted Viral | 3422 | Open in IMG/M |
| 3300025267|Ga0208179_1014037 | All Organisms → Viruses → Predicted Viral | 2401 | Open in IMG/M |
| 3300025267|Ga0208179_1119271 | Not Available | 501 | Open in IMG/M |
| 3300025274|Ga0208183_1056708 | Not Available | 774 | Open in IMG/M |
| 3300025280|Ga0208449_1141094 | Not Available | 530 | Open in IMG/M |
| 3300025282|Ga0208030_1001951 | All Organisms → cellular organisms → Bacteria | 10889 | Open in IMG/M |
| 3300026115|Ga0208560_1005809 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Gimesia → unclassified Gimesia → Gimesia sp. | 1018 | Open in IMG/M |
| 3300027838|Ga0209089_10282743 | Not Available | 951 | Open in IMG/M |
| (restricted) 3300027865|Ga0255052_10296949 | Not Available | 789 | Open in IMG/M |
| 3300028022|Ga0256382_1005066 | Not Available | 2204 | Open in IMG/M |
| 3300029319|Ga0183748_1021561 | Not Available | 2271 | Open in IMG/M |
| 3300031801|Ga0310121_10548587 | Not Available | 633 | Open in IMG/M |
| 3300032360|Ga0315334_11271389 | Not Available | 635 | Open in IMG/M |
| 3300034654|Ga0326741_023526 | All Organisms → Viruses → Predicted Viral | 1087 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 62.75% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 15.69% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 3.92% |
| Marine Oceanic | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Oceanic | 2.94% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 2.94% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.96% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 1.96% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.98% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.98% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.98% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.98% |
| Filtered Seawater | Environmental → Aquatic → Marine → Unclassified → Unclassified → Filtered Seawater | 0.98% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.98% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.98% |
| Diffuse Hydrothermal Fluids | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Fluids | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300002518 | Marine viral communities from the Pacific Ocean - ETNP_6_100 | Environmental | Open in IMG/M |
| 3300004460 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004637 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI047_150m_RNA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005430 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV69 | Environmental | Open in IMG/M |
| 3300005514 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV263 | Environmental | Open in IMG/M |
| 3300005605 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV67 | Environmental | Open in IMG/M |
| 3300006076 | Microbial communities in diffuse hydrothermal fluids of Manus Basin, Bismarck Sea ? fluid A | Environmental | Open in IMG/M |
| 3300006166 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV91 | Environmental | Open in IMG/M |
| 3300006736 | Marine viral communities from the Subarctic Pacific Ocean - 1_ETSP_OMZ_AT15124 metaG | Environmental | Open in IMG/M |
