


| Basic Information | |
|---|---|
| Family ID | F101812 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 102 |
| Average Sequence Length | 43 residues |
| Representative Sequence | LSERVHLGKAGVAGFGLLGLLWGATRRVGRVFAAGHKPQDA |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 92.16 % |
| Associated GOLD sequencing projects | 96 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (66.667 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (25.490 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.412 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.157 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 47.83% β-sheet: 0.00% Coil/Unstructured: 52.17% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF00494 | SQS_PSY | 82.35 |
| PF01593 | Amino_oxidase | 7.84 |
| PF13450 | NAD_binding_8 | 4.90 |
| PF13249 | SQHop_cyclase_N | 3.92 |
| PF00535 | Glycos_transf_2 | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG1562 | Phytoene/squalene synthetase | Lipid transport and metabolism [I] | 82.35 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 66.67 % |
| All Organisms | root | All Organisms | 33.33 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000955|JGI1027J12803_106854010 | Not Available | 1338 | Open in IMG/M |
| 3300002917|JGI25616J43925_10109284 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1135 | Open in IMG/M |
| 3300004156|Ga0062589_102015942 | Not Available | 586 | Open in IMG/M |
| 3300004281|Ga0066397_10106133 | Not Available | 595 | Open in IMG/M |
| 3300004479|Ga0062595_101042828 | Not Available | 708 | Open in IMG/M |
| 3300005529|Ga0070741_11182762 | Not Available | 646 | Open in IMG/M |
| 3300005530|Ga0070679_101085851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 745 | Open in IMG/M |
| 3300005558|Ga0066698_10235072 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1261 | Open in IMG/M |
| 3300005568|Ga0066703_10907726 | Not Available | 502 | Open in IMG/M |
| 3300005617|Ga0068859_103102975 | Not Available | 506 | Open in IMG/M |
| 3300006038|Ga0075365_10787047 | Not Available | 671 | Open in IMG/M |
| 3300006038|Ga0075365_11346545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 501 | Open in IMG/M |
| 3300006046|Ga0066652_101627625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 592 | Open in IMG/M |
| 3300006047|Ga0075024_100760779 | Not Available | 538 | Open in IMG/M |
| 3300006172|Ga0075018_10040623 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1898 | Open in IMG/M |
| 3300006852|Ga0075433_10742488 | Not Available | 859 | Open in IMG/M |
| 3300006853|Ga0075420_100352910 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1273 | Open in IMG/M |
| 3300006904|Ga0075424_100219958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2018 | Open in IMG/M |
| 3300009090|Ga0099827_11921855 | Not Available | 515 | Open in IMG/M |
| 3300009156|Ga0111538_10614244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1379 | Open in IMG/M |
| 3300010047|Ga0126382_11267083 | Not Available | 664 | Open in IMG/M |
| 3300010361|Ga0126378_10488418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1346 | Open in IMG/M |
