


| Basic Information | |
|---|---|
| Family ID | F101799 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 102 |
| Average Sequence Length | 40 residues |
| Representative Sequence | AMREAVAAVRAGRVCVVDVRVAPGYSAGATAAIMQRTPG |
| Number of Associated Samples | 77 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 11.76 % |
| % of genes near scaffold ends (potentially truncated) | 82.35 % |
| % of genes from short scaffolds (< 2000 bps) | 90.20 % |
| Associated GOLD sequencing projects | 72 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (50.980 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (43.137 % of family members) |
| Environment Ontology (ENVO) | Unclassified (56.863 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.843 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.87% β-sheet: 0.00% Coil/Unstructured: 73.13% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF00083 | Sugar_tr | 11.76 |
| PF07690 | MFS_1 | 9.80 |
| PF02582 | DUF155 | 8.82 |
| PF02668 | TauD | 4.90 |
| PF02775 | TPP_enzyme_C | 2.94 |
| PF00072 | Response_reg | 1.96 |
| PF03824 | NicO | 0.98 |
| PF05711 | TylF | 0.98 |
| PF12910 | PHD_like | 0.98 |
| PF01070 | FMN_dh | 0.98 |
| PF00528 | BPD_transp_1 | 0.98 |
| PF11737 | DUF3300 | 0.98 |
| PF00005 | ABC_tran | 0.98 |
| PF01850 | PIN | 0.98 |
| PF00067 | p450 | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG1723 | Mitochondrial translation protein, Rmd1/RMND1/DUF155 family | Translation, ribosomal structure and biogenesis [J] | 8.82 |
| COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 4.90 |
| COG2124 | Cytochrome P450 | Defense mechanisms [V] | 0.98 |
| COG0069 | Glutamate synthase domain 2 | Amino acid transport and metabolism [E] | 0.98 |
| COG1304 | FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase | Energy production and conversion [C] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 50.98 % |
| Unclassified | root | N/A | 49.02 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005363|Ga0008090_14841970 | Not Available | 605 | Open in IMG/M |
| 3300005518|Ga0070699_100973226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 778 | Open in IMG/M |
| 3300005554|Ga0066661_10660283 | Not Available | 616 | Open in IMG/M |
| 3300005591|Ga0070761_10478637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 766 | Open in IMG/M |
| 3300005764|Ga0066903_102848200 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 938 | Open in IMG/M |
| 3300005764|Ga0066903_103339406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 867 | Open in IMG/M |
| 3300005764|Ga0066903_103946220 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 796 | Open in IMG/M |
| 3300005764|Ga0066903_105688029 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 656 | Open in IMG/M |
| 3300005764|Ga0066903_108143471 | Not Available | 537 | Open in IMG/M |
| 3300006172|Ga0075018_10430625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 676 | Open in IMG/M |
| 3300006755|Ga0079222_10998296 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 719 | Open in IMG/M |