| 3300006738 | Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG | Environmental | Open in IMG/M |
| 3300006751 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG | Environmental | Open in IMG/M |
| 3300006753 | Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG | Environmental | Open in IMG/M |
| 3300006754 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006923 | Marine viral communities from the Subarctic Pacific Ocean - 15B_ETSP_OMZ_AT15312_CsCl metaG | Environmental | Open in IMG/M |
| 3300006925 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG | Environmental | Open in IMG/M |
| 3300006926 | Marine viral communities from the Subarctic Pacific Ocean - 18_ETSP_OMZAT15316 metaG | Environmental | Open in IMG/M |
| 3300006927 | Marine viral communities from the Subarctic Pacific Ocean - 2_ETSP_OMZ_AT15125 metaG | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300007963 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2) | Environmental | Open in IMG/M |
| 3300008050 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG | Environmental | Open in IMG/M |
| 3300008216 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_Geostar | Environmental | Open in IMG/M |
| 3300008217 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_215 | Environmental | Open in IMG/M |
| 3300008219 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_b05 | Environmental | Open in IMG/M |
| 3300008221 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_66 | Environmental | Open in IMG/M |
| 3300009104 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 2.7-0.2um | Environmental | Open in IMG/M |
| 3300009173 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 | Environmental | Open in IMG/M |
| 3300009409 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 | Environmental | Open in IMG/M |
| 3300009413 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s12 | Environmental | Open in IMG/M |
| 3300009425 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009577 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3750_2500 | Environmental | Open in IMG/M |
| 3300009604 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s16 | Environmental | Open in IMG/M |
| 3300009620 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_51 | Environmental | Open in IMG/M |
| 3300009786 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 | Environmental | Open in IMG/M |
| 3300009791 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3819_2500 | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300010155 | Marine viral communities from the Subarctic Pacific Ocean - 12_ETSP_OMZ_AT15267 metaG | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300017704 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_07 viral metaG | Environmental | Open in IMG/M |
| 3300017757 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22 | Environmental | Open in IMG/M |
| 3300017764 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11 | Environmental | Open in IMG/M |
| 3300020351 | Marine microbial communities from Tara Oceans - TARA_B100000676 (ERX555955-ERR599089) | Environmental | Open in IMG/M |
| 3300020395 | Marine microbial communities from Tara Oceans - TARA_B100000427 (ERX555987-ERR599133) | Environmental | Open in IMG/M |