| 3300010361|Ga0126378_12959480 | Not Available | 542 | Open in IMG/M |
| 3300010366|Ga0126379_12655173 | Not Available | 598 | Open in IMG/M |
| 3300010400|Ga0134122_10486776 | Not Available | 1113 | Open in IMG/M |
| 3300010880|Ga0126350_10810658 | Not Available | 535 | Open in IMG/M |
| 3300011418|Ga0153954_1001720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 10791 | Open in IMG/M |
| 3300012203|Ga0137399_11148143 | Not Available | 654 | Open in IMG/M |
| 3300012208|Ga0137376_10540600 | Not Available | 1010 | Open in IMG/M |
| 3300012930|Ga0137407_11610627 | Not Available | 618 | Open in IMG/M |
| 3300012948|Ga0126375_10425102 | Not Available | 968 | Open in IMG/M |
| 3300012971|Ga0126369_10253120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1734 | Open in IMG/M |
| 3300012984|Ga0164309_10674061 | Not Available | 817 | Open in IMG/M |
| 3300012986|Ga0164304_11079996 | Not Available | 641 | Open in IMG/M |
| 3300013306|Ga0163162_13375104 | Not Available | 510 | Open in IMG/M |
| 3300015372|Ga0132256_103140826 | Not Available | 555 | Open in IMG/M |
| 3300016270|Ga0182036_10180229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1531 | Open in IMG/M |
| 3300016294|Ga0182041_12006540 | Not Available | 539 | Open in IMG/M |
| 3300016387|Ga0182040_11272426 | Not Available | 620 | Open in IMG/M |
| 3300016422|Ga0182039_10045326 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2954 | Open in IMG/M |
| 3300018081|Ga0184625_10084246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1629 | Open in IMG/M |
| 3300018081|Ga0184625_10271422 | Not Available | 888 | Open in IMG/M |
| 3300018468|Ga0066662_10782245 | Not Available | 923 | Open in IMG/M |
| 3300019361|Ga0173482_10057217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1290 | Open in IMG/M |
| 3300019889|Ga0193743_1047453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1889 | Open in IMG/M |
| 3300020000|Ga0193692_1050880 | Not Available | 940 | Open in IMG/M |
| 3300021344|Ga0193719_10016444 | Not Available | 3135 | Open in IMG/M |
| 3300025925|Ga0207650_10162756 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1769 | Open in IMG/M |
| 3300025928|Ga0207700_10412941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1184 | Open in IMG/M |
| 3300025944|Ga0207661_11872876 | Not Available | 545 | Open in IMG/M |
| 3300026326|Ga0209801_1372793 | Not Available | 503 | Open in IMG/M |
| 3300026334|Ga0209377_1054178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1780 | Open in IMG/M |
| 3300026360|Ga0257173_1059427 | Not Available | 552 | Open in IMG/M |
| 3300026514|Ga0257168_1146956 | Not Available | 525 | Open in IMG/M |
| 3300026555|Ga0179593_1017163 | Not Available | 2828 | Open in IMG/M |
| 3300027546|Ga0208984_1048535 | Not Available | 904 | Open in IMG/M |
| 3300027646|Ga0209466_1124899 | Not Available | 523 | Open in IMG/M |
| 3300027654|Ga0209799_1073922 | Not Available | 767 | Open in IMG/M |
| 3300027703|Ga0207862_1114305 | Not Available | 811 | Open in IMG/M |
| 3300027812|Ga0209656_10458291 | Not Available | 563 | Open in IMG/M |