| 3300006800|Ga0066660_10667049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 860 | Open in IMG/M |
| 3300010046|Ga0126384_10246740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1441 | Open in IMG/M |
| 3300010048|Ga0126373_10864705 | Not Available | 968 | Open in IMG/M |
| 3300010048|Ga0126373_12412322 | Not Available | 586 | Open in IMG/M |
| 3300010154|Ga0127503_10142372 | Not Available | 526 | Open in IMG/M |
| 3300010360|Ga0126372_10260319 | All Organisms → cellular organisms → Bacteria | 1496 | Open in IMG/M |
| 3300010360|Ga0126372_10516975 | Not Available | 1125 | Open in IMG/M |
| 3300010361|Ga0126378_13088189 | Not Available | 530 | Open in IMG/M |
| 3300010376|Ga0126381_104866257 | Not Available | 516 | Open in IMG/M |
| 3300010398|Ga0126383_10190846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1957 | Open in IMG/M |
| 3300012212|Ga0150985_105390163 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3404 | Open in IMG/M |
| 3300012469|Ga0150984_105163526 | Not Available | 642 | Open in IMG/M |
| 3300012582|Ga0137358_10681407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 688 | Open in IMG/M |
| 3300012971|Ga0126369_10168679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2078 | Open in IMG/M |
| 3300016270|Ga0182036_10535322 | Not Available | 932 | Open in IMG/M |
| 3300016270|Ga0182036_11007859 | Not Available | 687 | Open in IMG/M |
| 3300016294|Ga0182041_11639633 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 594 | Open in IMG/M |
| 3300016319|Ga0182033_10605105 | All Organisms → cellular organisms → Bacteria | 952 | Open in IMG/M |
| 3300016357|Ga0182032_10380539 | Not Available | 1137 | Open in IMG/M |
| 3300016357|Ga0182032_10866571 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 766 | Open in IMG/M |
| 3300016371|Ga0182034_11789266 | Not Available | 541 | Open in IMG/M |
| 3300016422|Ga0182039_10934754 | Not Available | 775 | Open in IMG/M |
| 3300016422|Ga0182039_11439389 | Not Available | 626 | Open in IMG/M |
| 3300017822|Ga0187802_10293331 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 633 | Open in IMG/M |
| 3300017975|Ga0187782_10970188 | Not Available | 660 | Open in IMG/M |
| 3300020580|Ga0210403_10130280 | All Organisms → cellular organisms → Bacteria | 2051 | Open in IMG/M |
| 3300020583|Ga0210401_10806970 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300020583|Ga0210401_10969477 | Not Available | 709 | Open in IMG/M |
| 3300021401|Ga0210393_10643513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 865 | Open in IMG/M |
| 3300021401|Ga0210393_10683295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 837 | Open in IMG/M |
| 3300021433|Ga0210391_11442007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 529 | Open in IMG/M |
| 3300021560|Ga0126371_10387004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1538 | Open in IMG/M |
| 3300021560|Ga0126371_13719230 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300022527|Ga0242664_1143727 | Not Available | 522 | Open in IMG/M |
| 3300022720|Ga0242672_1045726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 720 | Open in IMG/M |