| 3300020473 | Marine microbial communities from Tara Oceans - TARA_B100000700 (ERX555932-ERR598948) | Environmental | Open in IMG/M |
| 3300024052 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_5 | Environmental | Open in IMG/M |
| 3300025046 | Marine viral communities from the Pacific Ocean - LP-45 (SPAdes) | Environmental | Open in IMG/M |
| 3300025050 | Marine viral communities from the Pacific Ocean - LP-54 (SPAdes) | Environmental | Open in IMG/M |
| 3300025052 | Marine viral communities from the Pacific Ocean - LP-37 (SPAdes) | Environmental | Open in IMG/M |
| 3300025066 | Marine viral communities from the Subarctic Pacific Ocean - 15B_ETSP_OMZ_AT15312_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025072 | Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025078 | Marine viral communities from the Subarctic Pacific Ocean - 18_ETSP_OMZAT15316 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025082 | Marine viral communities from the Subarctic Pacific Ocean - 1_ETSP_OMZ_AT15124 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025083 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025084 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025085 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025097 | Marine viral communities from the Subarctic Pacific Ocean - 2_ETSP_OMZ_AT15125 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025098 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025103 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025112 | Marine viral communities from the Pacific Ocean - ETNP_2_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300025114 | Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025133 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025141 | Marine viral communities from the Pacific Ocean - ETNP_6_85 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025251 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_906 (SPAdes) | Environmental | Open in IMG/M |
| 3300025267 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_Geostar (SPAdes) | Environmental | Open in IMG/M |
| 3300025274 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_51 (SPAdes) | Environmental | Open in IMG/M |
| 3300025280 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s17 (SPAdes) | Environmental | Open in IMG/M |
| 3300025282 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9 (SPAdes) | Environmental | Open in IMG/M |
| 3300026115 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3827_250 (SPAdes) | Environmental | Open in IMG/M |
| 3300027838 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300027865 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_21 | Environmental | Open in IMG/M |
| 3300028022 | Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 750m | Environmental | Open in IMG/M |
| 3300029319 | Marine viral communities collected during Tara Oceans survey from station TARA_032 - TARA_A100001516 | Environmental | Open in IMG/M |
| 3300031801 | Marine microbial communities from Western Arctic Ocean, Canada - CB27_Tmax_986 | Environmental | Open in IMG/M |
