


| Basic Information | |
|---|---|
| Family ID | F101795 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 102 |
| Average Sequence Length | 37 residues |
| Representative Sequence | MPHMIPAPGAFAAGVAIFLIVLWDAFEAIILPRRVTRKF |
| Number of Associated Samples | 88 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 82.35 % |
| % of genes near scaffold ends (potentially truncated) | 98.04 % |
| % of genes from short scaffolds (< 2000 bps) | 91.18 % |
| Associated GOLD sequencing projects | 82 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.53 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (76.471 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (34.314 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.392 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.843 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.28% β-sheet: 0.00% Coil/Unstructured: 56.72% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF02566 | OsmC | 75.49 |
| PF09844 | DUF2071 | 11.76 |
| PF04342 | DMT_6 | 3.92 |
| PF12849 | PBP_like_2 | 1.96 |
| PF01040 | UbiA | 0.98 |
| PF00731 | AIRC | 0.98 |
| PF05016 | ParE_toxin | 0.98 |
| PF04055 | Radical_SAM | 0.98 |
| PF07110 | EthD | 0.98 |
| PF07885 | Ion_trans_2 | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 75.49 |
| COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 75.49 |
| COG3169 | Uncharacterized membrane protein, DMT/DUF486 family | Function unknown [S] | 3.92 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 76.47 % |
| Unclassified | root | N/A | 23.53 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002917|JGI25616J43925_10109257 | All Organisms → cellular organisms → Bacteria | 1135 | Open in IMG/M |
| 3300004139|Ga0058897_10753089 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 624 | Open in IMG/M |
| 3300004618|Ga0068963_1220898 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300004631|Ga0058899_12248385 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300005618|Ga0068864_101296838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia rhynchosiae | 728 | Open in IMG/M |
| 3300005944|Ga0066788_10104697 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300006172|Ga0075018_10508178 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300006796|Ga0066665_10510930 | All Organisms → cellular organisms → Bacteria | 983 | Open in IMG/M |
| 3300006796|Ga0066665_10618823 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
| 3300006893|Ga0073928_10034656 | All Organisms → cellular organisms → Bacteria | 4778 | Open in IMG/M |
| 3300006893|Ga0073928_10894571 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300007258|Ga0099793_10390396 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia rhynchosiae | 683 | Open in IMG/M |
| 3300009038|Ga0099829_11287530 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia rhynchosiae | 604 | Open in IMG/M |
| 3300010122|Ga0127488_1027206 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 608 | Open in IMG/M |
| 3300011120|Ga0150983_15621185 | Not Available | 651 | Open in IMG/M |
| 3300011120|Ga0150983_15892273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia rhynchosiae | 537 | Open in IMG/M |
| 3300011270|Ga0137391_11096345 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 644 | Open in IMG/M |
| 3300012199|Ga0137383_10245158 | All Organisms → cellular organisms → Bacteria | 1313 | Open in IMG/M |
| 3300012349|Ga0137387_10380536 | All Organisms → cellular organisms → Bacteria | 1023 | Open in IMG/M |
| 3300012361|Ga0137360_10347380 | All Organisms → cellular organisms → Bacteria | 1241 | Open in IMG/M |
| 3300012410|Ga0134060_1249211 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300012923|Ga0137359_10213355 | All Organisms → cellular organisms → Bacteria | 1724 | Open in IMG/M |
| 3300012925|Ga0137419_10261899 | All Organisms → cellular organisms → Bacteria | 1307 | Open in IMG/M |