| 3300027824|Ga0209040_10202046 | Not Available | 1030 | Open in IMG/M |
| 3300027873|Ga0209814_10371152 | Not Available | 627 | Open in IMG/M |
| 3300027880|Ga0209481_10174262 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 1068 | Open in IMG/M |
| 3300027907|Ga0207428_10760423 | Not Available | 690 | Open in IMG/M |
| 3300028778|Ga0307288_10447168 | Not Available | 530 | Open in IMG/M |
| 3300028790|Ga0307283_10021455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1365 | Open in IMG/M |
| 3300028791|Ga0307290_10159058 | Not Available | 827 | Open in IMG/M |
| 3300028802|Ga0307503_10025976 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1998 | Open in IMG/M |
| 3300028802|Ga0307503_10831275 | Not Available | 529 | Open in IMG/M |
| 3300028807|Ga0307305_10179021 | Not Available | 977 | Open in IMG/M |
| 3300031543|Ga0318516_10590320 | Not Available | 634 | Open in IMG/M |
| 3300031544|Ga0318534_10196908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1163 | Open in IMG/M |
| 3300031545|Ga0318541_10760872 | Not Available | 540 | Open in IMG/M |
| 3300031561|Ga0318528_10284404 | Not Available | 887 | Open in IMG/M |
| 3300031572|Ga0318515_10159565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1203 | Open in IMG/M |
| 3300031573|Ga0310915_10057526 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2530 | Open in IMG/M |
| 3300031682|Ga0318560_10310906 | Not Available | 849 | Open in IMG/M |
| 3300031713|Ga0318496_10144054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1298 | Open in IMG/M |
| 3300031719|Ga0306917_10085367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2228 | Open in IMG/M |
| 3300031723|Ga0318493_10509590 | Not Available | 665 | Open in IMG/M |
| 3300031747|Ga0318502_10449311 | Not Available | 769 | Open in IMG/M |
| 3300031751|Ga0318494_10202354 | Not Available | 1131 | Open in IMG/M |
| 3300031764|Ga0318535_10511179 | Not Available | 533 | Open in IMG/M |
| 3300031765|Ga0318554_10754212 | Not Available | 545 | Open in IMG/M |
| 3300031795|Ga0318557_10049533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1762 | Open in IMG/M |
| 3300031796|Ga0318576_10216180 | Not Available | 902 | Open in IMG/M |
| 3300031798|Ga0318523_10233868 | Not Available | 918 | Open in IMG/M |
| 3300031897|Ga0318520_10205618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1162 | Open in IMG/M |
| 3300032039|Ga0318559_10012051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3122 | Open in IMG/M |
| 3300032039|Ga0318559_10192820 | Not Available | 935 | Open in IMG/M |
| 3300032044|Ga0318558_10393052 | Not Available | 690 | Open in IMG/M |
| 3300032055|Ga0318575_10728161 | Not Available | 501 | Open in IMG/M |
| 3300032066|Ga0318514_10194138 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1062 | Open in IMG/M |
| 3300032090|Ga0318518_10451128 | Not Available | 659 | Open in IMG/M |
| 3300032094|Ga0318540_10312438 | Not Available | 758 | Open in IMG/M |
| 3300032163|Ga0315281_11344965 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 706 | Open in IMG/M |
| 3300032174|Ga0307470_11759094 | Not Available | 523 | Open in IMG/M |