| 3300022726|Ga0242654_10290970 | Not Available | 598 | Open in IMG/M |
| 3300025898|Ga0207692_10736628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 642 | Open in IMG/M |
| 3300027610|Ga0209528_1089233 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 682 | Open in IMG/M |
| 3300027701|Ga0209447_10194524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 555 | Open in IMG/M |
| 3300027812|Ga0209656_10008833 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 6398 | Open in IMG/M |
| 3300027855|Ga0209693_10074631 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1673 | Open in IMG/M |
| 3300031231|Ga0170824_124896350 | Not Available | 610 | Open in IMG/M |
| 3300031545|Ga0318541_10039823 | All Organisms → cellular organisms → Bacteria | 2373 | Open in IMG/M |
| 3300031545|Ga0318541_10328793 | Not Available | 853 | Open in IMG/M |
| 3300031546|Ga0318538_10188178 | Not Available | 1100 | Open in IMG/M |
| 3300031546|Ga0318538_10530607 | Not Available | 638 | Open in IMG/M |
| 3300031573|Ga0310915_10041549 | All Organisms → cellular organisms → Bacteria | 2930 | Open in IMG/M |
| 3300031573|Ga0310915_10745390 | Not Available | 690 | Open in IMG/M |
| 3300031668|Ga0318542_10224455 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
| 3300031680|Ga0318574_10681788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 602 | Open in IMG/M |
| 3300031719|Ga0306917_10420295 | Not Available | 1045 | Open in IMG/M |
| 3300031719|Ga0306917_10798600 | Not Available | 740 | Open in IMG/M |
| 3300031724|Ga0318500_10280684 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 813 | Open in IMG/M |
| 3300031724|Ga0318500_10479621 | Not Available | 624 | Open in IMG/M |
| 3300031744|Ga0306918_11161815 | Not Available | 597 | Open in IMG/M |
| 3300031744|Ga0306918_11209072 | Not Available | 583 | Open in IMG/M |
| 3300031747|Ga0318502_10314999 | Not Available | 922 | Open in IMG/M |
| 3300031768|Ga0318509_10154548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1266 | Open in IMG/M |
| 3300031781|Ga0318547_10083483 | All Organisms → cellular organisms → Bacteria | 1794 | Open in IMG/M |
| 3300031781|Ga0318547_10377417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 868 | Open in IMG/M |
| 3300031797|Ga0318550_10398234 | Not Available | 666 | Open in IMG/M |
| 3300031805|Ga0318497_10639830 | Not Available | 596 | Open in IMG/M |
| 3300031831|Ga0318564_10329784 | Not Available | 672 | Open in IMG/M |
| 3300031833|Ga0310917_10971837 | Not Available | 570 | Open in IMG/M |
| 3300031835|Ga0318517_10029911 | All Organisms → cellular organisms → Bacteria | 2178 | Open in IMG/M |
| 3300031845|Ga0318511_10547103 | Not Available | 537 | Open in IMG/M |
| 3300031860|Ga0318495_10075515 | All Organisms → cellular organisms → Bacteria | 1504 | Open in IMG/M |
| 3300031879|Ga0306919_11247188 | Not Available | 564 | Open in IMG/M |
| 3300031890|Ga0306925_10460529 | All Organisms → cellular organisms → Bacteria | 1358 | Open in IMG/M |
| 3300031893|Ga0318536_10484422 | Not Available | 622 | Open in IMG/M |