| 3300012927|Ga0137416_10135895 | All Organisms → cellular organisms → Bacteria | 1905 | Open in IMG/M |
| 3300015053|Ga0137405_1156924 | All Organisms → cellular organisms → Bacteria | 1459 | Open in IMG/M |
| 3300015167|Ga0167661_1082762 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia rhynchosiae | 579 | Open in IMG/M |
| 3300016357|Ga0182032_11264981 | Not Available | 636 | Open in IMG/M |
| 3300016371|Ga0182034_10491679 | All Organisms → cellular organisms → Bacteria | 1022 | Open in IMG/M |
| 3300016404|Ga0182037_11220928 | Not Available | 661 | Open in IMG/M |
| 3300017933|Ga0187801_10022870 | All Organisms → cellular organisms → Bacteria | 2141 | Open in IMG/M |
| 3300018088|Ga0187771_11037131 | Not Available | 696 | Open in IMG/M |
| 3300018468|Ga0066662_11316357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia rhynchosiae | 741 | Open in IMG/M |
| 3300020199|Ga0179592_10118657 | All Organisms → cellular organisms → Bacteria | 1214 | Open in IMG/M |
| 3300020579|Ga0210407_11447082 | Not Available | 508 | Open in IMG/M |
| 3300020580|Ga0210403_10907689 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia rhynchosiae | 694 | Open in IMG/M |
| 3300021088|Ga0210404_10038956 | All Organisms → cellular organisms → Bacteria | 2177 | Open in IMG/M |
| 3300021168|Ga0210406_10003392 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 17483 | Open in IMG/M |
| 3300021168|Ga0210406_10831959 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300021168|Ga0210406_11260966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia rhynchosiae | 534 | Open in IMG/M |
| 3300021178|Ga0210408_11287808 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia rhynchosiae | 555 | Open in IMG/M |
| 3300021178|Ga0210408_11332842 | Not Available | 543 | Open in IMG/M |
| 3300021403|Ga0210397_11287776 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300021406|Ga0210386_11750886 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300021407|Ga0210383_11043485 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia rhynchosiae | 692 | Open in IMG/M |
| 3300021407|Ga0210383_11591544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia rhynchosiae | 538 | Open in IMG/M |
| 3300021420|Ga0210394_11563959 | Not Available | 556 | Open in IMG/M |
| 3300021432|Ga0210384_10624047 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
| 3300021432|Ga0210384_11279686 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia rhynchosiae | 638 | Open in IMG/M |
| 3300021476|Ga0187846_10302274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia rhynchosiae | 662 | Open in IMG/M |
| 3300021477|Ga0210398_10593543 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
| 3300021478|Ga0210402_10773350 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
| 3300021479|Ga0210410_10007794 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 9254 | Open in IMG/M |
| 3300021559|Ga0210409_10054485 | All Organisms → cellular organisms → Bacteria | 3750 | Open in IMG/M |
| 3300022532|Ga0242655_10165147 | Not Available | 657 | Open in IMG/M |
| 3300022532|Ga0242655_10171916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia rhynchosiae | 647 | Open in IMG/M |
| 3300022533|Ga0242662_10218782 | Not Available | 606 | Open in IMG/M |
| 3300022533|Ga0242662_10219673 | Not Available | 605 | Open in IMG/M |
| 3300022533|Ga0242662_10267655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia rhynchosiae | 560 | Open in IMG/M |
| 3300022726|Ga0242654_10241652 | Not Available | 644 | Open in IMG/M |
| 3300024330|Ga0137417_1427942 | All Organisms → cellular organisms → Bacteria | 4655 | Open in IMG/M |
| 3300026515|Ga0257158_1099903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia rhynchosiae | 573 | Open in IMG/M |
| 3300026548|Ga0209161_10178964 | All Organisms → cellular organisms → Bacteria | 1199 | Open in IMG/M |
| 3300026800|Ga0207742_114331 | Not Available | 591 | Open in IMG/M |
| 3300026909|Ga0207858_1004403 | Not Available | 1456 | Open in IMG/M |