| 3300032205|Ga0307472_100346115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1218 | Open in IMG/M |
| 3300032261|Ga0306920_101991277 | Not Available | 814 | Open in IMG/M |
| 3300032397|Ga0315287_12114777 | Not Available | 617 | Open in IMG/M |
| 3300032893|Ga0335069_12574072 | Not Available | 525 | Open in IMG/M |
| 3300034819|Ga0373958_0108771 | Not Available | 658 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 25.49% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 11.76% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.86% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.88% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.90% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.92% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.96% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.96% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.96% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.96% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.96% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.96% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.96% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 1.96% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.98% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.98% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.98% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.98% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.98% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.98% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.98% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004281 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011418 | Attine ant fungus gardens microbial communities from Florida, USA - TSFL038 MetaG | Host-Associated | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019889 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c2 | Environmental | Open in IMG/M |
| 3300020000 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a1 | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026360 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-B | Environmental | Open in IMG/M |
| 3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300027546 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
| 3300028790 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_122 | Environmental | Open in IMG/M |
| 3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J12803_1068540104 | 3300000955 | Soil | RERVHLGKAGVAGIAILGLISGLIHRAGRVLAPGRKPLDA* |
| JGI25616J43925_101092841 | 3300002917 | Grasslands Soil | DPLSERVHLGKAGVAGFGVLGLLWGATRRVGRAFAAGHTTQDA* |
| Ga0062589_1020159422 | 3300004156 | Soil | SERVHLGKAGVAGFGLLGLLWGATRRVGRVLAAGRKPQDA* |
| Ga0066397_101061332 | 3300004281 | Tropical Forest Soil | ERVHLGKAGVAGFGLLGLLWGATRRVGRVFAAGHKPQDA* |
| Ga0062595_1010428282 | 3300004479 | Soil | QTFAERLVAVLTRRDPLSQHVHLGKAGVAGFGLLGLLWGATRRVGRVFAVGHKPQDA* |
| Ga0070741_111827622 | 3300005529 | Surface Soil | CERVHLGKAGFTGLGLVGLLWGAACRVGRVFAATPKPQGT* |