| 3300031896|Ga0318551_10600178 | Not Available | 635 | Open in IMG/M |
| 3300031896|Ga0318551_10772346 | Not Available | 558 | Open in IMG/M |
| 3300031910|Ga0306923_10792590 | All Organisms → cellular organisms → Bacteria | 1047 | Open in IMG/M |
| 3300031912|Ga0306921_11376026 | Not Available | 777 | Open in IMG/M |
| 3300031912|Ga0306921_11596762 | Not Available | 709 | Open in IMG/M |
| 3300031947|Ga0310909_10075201 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2664 | Open in IMG/M |
| 3300031954|Ga0306926_10381548 | Not Available | 1741 | Open in IMG/M |
| 3300031954|Ga0306926_10508731 | All Organisms → cellular organisms → Bacteria | 1479 | Open in IMG/M |
| 3300031981|Ga0318531_10584557 | Not Available | 506 | Open in IMG/M |
| 3300032001|Ga0306922_10329742 | All Organisms → cellular organisms → Bacteria | 1638 | Open in IMG/M |
| 3300032001|Ga0306922_12284495 | Not Available | 519 | Open in IMG/M |
| 3300032010|Ga0318569_10010975 | All Organisms → cellular organisms → Bacteria | 3406 | Open in IMG/M |
| 3300032035|Ga0310911_10823577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia bryophila | 536 | Open in IMG/M |
| 3300032039|Ga0318559_10301537 | Not Available | 744 | Open in IMG/M |
| 3300032043|Ga0318556_10018925 | All Organisms → cellular organisms → Bacteria | 3050 | Open in IMG/M |
| 3300032043|Ga0318556_10264663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 898 | Open in IMG/M |
| 3300032059|Ga0318533_10126865 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1789 | Open in IMG/M |
| 3300032066|Ga0318514_10448122 | Not Available | 686 | Open in IMG/M |
| 3300032066|Ga0318514_10718300 | Not Available | 531 | Open in IMG/M |
| 3300032091|Ga0318577_10551617 | Not Available | 548 | Open in IMG/M |
| 3300032261|Ga0306920_102897949 | Not Available | 650 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 43.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 22.55% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 10.78% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.90% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.96% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.96% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.98% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.98% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.98% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.98% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.98% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.98% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.98% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.98% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.98% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.98% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022527 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022720 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0008090_148419701 | 3300005363 | Tropical Rainforest Soil | GTPKPAAIRGAVSALRDGRVCVVGVRVAGRYSAGATAAIMQRTPG* |