| 3300026909|Ga0207858_1005171 | All Organisms → cellular organisms → Bacteria | 1342 | Open in IMG/M |
| 3300027512|Ga0209179_1098678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia rhynchosiae | 650 | Open in IMG/M |
| 3300027610|Ga0209528_1023486 | All Organisms → cellular organisms → Bacteria | 1358 | Open in IMG/M |
| 3300027643|Ga0209076_1032903 | All Organisms → cellular organisms → Bacteria | 1449 | Open in IMG/M |
| 3300027667|Ga0209009_1198477 | Not Available | 507 | Open in IMG/M |
| 3300027671|Ga0209588_1073764 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia rhynchosiae | 1102 | Open in IMG/M |
| 3300027674|Ga0209118_1003092 | All Organisms → cellular organisms → Bacteria | 6867 | Open in IMG/M |
| 3300027674|Ga0209118_1100452 | Not Available | 818 | Open in IMG/M |
| 3300027729|Ga0209248_10045118 | All Organisms → cellular organisms → Bacteria | 1358 | Open in IMG/M |
| 3300027846|Ga0209180_10202813 | All Organisms → cellular organisms → Bacteria | 1143 | Open in IMG/M |
| 3300027846|Ga0209180_10215263 | All Organisms → cellular organisms → Bacteria | 1107 | Open in IMG/M |
| 3300027862|Ga0209701_10158262 | All Organisms → cellular organisms → Bacteria | 1378 | Open in IMG/M |
| 3300027882|Ga0209590_10016006 | All Organisms → cellular organisms → Bacteria | 3667 | Open in IMG/M |
| 3300027903|Ga0209488_11214558 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia rhynchosiae | 507 | Open in IMG/M |
| 3300027908|Ga0209006_10251028 | All Organisms → cellular organisms → Bacteria | 1522 | Open in IMG/M |
| 3300029944|Ga0311352_10381440 | All Organisms → cellular organisms → Bacteria | 1158 | Open in IMG/M |
| 3300030847|Ga0075405_11287448 | Not Available | 695 | Open in IMG/M |
| 3300030991|Ga0073994_10071212 | All Organisms → cellular organisms → Bacteria | 1168 | Open in IMG/M |
| 3300031027|Ga0302308_10509729 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia rhynchosiae | 706 | Open in IMG/M |
| 3300031590|Ga0307483_1021459 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia rhynchosiae | 635 | Open in IMG/M |
| 3300031719|Ga0306917_11545940 | Not Available | 510 | Open in IMG/M |
| 3300031744|Ga0306918_11425426 | Not Available | 530 | Open in IMG/M |
| 3300031753|Ga0307477_10851362 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia rhynchosiae | 604 | Open in IMG/M |
| 3300031754|Ga0307475_10801240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia rhynchosiae | 747 | Open in IMG/M |
| 3300031771|Ga0318546_10643862 | Not Available | 746 | Open in IMG/M |
| 3300031792|Ga0318529_10147495 | All Organisms → cellular organisms → Bacteria | 1081 | Open in IMG/M |
| 3300031845|Ga0318511_10361614 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia rhynchosiae | 662 | Open in IMG/M |
| 3300031879|Ga0306919_11014660 | Not Available | 634 | Open in IMG/M |
| 3300031912|Ga0306921_10518908 | All Organisms → cellular organisms → Bacteria | 1384 | Open in IMG/M |
| 3300031941|Ga0310912_10723501 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300031942|Ga0310916_11165307 | Not Available | 638 | Open in IMG/M |
| 3300032001|Ga0306922_10897099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia rhynchosiae | 921 | Open in IMG/M |
| 3300032054|Ga0318570_10486682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia rhynchosiae | 563 | Open in IMG/M |
| 3300032076|Ga0306924_12050218 | Not Available | 588 | Open in IMG/M |
| 3300032829|Ga0335070_10565734 | All Organisms → cellular organisms → Bacteria | 1072 | Open in IMG/M |
| 3300032892|Ga0335081_12593894 | Not Available | 520 | Open in IMG/M |
| 3300033158|Ga0335077_10786360 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia rhynchosiae | 970 | Open in IMG/M |