| 3300032360 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 34915 | Environmental | Open in IMG/M |
| 3300034654 | Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 487_2244 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_100936101 | 3300000101 | Marine | IVSAMMVESIIIAFSIREDMFLTVALGALVIIGLRATKKVLND* |
| JGI24006J15134_100076452 | 3300001450 | Marine | MFIESIIIAFSIREDMFLPVALGALAIIGLRATKKVLND* |
| JGI25134J35505_100794482 | 3300002518 | Marine | MDKAIVSAMFVESIIIAFSVKEDMYFPVALGALVVIGLRATKKVLDD* |
| Ga0066222_11379747 | 3300004460 | Marine | MMIESIIIAFSIREDMFLTVALGALVIIGLRATKKVLND* |
| Ga0066616_11754981 | 3300004637 | Marine | MMIESIIIAFSIRDDMFLSVALGALVVIGLRATKKVMDD* |
| Ga0066849_100026017 | 3300005430 | Marine | MDKVIVSAMFILSVVIAFSIREDMHLQVSLVALVVIGLKATKKVLDD* |
| Ga0066849_100873434 | 3300005430 | Marine | MFVLSVIIAFSIKEDRHLPVSLGALVVIGLRATKKVIDD* |
| Ga0066866_101863043 | 3300005514 | Marine | MLDKAIVSAMFIESIIIACSVKEDMYLPVALGALVVIGLRATKKVLDD* |
| Ga0066850_101821494 | 3300005605 | Marine | AIVSAMMIESIIIAFSIREDMMLRVALGALVVIGLRATKKVLDD* |
| Ga0081592_10421604 | 3300006076 | Diffuse Hydrothermal Fluids | MLVESIIIAFSIREDMFLSVAIGALIVIGLRMTKKVLDG* |
| Ga0066836_107200682 | 3300006166 | Marine | MMIESIIIAFSIREDMMLRVALGALVVIGLRATKKVLDD* |
| Ga0098033_10244043 | 3300006736 | Marine | MLVESIIIAFSIREDMFLSVAMGALIVIGLRMTKKVLDG* |
| Ga0098033_11278482 | 3300006736 | Marine | MFVLSIIIAFSVREDMYLPVALAALVVIGLRATKKVLDD* |
| Ga0098035_12326762 | 3300006738 | Marine | MLDKAIVSAMFVESVIIAFSIKEDMMLQVALGALVVIGLKATKKVLDD* |
| Ga0098040_10210333 | 3300006751 | Marine | MFILSVVIAFSIREDMHLQVSLVALVVIGLKATKKVLDD* |
| Ga0098040_10525674 | 3300006751 | Marine | MLDKAIVSAMFIESVIIACSIREDMYLPVSLGALVVIGLRATKKVLDD* |
| Ga0098040_11826022 | 3300006751 | Marine | MMIESIIIAFSIRDDMFLSVAIGALVVIGLRATKKVLDD* |
| Ga0098040_11989032 | 3300006751 | Marine | MMIESIIIAFSIREDMYLTVALGALVVIGLRSTKKVLND* |
| Ga0098039_11532472 | 3300006753 | Marine | MFILSIIIAFSIKEDRHLPVSLGALVVIGLRATKKVIDD* |
| Ga0098044_10087178 | 3300006754 | Marine | MFVLSIIIAFSIREDMYLPVALAALVVIGLRATKKVLDD* |
| Ga0098055_12321341 | 3300006793 | Marine | IDKAIVSAMMIESIIIAFSIREDMFLTVALGALVIIGLRATKKVLND* |
| Ga0098053_10171533 | 3300006923 | Marine | MDKVIVSAMFILSVVIAFSIREDMHLQVSLVALVVIGLRATKKVIDD* |
| Ga0098050_10678544 | 3300006925 | Marine | ALFVLSIVIAFSIKDDMYLPVSLAALVVIGLRATKKVIDD* |
| Ga0098057_10431524 | 3300006926 | Marine | MFVLSIVIAFSIKEDMHLPVSLAALVVIGLRATKKVIDD* |
| Ga0098034_11387471 | 3300006927 | Marine | MLDKAIVSAMFVESVIIAFSIKEDMILQVALGALVVIGLKATKKVLDD*DICRI |
| Ga0098041_11394642 | 3300006928 | Marine | MMIESIIIAFSIREDMYLAVALGALVVIGLRSTKKVLND* |
| Ga0110931_11418862 | 3300007963 | Marine | MFVLSVVIAFSIREEKMLLVSLVALVVIGLRATKKVLDD* |
| Ga0098052_10118476 | 3300008050 | Marine | MFVLSIIITFNIKEDMYLPVALAALVVIGLKATKKVLDD* |
| Ga0098052_10427123 | 3300008050 | Marine | MMIESIIIAFSIRDDMFLSVAMGALVVIGLRATKKVLDD* |
| Ga0098052_11830882 | 3300008050 | Marine | MFILSILIAFSLKEDRHLPVSLGALVVIGLRATKKVIDD* |
| Ga0114898_10257764 | 3300008216 | Deep Ocean | MMVESIIIAFSIREDMFLSVAIGALIVIGLRATKKVLDG* |
| Ga0114899_10361153 | 3300008217 | Deep Ocean | MMIESIIIAFSIREDMFLAVAMGALVVIGLRATKKVLDD* |