| Ga0070699_1009732261 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | DPKQLMAAIREAVAAVRAGKVCVVDVRVATGYAADATAAILQRTPRQE* |
| Ga0066661_106602832 | 3300005554 | Soil | VAAVRAGKVCVVDVHVAAGYDPGAASGIMQQAGRG* |
| Ga0070761_104786371 | 3300005591 | Soil | LVAAITEAVAAVRAGKVCVVDVRVAVGYDPGGAGGIMQR* |
| Ga0066903_1028482002 | 3300005764 | Tropical Forest Soil | MREAVAAVRAGRVCVADVRAAPGYSAGPTAAIMQRTPG* |
| Ga0066903_1033394062 | 3300005764 | Tropical Forest Soil | VAGYLIRLSRALHEAVAAVRAGRVCVVDLRVAPGYSAGATAAIMQRTA* |
| Ga0066903_1039462201 | 3300005764 | Tropical Forest Soil | AVAAVRAGKVCVVDVRVAPGYSAGATAAIMERTPGTAGTAP* |
| Ga0066903_1056880291 | 3300005764 | Tropical Forest Soil | MREAVAAVRTGRVCVADVRVAPGYSAGGTAAILQRTPG* |
| Ga0066903_1081434711 | 3300005764 | Tropical Forest Soil | VAAVRAGKVCVVDVRVAPGYAAGATAAIMEHKPG* |
| Ga0075018_104306252 | 3300006172 | Watersheds | VAAVRAGKVCVVDVHVATGYDPSAASGILQRAPG* |
| Ga0079222_109982961 | 3300006755 | Agricultural Soil | RLLPALNEAVAAVRAGKVCVVDVHVAAGYDPGATSGILQRAG* |
| Ga0066660_106670492 | 3300006800 | Soil | LSEAVAAVRAGKVCVVDVHVAAGYDPGAASGIMQRSG* |
| Ga0126384_102467401 | 3300010046 | Tropical Forest Soil | MREAVAAVRAGRVCVVDVRVAPGYSAGATAAIMQRTPG* |
| Ga0126373_108647052 | 3300010048 | Tropical Forest Soil | MREAVAAVRAGRVCVVDVRVAPGYSAGTTAAIMQRTPG* |
| Ga0126373_124123221 | 3300010048 | Tropical Forest Soil | MREAVAAVRAGRVCVADVRAAPGYSAGATAAIMQRTARVW |
| Ga0127503_101423722 | 3300010154 | Soil | SAMREAVAAVRAGKVCVLDVRVAPGYSAGATAAIMQRTP* |
| Ga0126372_102603191 | 3300010360 | Tropical Forest Soil | LVAAIREGVAAVRSGKVCVVDVRVAAGYAAEATAAILQRASG* |
| Ga0126372_105169751 | 3300010360 | Tropical Forest Soil | VAATRAGKVCVVDIRVAAGYDPGAASGIMQSSAGVAENRG* |
| Ga0126378_130881891 | 3300010361 | Tropical Forest Soil | LVPAMREAVAAVRAGKVCVVDVRVAPGYSASATAAIMQRTPG* |
| Ga0126381_1048662571 | 3300010376 | Tropical Forest Soil | MREAVAAGRAGRVCVADVRAAPGYSAGATAAIMQRTQG* |
| Ga0126383_101908463 | 3300010398 | Tropical Forest Soil | MREAVAAVRAGRVCVVDVRVAPGYSAGATAAILQRTP* |
| Ga0150985_1053901634 | 3300012212 | Avena Fatua Rhizosphere | AVSEAVAAVRAGKVCDVDVRVATGYAADATAAILQRSPR* |
| Ga0150984_1051635262 | 3300012469 | Avena Fatua Rhizosphere | PAMREAVAAVRAGKVCVVDVRVAPGYSAGATAAILQRTSG* |
| Ga0137358_106814071 | 3300012582 | Vadose Zone Soil | VAAVRAGKVCVVDVHVAAGYDPGAATGILQRAPG* |
| Ga0126369_101686791 | 3300012971 | Tropical Forest Soil | MREAIAAVRASRVCVVDVRVAPRYSAGATAAIMQRTP* |
| Ga0182036_105353221 | 3300016270 | Soil | RKLVPAMREAVAAVRAGKVCVVDVRVAPGYSAGATAAIMQRAPE |
| Ga0182036_110078591 | 3300016270 | Soil | MREAVAAVRAGRVCVVDVRVAPGYSAGATAAIMQRTPG |
| Ga0182041_116396331 | 3300016294 | Soil | LTEAVAAVRAGKVCVVDVRVAAGYDPGAASGIMQRSSGA |
| Ga0182033_106051052 | 3300016319 | Soil | MREAVAAVRAGRVCVVDVRVAPGYSTGATAAIMQRNSG |
| Ga0182032_103805391 | 3300016357 | Soil | EAVAAVRAGKVCVLDVRVAPGYSAGATAAIMQRMPE |
| Ga0182032_108665712 | 3300016357 | Soil | VAAVRAGKVCVVDVRVAAGYDPGAASGIMQRSSGG |
| Ga0182034_117892662 | 3300016371 | Soil | DPRKLVSAMREAVAAVRAGRVCVVDVRVAPGYSAGATAAIMQRTPG |
| Ga0182039_109347542 | 3300016422 | Soil | MALREAVAAVRAGKVCVVDVRVAPGYSPGATGAIMQQGR |