| 3300033289|Ga0310914_11808813 | Not Available | 515 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 34.31% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 19.61% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.82% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 8.82% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.94% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.94% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.94% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.94% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.96% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.96% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.96% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.96% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.98% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.98% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.98% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.98% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.98% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.98% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300004139 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF230 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004618 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 55 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004631 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005944 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300010122 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012410 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015167 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11b, vegetated hydrological feature) | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026800 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 43 (SPAdes) | Environmental | Open in IMG/M |
| 3300026909 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 23 (SPAdes) | Environmental | Open in IMG/M |
| 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030847 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031027 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300031590 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25616J43925_101092571 | 3300002917 | Grasslands Soil | MPHMIPAPGAFIVGVAIFLIVVWDAFEAIILPRRVTRKFR |
| Ga0058897_107530892 | 3300004139 | Forest Soil | MPHMIPFPGAFVAGALIFLIVIWDAFEAIILPRRVTRKFR |
| Ga0068963_12208982 | 3300004618 | Peatlands Soil | MLRMIPAPGVFIAGVLLFLLVAWDAFEAIILPRRVTRKFR |
| Ga0058899_122483851 | 3300004631 | Forest Soil | MPHMIPAPGAFIAGVAIFLIVLWDAFEAIILPRRVTRKFR |
| Ga0068864_1012968382 | 3300005618 | Switchgrass Rhizosphere | MPHMIPFPVPFAAGVAIFMIVLWDAFESVILPRRVTRK |
| Ga0066788_101046971 | 3300005944 | Soil | MIPVPGAFLTGIAIFFIVIWDAFESVILPRRVTRKFR |
| Ga0075018_105081782 | 3300006172 | Watersheds | MPHMIPVPGAFAVGVAIFLIVLWDAFEAIILPRRVTRKF |
| Ga0066665_105109301 | 3300006796 | Soil | MLTSPAAFLTGVAILIIVVWDAFEVIILPRRVTRRFRL |
| Ga0066665_106188233 | 3300006796 | Soil | MPHMIPAPGAFAAGVAIFLIVLWDAFEAIILPRRVTRKF |
| Ga0073928_100346561 | 3300006893 | Iron-Sulfur Acid Spring | MIPAPGAFLAGIAIFLIVVWDAFESIILPRRVTRKFR |
| Ga0073928_108945712 | 3300006893 | Iron-Sulfur Acid Spring | MTSAIPAPGEFLAGVMLFLIVVWDAFEAIILPRRV |
| Ga0099793_103903961 | 3300007258 | Vadose Zone Soil | MTSVIPYPGEFVVGVAAFLIVVWDAFEAIILPRRVT |
| Ga0099829_112875301 | 3300009038 | Vadose Zone Soil | MPHMIPTPGTFAAGVAIFLIVIWDAFEAIILPRRVTRKF |
| Ga0127488_10272061 | 3300010122 | Grasslands Soil | MPHMIPAPGAFAAGVAIFLIVLWDAFEAIILPRRVTRK |
| Ga0150983_156211852 | 3300011120 | Forest Soil | MILAPGVFIAGVVIFLIVLWDAFEAIILPRRVTRK |
| Ga0150983_158922731 | 3300011120 | Forest Soil | MIPAPGAFLAGVAIFLIVLWDAFEAIILPRRVTRK |
| Ga0137391_110963453 | 3300011270 | Vadose Zone Soil | MPHMIPAPGAFVAGVAIFLIVLWEAFEAIILPRRVT |
| Ga0137383_102451583 | 3300012199 | Vadose Zone Soil | MQHMISAPGAFAAGVAIFLIVLWDAFEAIILPRRVTR |
| Ga0137387_103805361 | 3300012349 | Vadose Zone Soil | MPHMIPAPGAFALGVAIFLIVVWDAFEAVILPRRVT |
| Ga0137360_103473801 | 3300012361 | Vadose Zone Soil | MPHMIPAPGAFAAGVALFLIVLWDAFEAIILPRRVTRK |