| Ga0070679_1010858512 | 3300005530 | Corn Rhizosphere | RRDPLSERVHLGKAGVAGFGLLGLLWGATRRVGRVLAAGRKPQDA* |
| Ga0066698_102350723 | 3300005558 | Soil | VRLLSRRDPLSERVHLGKAGVAGFGMLGLLWGATRRVGRAFAAGHTTQDA* |
| Ga0066703_109077261 | 3300005568 | Soil | HLGKAGVAGFGMLGLLWGATRRVGRAFAAGHTTQDA* |
| Ga0068859_1031029752 | 3300005617 | Switchgrass Rhizosphere | SERVHLGKAGVAGFGLLGLLWGATRRVGRVLAAGHKPQDA* |
| Ga0075365_107870472 | 3300006038 | Populus Endosphere | QRVHLGKAGVAGFGLVGLIWGATRRAGRLLAAGHRPQDA* |
| Ga0075365_113465451 | 3300006038 | Populus Endosphere | TRRDPLSERVHLGKAGVAGFGLLGLLWGATRRVGRVLAAGHKPQDA* |
| Ga0066652_1016276251 | 3300006046 | Soil | TFAERLVGVLSRRDPLSQRVHLGKAGVVGFGLLGLLWGASRRVGRRFAAGHKPQDP* |
| Ga0075024_1007607791 | 3300006047 | Watersheds | SKAAVAGLGLVGLIWGATGRIGRAFAATPKPQGT* |
| Ga0075018_100406231 | 3300006172 | Watersheds | ERVHLGKAGVAGFGVLGLLWGATRRVGRAFTAGHTTQDA* |
| Ga0075433_107424881 | 3300006852 | Populus Rhizosphere | SERVHLGKAGVAGFGVLGLLWGATRRVGRVFAAGQKTQDA* |
| Ga0075420_1003529103 | 3300006853 | Populus Rhizosphere | RLAAVLARRDPLSQRVHLGKAGVAGFGLVGLIWGATRRAGRLLAAGHRPQDA* |
| Ga0075424_1002199583 | 3300006904 | Populus Rhizosphere | LGKAGVAGFGLLGLLWGTTRRVGRVFAVGHKPQDA* |
| Ga0099827_119218551 | 3300009090 | Vadose Zone Soil | RDPLSERVHLGKAGVAGFGLLGLLWGATRRVGRVRAAGRKPQDA* |
| Ga0111538_106142441 | 3300009156 | Populus Rhizosphere | LSERVHLGKAGTAGLGLVGLIRGATSRVGRVFSATPKPQGT* |
| Ga0126382_112670832 | 3300010047 | Tropical Forest Soil | QRDPLSERVHLGKAGVAGFGVLGLLWGATRRVGRVFAPGHKPQDA* |
| Ga0126378_104884183 | 3300010361 | Tropical Forest Soil | SRRDPLSERVHLGKAGVAGFGLLGLLWGATRRVGRVRAAGRKP* |
| Ga0126378_129594802 | 3300010361 | Tropical Forest Soil | SRRDPLSERVHLGKAGVAGFGLLGLLWGATRRVGRVRAAGHKPQDA* |
| Ga0126379_126551732 | 3300010366 | Tropical Forest Soil | DPLSERVHLGKAGVAGFGVLGLLWGATRRVGRVFAPGHKPQDA* |
| Ga0134122_104867763 | 3300010400 | Terrestrial Soil | LSERVHLGKAGVAGFGLLGLLWGATRRVGRVLAAGHKPQDA* |
| Ga0126350_108106581 | 3300010880 | Boreal Forest Soil | VHLGKAGVAALGLLGVVKGAANRVGRAFAGAHKPQDA* |
| Ga0153954_10017208 | 3300011418 | Attine Ant Fungus Gardens | AERLVDLLSRRDPLSERVHLDKAAVAGFGLLGLGWGATHRVGRIFTVDHKPQDA* |
| Ga0137399_111481431 | 3300012203 | Vadose Zone Soil | HLGKAGVAGFGVLGLLWGATRRVGRAFAAGHTTQDA* |
| Ga0137376_105406001 | 3300012208 | Vadose Zone Soil | RVHLGKAGVAGFGVLGLLLGATRRVGRVFAAGQKTQDA* |
| Ga0137407_116106271 | 3300012930 | Vadose Zone Soil | PLSQRVHLGKAGVASFGLLGLISGAIRRVGRVLPAGHKPQDA* |
| Ga0126375_104251022 | 3300012948 | Tropical Forest Soil | RDPLSERVHLRKAGVAGVAMMGLLNGVLGRVGRAFTASQKPRNA* |
| Ga0126369_102531203 | 3300012971 | Tropical Forest Soil | LGKAGVAGFGILGLLWGASRRVGRVFAAGHRPQDA* |
| Ga0164309_106740611 | 3300012984 | Soil | QTFAERLVAVLTRRDPLSQHVHLGKAGVAGFGLLGLLWGATRRVGRLFAVGHKPQDA* |
| Ga0164304_110799961 | 3300012986 | Soil | LVRLLAQRDPLSERVHLGKAGVEGFGVLGLLWGATRRVGRLFAAGQKTQDA* |
| Ga0163162_133751041 | 3300013306 | Switchgrass Rhizosphere | RDPLSERVHLGKAGVAGFGLLGLLWGATRRVGRVLAAGHKPQDA* |
| Ga0132256_1031408262 | 3300015372 | Arabidopsis Rhizosphere | DPLSERVHLGKAGVAGFGVLGLLWGATRRVGRVFAAGQKTQDA* |