| Ga0182039_114393892 | 3300016422 | Soil | EDPRKLVPALREAVAAVRAGRVCVVDVRVAPGYSAGATAAIMQRTPG |
| Ga0187802_102933313 | 3300017822 | Freshwater Sediment | AAITEAVTAVRAGKVCVVDVRVAVGYDPGGAAGIIGR |
| Ga0187782_109701882 | 3300017975 | Tropical Peatland | RKLVSALREAVAAVRSGKVCVVDVRVAPGYSPGATAAIMQQGR |
| Ga0210403_101302802 | 3300020580 | Soil | MREAVAAVRAGKVCVVDVRVAPGYSAGATAAIMDRPP |
| Ga0210401_108069701 | 3300020583 | Soil | RRLVSALGEAVATVRAGKVCVVDVHVAAGYDPGAAGGIMQRAG |
| Ga0210401_109694772 | 3300020583 | Soil | AVAALRAGKVCVVDVRVAPGYSAGATAAIMQRASG |
| Ga0210393_106435131 | 3300021401 | Soil | DDPRRLLPALNEAVAAVRAGKVCVVDVHVAAGYDPGAATGILQRAPG |
| Ga0210393_106832951 | 3300021401 | Soil | DDPHRLLPALNEAVAAVRAGKVCVVDVHVAAGYDSGAATGILQRAPG |
| Ga0210391_114420072 | 3300021433 | Soil | EAVAAVRAGKVCVVDVHVAAGYDPGAATGILQRAPG |
| Ga0126371_103870041 | 3300021560 | Tropical Forest Soil | MREAVAAVHTGRVCVADVRVAPGYSAGGTAAILQRTPG |
| Ga0126371_137192301 | 3300021560 | Tropical Forest Soil | DPRKLLPAMRDAVAAVRAGKVCVVDVRVAPGYSAGATAAIMQQSR |
| Ga0242664_11437271 | 3300022527 | Soil | PAMREAVAAVRAGKVCVVDVRVAPGYSAGATAAIMQRASG |
| Ga0242672_10457262 | 3300022720 | Soil | VDDPRRLLPALNEAVAAVRAGKVCVVDVHVAAGYDPGPTTGILQRAPG |
| Ga0242654_102909702 | 3300022726 | Soil | AVAAVRAGKVCVVDVRVAPGYSAGATAAILQRTPG |
| Ga0207692_107366281 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | NEAVAAVRAGKVCVVDVHVAAGYDPGAATGILQRAPE |
| Ga0209528_10892331 | 3300027610 | Forest Soil | AVAAVRAGKVCVVDVHVATGYDPGAASGILQRAPG |
| Ga0209447_101945241 | 3300027701 | Bog Forest Soil | KKLVAAMTEAVAAVRAGKVCVVDVRVAVGYDPGGAAGIMRR |
| Ga0209656_100088331 | 3300027812 | Bog Forest Soil | VAAVRAGKVCVVDVRVAAGYDPGAASGIMQHASGG |
| Ga0209693_100746311 | 3300027855 | Soil | AVAAVRAGKVCVVDVHVATGYDPGAATGILQRAPG |
| Ga0170824_1248963501 | 3300031231 | Forest Soil | KLVAAMREAVAAVRAGKVCVVDVRVAPGYSAGATAAIMQRTPG |
| Ga0318541_100398233 | 3300031545 | Soil | GVCCMMAAVRAGKVCVVDVRVAPGYSAGATAAIMQHTP |
| Ga0318541_103287931 | 3300031545 | Soil | CMMAAVRAGRVCVVDVRVAPGYSAGATAAIMQRTPG |
| Ga0318538_101881781 | 3300031546 | Soil | DPKQLVGAIGEAVAAVRAGKVCVVDVRVATGYAAEATAAILQRLSG |
| Ga0318538_105306071 | 3300031546 | Soil | REAVAAVRAGKVCVVDVRVAPGYSAGATAAIMQRTP |
| Ga0310915_100415494 | 3300031573 | Soil | ALREAVAAVRAGRVCVVDVRVAPGYSAGATAAIMQRATG |
| Ga0310915_107453902 | 3300031573 | Soil | PALREAVAAVRAGKVCVVDVRVAPGYSEGATAAILRHAPG |
| Ga0318542_102244552 | 3300031668 | Soil | VPALGEAVAAVRAGKVCVVDVRVAPGYSPGATAAIMQQGR |
| Ga0318574_106817881 | 3300031680 | Soil | AIGEAVAAVRAGKVCVVDVRVATGYAAEATAAILQRSSG |
| Ga0306917_104202951 | 3300031719 | Soil | IRDGVAAVRAGKVCVVDVRVATGYAAEATAAILQRSSG |
| Ga0306917_107986001 | 3300031719 | Soil | TEAVAAVRAGKVCVVDVRVAAGYDPGAASGIMQRSSGA |
| Ga0318500_102806842 | 3300031724 | Soil | VAALTEAVAAVRAGKVCVVDVRVAAGYDPGAASGIMQRSSGA |
| Ga0318500_104796212 | 3300031724 | Soil | VEDPRKLVPALREAVAAVRAGRVCVVDVRVAPGYSAGATAAIMQRATG |
| Ga0306918_111618151 | 3300031744 | Soil | PAMREAVAAVRAGKVCVVDVRVAPGYSAGATAAIMQRTSG |
| Ga0306918_112090722 | 3300031744 | Soil | MREAVAAVRAGRVCVVDVRVAPGYSASATAAIMQRTPG |