| Ga0114899_11371722 | 3300008217 | Deep Ocean | MMIESIIIAFSIRDDMFLSVAIGALVVIGLRATKKVMDD* |
| Ga0114905_11813122 | 3300008219 | Deep Ocean | MMIESIIIAFSIRDGMFLSVALGALVVIGLRATKKVIDD* |
| Ga0114916_11396891 | 3300008221 | Deep Ocean | MMVESIIIAFSIKDDMYLTVALGALMIIGLKATKKVLDG* |
| Ga0117902_12351754 | 3300009104 | Marine | MFVLSIVIAFSIQEDMHLPVSLAALVVIGLRATKKVIDD* |
| Ga0114996_100544598 | 3300009173 | Marine | MMIESIIIAFSIRDDMFLTVALGALVVIGLRATKKVLND* |
| Ga0114996_104175632 | 3300009173 | Marine | MMIESIIIAFSIRDDMFLLVAMGALVVIGLRATKKVMDD* |
| Ga0114993_106465153 | 3300009409 | Marine | MMIESIIIAFSIRGDMFLLVAMGALVVIGLRATKKVLDD* |
| Ga0114993_107608791 | 3300009409 | Marine | SIIIAFSIRDDMFLTVALGALVVIGLRATKKVLND* |
| Ga0114902_11074221 | 3300009413 | Deep Ocean | SIIIAFSIKEDRHLPVSLGALVVIGLRATKKVIDD* |
| Ga0114997_100852353 | 3300009425 | Marine | MFIESIIIAFSIREDMFFPVALGALVVIGLRATKKVLDD* |
| Ga0114932_100737474 | 3300009481 | Deep Subsurface | MFVMSIIVAFSVKEDMYLPVSLGALVVIGLRATKKVLDD* |
| Ga0114932_108722742 | 3300009481 | Deep Subsurface | MLTKAIVSAMFIESIIIAFSIKEDMYLPVSLGALVVIGLRATKKVLDD* |
| Ga0105230_1128982 | 3300009577 | Marine Oceanic | MMIESIIIAFSIREDMFLLVAMGALVVIGLRATKKVLDD* |
| Ga0114901_10230022 | 3300009604 | Deep Ocean | MMIESIIIAFSIREDMFLEVAMGALVVIGLRATKKVLDD* |
| Ga0114901_10531731 | 3300009604 | Deep Ocean | DKAIVSAMMIESIIIAFSIREDMFLTVALGALVIIGLRATKKVLND* |
| Ga0114912_11052333 | 3300009620 | Deep Ocean | IVSAMMIESIIIAFSIRDDMFLSVAIGALVVIGLRATKKVLDD* |
| Ga0114999_102071597 | 3300009786 | Marine | KAIVSAMMIESIIIAFSIRDDMFLLVAMGALVVIGLRATKKVMDD* |
| Ga0105235_1332642 | 3300009791 | Marine Oceanic | MMIESIIIAFSIRDDMFLLVAMGALVVIGLRATKKVLDD* |
| Ga0098049_11972743 | 3300010149 | Marine | IESIIIAFSIREDMFLTVALGALVIIGLRATKKVLND* |
| Ga0098056_10144056 | 3300010150 | Marine | MFVLSIVIAFSVREDMYLPVSLAALVVIGLRATKKVIDD* |
| Ga0098059_13223123 | 3300010153 | Marine | IESIIIAFSIRDDMFLSVAIGALVVIGLRATKKVLYD* |
| Ga0098047_100218326 | 3300010155 | Marine | MMIESIIIAFSIREDMFLSVAIGALIVIGLRATKKVMDD* |
| Ga0133547_110743091 | 3300010883 | Marine | IVSAMMIESIIIAFSIRDDMFLTVALGALVVIGLRATKKVLND* |
| Ga0133547_114010773 | 3300010883 | Marine | MMIESIIIAFSIRDDMFLSVALGALVVIGLRATKKVLGD* |
| Ga0181371_10782041 | 3300017704 | Marine | DKAIVSAMFVESIIIAFSVKEDMYFPVALGALVVIGLRATKKVLDD |
| Ga0181420_10716374 | 3300017757 | Seawater | MDKVIVSAMFILSVVIAFSIREDMHLQVSLVALVVIGLKAT |
| Ga0181385_11435043 | 3300017764 | Seawater | MFVMSIIVAFSVKEDMYLPVALGALVVIGLRATKKVLDD |
| Ga0181385_11935783 | 3300017764 | Seawater | VSAMMIESIIIAFSIREDMMLRVALGALVVIGLRATKKVLDD |
| Ga0211601_10239956 | 3300020351 | Marine | DKAIVAAMFVLSMIIAFSLKEDRMLPVSLGALVVIGLRATKKVIDD |
| Ga0211705_102080282 | 3300020395 | Marine | MDSAIASAMFVESIIIAFSIREDMYFPVALGALVIIGLKATKKVLND |
| Ga0211625_1000020483 | 3300020473 | Marine | MFVLSMIIAFSLKEDRMLPVSLGALVVIGLRATKKVIDD |
| (restricted) Ga0255050_101252142 | 3300024052 | Seawater | MMIESIIIAFSIRDDMFLSVALGALVVIGLRATKKVIDD |
| Ga0207902_10494182 | 3300025046 | Marine | MMVESIIIAFSIREDMFLSVAIGALVVIGLRATKKVLDD |
| Ga0207892_10100602 | 3300025050 | Marine | MLVESIIIAFSIREDMFLSVAIGALIVIGLRMTKKVLDG |
| Ga0207906_10363532 | 3300025052 | Marine | MMIESIIIAFSIRDDMFLSVALGALVVIGLRATKKVLGD |