| Ga0182036_101802293 | 3300016270 | Soil | RLLTQRDPLSERVHLGKAGVAGFGVLGLLWGATRRVGRVFAPGHKPQDA |
| Ga0182041_120065402 | 3300016294 | Soil | VHLGKAGVAGFGVLGLLWGATRRVGRVFAAGQKTQDA |
| Ga0182040_112724261 | 3300016387 | Soil | VHLGKAGVAGFGVLGLLWGATRRVGRVFAPGRKPQDA |
| Ga0182039_100453264 | 3300016422 | Soil | CARVHLGAAGVAGFGLLGVVSAAIGRAGRLFSGGP |
| Ga0184625_100842461 | 3300018081 | Groundwater Sediment | FAERLVALLKPRDPLSQRVHLGKAGVAGFGVLGLLWGATRRVGRVFAVGHKPQDA |
| Ga0184625_102714222 | 3300018081 | Groundwater Sediment | PLSERVHLGKAGVAGFGLLGLLWGATRRVGRVLAAGHKPQDA |
| Ga0066662_107822451 | 3300018468 | Grasslands Soil | LSRRDQLSERVHLGKAGVAGFGIVGLLWGAGRRVGRVFAAGPRPQDA |
| Ga0173482_100572171 | 3300019361 | Soil | VAVLTRRDPLSQHVHLGKAGVAGFGLLGLLWGATRRVGRVFAVGHKPQDA |
| Ga0193743_10474531 | 3300019889 | Soil | CRDPLSERVHLGKAGVAGFGLLGLLWGATRRVGRVLAAGHKPQDA |
| Ga0193692_10508802 | 3300020000 | Soil | HRDPLSQRVHLGKAGVAGFGVLGLLWGATRRVGRVFAVGHKPQDA |
| Ga0193719_100164441 | 3300021344 | Soil | KHRDPLSQRVHLGKAGVAGFGVLGLLWGATRRVGRVFAVGHKPQDA |
| Ga0207650_101627563 | 3300025925 | Switchgrass Rhizosphere | RVHLGKAGVAGFGLLGLLWGATRRVGRVLAAGHKPQDA |
| Ga0207700_104129413 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | RVHLGKAGVAGFGVLGLLWGATRRVGRVFAPGHKPQDA |
| Ga0207661_118728761 | 3300025944 | Corn Rhizosphere | RDPLSQHVHLGKAGVAGFGLLGLLWGTTRRVGRVFAVGHKPQDA |
| Ga0209801_13727931 | 3300026326 | Soil | LLSRHDPLSERVHLGKAGVAGFGMLGLLWGATRRVGRAFAAGHTTQDA |
| Ga0209377_10541783 | 3300026334 | Soil | LLAQRDPLSERVHLGKAGVAGFGVLGLLWGATRRVGRVFAPGHKPQDA |
| Ga0257173_10594272 | 3300026360 | Soil | SRRDPLSERVHLGKAGVAGFGVLGLLWGATRRVGRAFAAGHTTQDA |
| Ga0257168_11469562 | 3300026514 | Soil | SERVHLGKAGVAGFGVLGLLWGAIRRVGRVFAAGQKTQDA |
| Ga0179593_10171631 | 3300026555 | Vadose Zone Soil | LNERVHLGKAGVAGFGVLGLLWGATRRVGRAFAAGHTTQDA |
| Ga0208984_10485351 | 3300027546 | Forest Soil | GRRDPLSERVHLGKAGVAGFGLLGLLWGASRRVGRVFAAGHKPQDA |
| Ga0209466_11248992 | 3300027646 | Tropical Forest Soil | LSERVHLGKAGVAGFGLLGLLWGATRRVGRVFAAGHKPQDA |
| Ga0209799_10739222 | 3300027654 | Tropical Forest Soil | PLSERVHLGKAGVAGFGVLGLLWGATRRVGRVFAPGHKPQDA |
| Ga0207862_11143052 | 3300027703 | Tropical Forest Soil | DPLCARVHLGKAGVAGFGVLGVLSGAIRRAGRLFPAGHEA |
| Ga0209656_104582911 | 3300027812 | Bog Forest Soil | LVGLLSRRDPLRERVHLGKAGVAGFGVLGLLSGAIRRVGRLLPAGHKPQDA |
| Ga0209040_102020463 | 3300027824 | Bog Forest Soil | LGKAGVAGFGVLGLLSGAIRRVGRLLPAGHKPQDA |
| Ga0209814_103711522 | 3300027873 | Populus Rhizosphere | VLARRDPLSQRVHLGKAGVAGFGLVGLIWGATRRAGRLLAAGHRPQDA |
| Ga0209481_101742623 | 3300027880 | Populus Rhizosphere | PLSERVHLGKAGVAGFGLVGLLWGASRRVGRIFAASHKPQDA |
| Ga0207428_107604232 | 3300027907 | Populus Rhizosphere | VRLLSRRDPLSERVHLGKAGVAGFGILGLLWGASRRVGRVFTAGHRPQDA |
| Ga0307288_104471681 | 3300028778 | Soil | PLSERVHLGKAGVAGFGILGLLWGASRRVGRVFTAGHRPQDA |
| Ga0307283_100214553 | 3300028790 | Soil | LLKHRDPLSQRVHLGKAGVAGFGVLGLLWGATRRVGRVFAVGHKPQDA |
| Ga0307290_101590582 | 3300028791 | Soil | LSQRVHLGKAGVAGFGVLGLLWGATRRVGRVFAVGHKPQDA |
| Ga0307503_100259761 | 3300028802 | Soil | LSERVHLGKAGVAGFGLLGLLWGATRRVGRVLAAGRKPQDA |