| Ga0318502_103149992 | 3300031747 | Soil | DPRKLVAAMREAVAAVRAGRVCVVDVRVAPGYSAGATAAIMQRTPG |
| Ga0318509_101545481 | 3300031768 | Soil | SAMREAVAAVRAGRVCVVDVRVAPGYSAGATAAIMQRTPG |
| Ga0318547_100834831 | 3300031781 | Soil | PIEDPKQLVSAIREAVAAVRAGKVCVVDVRVATGYAADATVAILQRSPS |
| Ga0318547_103774173 | 3300031781 | Soil | EAVAAVRAGKVCVVDVRVAAGYDPGAASGIMQRSSGG |
| Ga0318550_103982341 | 3300031797 | Soil | ALTEAVAAVRAGKVCVVDVRVAAGYDPGAASGIMQRSSGA |
| Ga0318497_106398302 | 3300031805 | Soil | GKLVPAMREAVAAVRAGRVCVVDVRVAPGYSAGATAAIMQRTPG |
| Ga0318564_103297842 | 3300031831 | Soil | VEDPRKLVSAMREAVAAVRAGRVCVVDVRVAPGYSAGATAAIMQRTPG |
| Ga0310917_109718371 | 3300031833 | Soil | MREAVAAVRTGRVCVADVRAAPGYSAGATAAIMQRTPG |
| Ga0318517_100299111 | 3300031835 | Soil | LVPAMREAVAAVRSGKVCVVDVRVAPGYSAGATAAIMQHKAD |
| Ga0318511_105471031 | 3300031845 | Soil | PAMREAVAAVRAGKVCVVDVRVAPGYSAGATAAIMQHTP |
| Ga0318495_100755152 | 3300031860 | Soil | QLVGAIREAVAAVRAGKVCVVDVHVAAGYAADATAAILQRTSG |
| Ga0306919_112471881 | 3300031879 | Soil | KLVPALREAVAAVRAGRVCVVDVRVAPGYSAGATAAIMQRATG |
| Ga0306925_104605291 | 3300031890 | Soil | KQAAMREAIAAVRAGRVCVVDVRVAPDYSAGATAAIMQRTP |
| Ga0318536_104844222 | 3300031893 | Soil | DPRTLLSAMREAVAAVRAGRVCVVDVRVAPGYSAGATAAIMQRKVG |
| Ga0318551_106001781 | 3300031896 | Soil | MREAVAAVRAGRVCVVDLRVAPGYSASATAAIMQRKVG |
| Ga0318551_107723462 | 3300031896 | Soil | RKLVSALREAVAAVRAGKVCVVDVRVAPGYSPGATAAIMQHTP |
| Ga0306923_107925903 | 3300031910 | Soil | MREAVAAVRAGRVCVVDVRVAPGYSASATAAIMQR |
| Ga0306921_113760262 | 3300031912 | Soil | DPRKLVPAMREAVAAVRAGKVCVVDVRVAPGYSAGATAAIMQRTSG |
| Ga0306921_115967622 | 3300031912 | Soil | EDPGKLVPAMREAVAAVRAGRVCVVDVRVAPGYSAGATAAIMQRTPR |
| Ga0310909_100752011 | 3300031947 | Soil | AVAAVRAGRVCVVDVRVAPGYSASATAAIMQRTPG |
| Ga0306926_103815481 | 3300031954 | Soil | DPRKLVPALREAVAAVRAGRVCVVDVRVAPGYSAGATAAIMQRATG |
| Ga0306926_105087311 | 3300031954 | Soil | REAVAAVRAGRVCVVDVRVAPGYSAGATAAIMQRTPG |
| Ga0318531_105845571 | 3300031981 | Soil | AMREAVAAVRAGRVCVVDVRVAPGYSAGATAAIMQRTPG |
| Ga0306922_103297422 | 3300032001 | Soil | MREAIAAVRAGRVCVVDVRVAPDYSAGATAAIMQRTP |
| Ga0306922_122844951 | 3300032001 | Soil | MREAVAAVRAGKVCVVDVRVAPGYSAGATAAIMQRAPE |
| Ga0318569_100109751 | 3300032010 | Soil | REAVAAVRAGKVCVVDVCVAPGYSPGATAAIMQHTP |
| Ga0310911_108235771 | 3300032035 | Soil | DPKTLVAAMTEAVAAGRAGKVCVVDVRVAVGYDPGGTAGIMRR |
| Ga0318559_103015371 | 3300032039 | Soil | VPAMREAVAAVRAGKVCVVDVRVAPGYSAGATAAIMQRTSG |
| Ga0318556_100189254 | 3300032043 | Soil | PRKLVPALREAVAAVRAGRVCVVDVRVAPGYSAGATAAIMQRATG |
| Ga0318556_102646631 | 3300032043 | Soil | EDPKQLVAAIRDGVAAVRAGKVCVVDVRVATGYAAEATAAIL |
| Ga0318533_101268651 | 3300032059 | Soil | EAVAAVRAGKVCVVDVRVAPGYSTGATAAIMQHKAD |
| Ga0318514_104481222 | 3300032066 | Soil | KLVPALREAVAAVRAGKVCVVDVRVAPGYSPGATAAIMQHTP |
| Ga0318514_107183001 | 3300032066 | Soil | LVPALREAVAALRAGKVCVVDVRVAPGYSPGATAAIVQQGR |
| Ga0318577_105516172 | 3300032091 | Soil | VEDPRKLVPALREAVAAVRAGRVCVVDVRVAPGYSAGATAAIMQRTPG |
| Ga0306920_1028979491 | 3300032261 | Soil | REAVAAVRAGKVCVVDVRVAPGYSPGATAAIMQHTP |
| ⦗Top⦘ |