| Ga0207906_10533223 | 3300025052 | Marine | SAMMIESIIIAFSIRDDMFLSVALGALVVIGLKSTKKVLGD |
| Ga0208012_10154412 | 3300025066 | Marine | MFVLSVIIAFSIKEDRHLPVSLGALVVIGLRATKKVIDD |
| Ga0208012_10217211 | 3300025066 | Marine | MDKAIVSAMFVESIIIAFSVKEDMYFPVALGALVVI |
| Ga0208920_10365161 | 3300025072 | Marine | IASAMFVLSVVIAFSIREEKMLLVSLVALVVIGLRATKKVLDD |
| Ga0208668_10733813 | 3300025078 | Marine | MFVLSIVIAFSVREDMYLPVSLAALVVIGLRATKKVIDD |
| Ga0208156_10169363 | 3300025082 | Marine | MFVLSIVIAFSIKEDMHLPVSLAALVVIGLRATKKVIDD |
| Ga0208791_10285503 | 3300025083 | Marine | MDKAIVSAMFVESIIIAFSVKEDMYFPVALGALVVIGLRATKKVLDD |
| Ga0208298_10495143 | 3300025084 | Marine | MLDKAIVSAMFVESVIIAFSIKEDMMLQVALGALVVIGLKATKKVLDD |
| Ga0208792_10201233 | 3300025085 | Marine | MDKVIVSAMFILSVVIAFSIREDMHLQVSLVALVVIGLKATKKVLDD |
| Ga0208010_10695884 | 3300025097 | Marine | LDKAIASALFVLSIVIAFSVREDMYLPVSLAALVVIGLRATKKVIDD |
| Ga0208434_10164025 | 3300025098 | Marine | MMIESIIIAFSIREDMMLRVALGALVVIGLRATKKVLDD |
| Ga0208434_11077711 | 3300025098 | Marine | MLDKAIVSAMFIESIIIACSVKEDMYLPVALGALVVIGLRATKK |
| Ga0208013_10525972 | 3300025103 | Marine | MLDKAIVSAMFIESIIIACSVKEDMYLPVALGALVVIGLRATKKVLDD |
| Ga0209349_11212873 | 3300025112 | Marine | MMIESIIIAFSIREDMFLTVALGALVIIGLRATKKVLND |
| Ga0208433_10806912 | 3300025114 | Marine | MLVESIIIAFSIREDMFLSVAMGALIVIGLRMTKKVLDG |
| Ga0208299_10476132 | 3300025133 | Marine | MMIESIIIAFSIRDDMFLSVAIGALVVIGLRATKKVLDD |
| Ga0208299_11611283 | 3300025133 | Marine | MFILSILIAFSLKEDRHLPVSLGALVVIGLRATKKVIDD |
| Ga0209756_10267571 | 3300025141 | Marine | MDKAIVSAMFVESIIIAFSVKEDMYFPVALGALVVIGLR |
| Ga0209756_12537632 | 3300025141 | Marine | MFVLSVIIAFSLKEDRMLPVSLGALVVIGLRATKKVIDD |
| Ga0209337_100181610 | 3300025168 | Marine | MFIESIIIAFSIREDMFLSVAFGALVIIGLRATKKVLND |
| Ga0208182_10063857 | 3300025251 | Deep Ocean | MMIESIIIAFSIREDMFLAVAMGALVVIGLRATKKVLDD |
| Ga0208182_10072072 | 3300025251 | Deep Ocean | MMIESIIIAFSIRDGMFLSVALGALVVIGLRATKKVIDD |
| Ga0208179_10140371 | 3300025267 | Deep Ocean | AMMIESIIIAFSIREDMFLAVAMGALVVIGLRATKKVLDD |
| Ga0208179_11192711 | 3300025267 | Deep Ocean | MFILSIIIAFSIKEDRHLPVSLGALVVIGLRATKKVIDD |
| Ga0208183_10567082 | 3300025274 | Deep Ocean | MMVESIIIAFSIREDMFLSVAIGALIVIGLRATKKVLDG |
| Ga0208449_11410943 | 3300025280 | Deep Ocean | IVSAMMIESIIIAFSIRDDMFLSVAIGALVVIGLRATKKVLDD |
| Ga0208030_100195111 | 3300025282 | Deep Ocean | MMIESIIIAFSIREDMFLAVAMEALVVIGLRATKKVLDD |
| Ga0208560_10058094 | 3300026115 | Marine Oceanic | MMIESIIIAFSIREDMFLEVAMGALVVIGLRATKKVLDD |
| Ga0209089_102827431 | 3300027838 | Marine | AIVSAMFIESIIIAFSIRDDMFLSVALGALVVIGLRATKKVMDD |
| (restricted) Ga0255052_102969494 | 3300027865 | Seawater | KAIVSAMMIESIIIAFSIREDMFLTVALGALVIIGLRATKKVLND |
| Ga0256382_10050666 | 3300028022 | Seawater | MLTKAIVSAMFIESIIIAFSIKEDMYLPVSLGALVVIGLRATKKVLDD |
| Ga0183748_10215614 | 3300029319 | Marine | MLTKAIVSAMFIESIIIAFSIREDMYLPVSLGALVVIGLRATKKVLDD |
| Ga0310121_105485872 | 3300031801 | Marine | MMIESIIIAFSIRGDMFLLVAMGALVVIGLRATKKVLDD |
| Ga0315334_112713891 | 3300032360 | Seawater | DKAIVSAMMIESIIIAFSIRNDMFLSVALGALVVIGLKSTKKVLGD |
| Ga0326741_023526_58_174 | 3300034654 | Filtered Seawater | MIESIIIAFSIRDDMFLSVAIGALVVIGLRATKKVIDD |
| ⦗Top⦘ |