| Ga0307503_108312751 | 3300028802 | Soil | ERLTGLLSRRDPLSQCVHLGKAGVAGFGLLGLLWGATRRVGRVFAAGHKPQDA |
| Ga0307305_101790211 | 3300028807 | Soil | LGKAGVAGFGLLGLLWGASRRVGRVFAAGHKPQDA |
| Ga0318516_105903201 | 3300031543 | Soil | ERVHLGKAGVAGFGVLGLLWGATRRVGRVFAPGRKPQDA |
| Ga0318534_101969083 | 3300031544 | Soil | SERVHLGKAGVAGFGVLGLLWGATRRVGRVFAPGRKPQDA |
| Ga0318541_107608722 | 3300031545 | Soil | AQRDPLSERVHLGKAGVAGFGVLGLLWGATRRVGRVFAPGRKPQDA |
| Ga0318528_102844042 | 3300031561 | Soil | RVHLGKAGVAGFGVLGLLWGATRRVGRVFAAGQKTQDA |
| Ga0318515_101595651 | 3300031572 | Soil | LLAQRDPLSERVHLGKAGVAGFGVLSLLWGATRRVGRVFAPGRKPQDA |
| Ga0310915_100575264 | 3300031573 | Soil | QRDPLSERVHLGKAGVAGFGVLGLLWGATRRVGRVFAAGQKTQDA |
| Ga0318560_103109061 | 3300031682 | Soil | LGKAGVAGFGVLGLLWGATRRVGRVFAAGQKTQDA |
| Ga0318496_101440541 | 3300031713 | Soil | QRDPLSERVHLGKAGVAGFGVLGLLWGATRRVGRVFAPGRKPQDA |
| Ga0306917_100853671 | 3300031719 | Soil | PLSERVHLGKAGVAGFGVLGLLWGATRRVGRVFAAGQKTQDA |
| Ga0318493_105095901 | 3300031723 | Soil | VHLDKAGVAGFGVLGLLWGATRRVGRVFAAGQKTQDA |
| Ga0318502_104493111 | 3300031747 | Soil | PLSERVHLGKAGVAGFGVLGLLWGATRRVGRVFAPGRKPQDA |
| Ga0318494_102023541 | 3300031751 | Soil | IGLLRSRDPLSQRVHLGTAGVAGFGLLGLISGVTRRIGRVFAAGHEPQDA |
| Ga0318535_105111791 | 3300031764 | Soil | RVHLGKAGVAGFGVLGLLWGATRRVGRVFAPGRKPQDA |
| Ga0318554_107542121 | 3300031765 | Soil | LARRDPLCERVHLGKAGVAGFGLLGLLWGASRRVGRVFAVGHKPQDA |
| Ga0318557_100495331 | 3300031795 | Soil | HLGKAGVAGFGVHGLLWGATRRVGRVFAAGQKTQDA |
| Ga0318576_102161802 | 3300031796 | Soil | RRDPLSERVHLDKAGVAGFGVLGLFWGATRRVGRVFAAGQKTQDA |
| Ga0318523_102338682 | 3300031798 | Soil | VRLLTQRDPLSERVHLGKAGVAGFGVLGLLWGATRRVGRVFAAGQKTQDA |
| Ga0318520_102056183 | 3300031897 | Soil | HLGTAGVAGFGLLGLISGVTRRIGRVFAAGHEPQDA |
| Ga0318559_100120511 | 3300032039 | Soil | VRLLAQRDPLSERVHLGKAGVAGFGVLGRLWGATRRVGRVFAPGRKPQDA |
| Ga0318559_101928201 | 3300032039 | Soil | LVRLLTRRDPLSERVHLDKAGVAGFGVLGLFWGATRRVGRVFAAGQKTQDA |
| Ga0318558_103930522 | 3300032044 | Soil | QRVHLGTAGVAGFGLLGLISGVTRRIGRVFAAGHEPQDA |
| Ga0318575_107281611 | 3300032055 | Soil | DPLSERVHLGKLGVAGFGLAGLLSGAFRRLGRRIAPAGRKPQDA |
| Ga0318514_101941381 | 3300032066 | Soil | HLGKAGVAGFGVLGLLWGATRRVGRVFAPGRKPQDA |
| Ga0318518_104511282 | 3300032090 | Soil | LLGRRDPLSERVHLGKAGVASFGLLGLLSGAFRRVGRLLPTGHKPQDA |
| Ga0318540_103124382 | 3300032094 | Soil | HLGKAGVAGFGVLGLLWGATRRVGRVFAAGQKTQDA |
| Ga0315281_113449652 | 3300032163 | Sediment | MQTLAERLVALLRRRDPLCERVHFGKAGVAGYGLLGLLWGAIRRVGRVPAGREPQGA |
| Ga0307470_117590941 | 3300032174 | Hardwood Forest Soil | VHLGKAGVAGFGLLGLLWGATRRVGRVFAAGHKPQDA |
| Ga0307472_1003461151 | 3300032205 | Hardwood Forest Soil | RRDPLSQRVHLGKVGVAGFGLLGLLWGATRRVGRLFAAGHKPQDA |
| Ga0306920_1019912771 | 3300032261 | Soil | ALLGRRDPLSERVHLGKAGVASFGLLGLLSGAFRRVGRLLPTGHKPQDA |
| Ga0315287_121147771 | 3300032397 | Sediment | SMLQHRDPLSERVHLGKAGTAGLGLVGLIRGGISRIGRIVSPAPKPQGT |
| Ga0335069_125740722 | 3300032893 | Soil | DPLCERVHLGKAGAAGLGLVGLIWGATCRVGRAFAATPRPQGT |
| Ga0373958_0108771_3_113 | 3300034819 | Rhizosphere Soil | HLGKAGVAGFGLLGLLWGATRRVGRVLAAGHKPQDA |
| ⦗Top⦘ |