| Ga0134060_12492113 | 3300012410 | Grasslands Soil | MPHMIPAPGAFAAGVAIFLIVLWDAFEAIILPRRVTR |
| Ga0137359_102133554 | 3300012923 | Vadose Zone Soil | MTSVIPAPGEFLAGVALFLIVVWDAFEAIILPRRV |
| Ga0137419_102618993 | 3300012925 | Vadose Zone Soil | MQHMISAPGAFAAGVAIFLIVLWDAFEAIILPRRVTRKFR |
| Ga0137416_101358955 | 3300012927 | Vadose Zone Soil | MILAPGVFIAGVVIFLIVIWDAFEAIILPRRVTRK |
| Ga0137405_11569243 | 3300015053 | Vadose Zone Soil | MPHMIPAPGAFIAGVATFAIVLWDAFEAIILPRRV |
| Ga0167661_10827621 | 3300015167 | Glacier Forefield Soil | MLPSPAAFIAGVAILIIVVWDAFEAIILPRRVTRQFRLN |
| Ga0182032_112649811 | 3300016357 | Soil | MIPVPGAFVAGVAVFLVVAWDAFEAIILPRRETREFR |
| Ga0182034_104916793 | 3300016371 | Soil | MIPAPGAFIAGLVVFLVVAWDAFEAIILPRRVTRRFRL |
| Ga0182037_112209282 | 3300016404 | Soil | MLRMIPAPGVFVAGVVIFLVVVWDAFEAIILPRRV |
| Ga0187801_100228706 | 3300017933 | Freshwater Sediment | MPHMIPVPGAFAVGVAIFLIVLWDAFEAIILPRRVT |
| Ga0187771_110371312 | 3300018088 | Tropical Peatland | MLRMIPVPGVFLAGIAVFLLVAWDAFEAIILPRRVTRKFRL |
| Ga0066662_113163571 | 3300018468 | Grasslands Soil | MPHMIPAPGAFAAGVAIFLIVVWDAFESIILPRRVTRKFR |
| Ga0179592_101186571 | 3300020199 | Vadose Zone Soil | MPHMIPAPGAFAAGVAIFVIVVWDAFEAIILPRRVTR |
| Ga0210407_114470822 | 3300020579 | Soil | MPHMIPSSGAFAAGAAIFLIVLWDAFEAIILPRRVT |
| Ga0210403_109076892 | 3300020580 | Soil | MPPMIPAPGAFLAGIAIFLIVVWDAFESIILPRRVTRKF |
| Ga0210404_100389561 | 3300021088 | Soil | MPHMLSAPGAFAVGVAIFLIVLWDAFEAIILPRRV |
| Ga0210406_100033921 | 3300021168 | Soil | MILAPGVFIAGVIIFLIVSWDAFEAIILPRRVTRK |
| Ga0210406_108319591 | 3300021168 | Soil | MPHMIPAPGAFIAGVAIFAIVLWDAFEAIILPRRVTRRFR |
| Ga0210406_112609662 | 3300021168 | Soil | MPSVLPAPGAFVAGAALFSIVLWDAFEAIILPRRVTRKFR |
| Ga0210408_112878081 | 3300021178 | Soil | MIPAPGAFAAGLAIFLIVIWDAFEAIILPRRVTRK |
| Ga0210408_113328421 | 3300021178 | Soil | MILAPGVFIAGVVIFLIVLWDAFEAIILPRRVTRKFR |
| Ga0210397_112877761 | 3300021403 | Soil | MQQLIPNPGAFVAGIVIFLVVVWDAFESIILPRRV |
| Ga0210386_117508862 | 3300021406 | Soil | MQHVIPNPGAFVAGIAIFLIVVWDAFEAIILPRRVTR |
| Ga0210383_110434851 | 3300021407 | Soil | MQHVIPVPGAFVAGILIFLIVVWDAFEAIILPRRVT |
| Ga0210383_115915441 | 3300021407 | Soil | MNTVSHMIPEPGVFLLGVALFMFVIWDAFEAIILPRRVTRKFRF |
| Ga0210394_115639591 | 3300021420 | Soil | MLAMIPVPGVFIAGVVLFFVVIWDAFEAIILPRRVTRK |
| Ga0210384_106240471 | 3300021432 | Soil | MILAPGVFIAGLVIFFIVSWDAFEAIILPRRVTRKFRLA |
| Ga0210384_112796862 | 3300021432 | Soil | MPHMIPLPVPFAAGVAIFMIVLWDAFESIILPRRVTRKF |
| Ga0187846_103022741 | 3300021476 | Biofilm | MPHMIPAPGAFAAGVAIFAIVVWDAFEAIILPRRVTRR |
| Ga0210398_105935433 | 3300021477 | Soil | MPHMIPAPAAFIAGVAIFVIVLWDAFEAIILPRRVT |
| Ga0210402_107733503 | 3300021478 | Soil | MILAPGVFIAGVVIFFIVSWDAFEAIILPRRVTRKFRL |
| Ga0210410_1000779411 | 3300021479 | Soil | MILAPGVFIAGILIFLIVSWDAFEAIILPRRVTRKIRLTRI |
| Ga0210409_100544856 | 3300021559 | Soil | MPHMIPFPGAFVAGALIFLIVIWDAFEAIILPRRVTRKIRLT |
| Ga0242655_101651472 | 3300022532 | Soil | MILAPGVFIAGVVIFLIVLWDAFEAIILPRRVTRKFRL |
| Ga0242655_101719161 | 3300022532 | Soil | MPHMIQAPGAFIAGVAIFLIVLWDAFEAIILPRRVTRKFRF |
| Ga0242662_102187822 | 3300022533 | Soil | MILAPGVFIAGVVIFLIVIWDAFEAIILPRRVTRKFR |
| Ga0242662_102196732 | 3300022533 | Soil | MILAPGVFIAGILIFLTVTWDAFEAIILPRRVTRKVR |
| Ga0242662_102676552 | 3300022533 | Soil | MHQMIPAPGAFLAGVAIFLIVLWDAFEAIILPRRVTRKFR |
| Ga0242654_102416521 | 3300022726 | Soil | MILAPGVFIAGVAIFLIVSWDAFEAIILPRRVTRKFR |
| Ga0137417_14279427 | 3300024330 | Vadose Zone Soil | MLTSPAAFLIGVAILIIVVWDAFEVIILPRRVTRVFG |
| Ga0257158_10999032 | 3300026515 | Soil | MIPAPGAFIAGFAIFLIVLWDAFEAIILPRRVTRKF |
| Ga0209161_101789641 | 3300026548 | Soil | MPHMIPFPVPFAAGVAIFMIVLWDAFESIILPRRVT |
| Ga0207742_1143311 | 3300026800 | Tropical Forest Soil | MLRMIPAPGVFIAGVVTFLVVLWDAFEAIILPRRV |
| Ga0207858_10044034 | 3300026909 | Tropical Forest Soil | MLRMIPTPGVFIAGVAIFLVVVWDAFEAIILPRRVT |
| Ga0207858_10051711 | 3300026909 | Tropical Forest Soil | MIPVPGAFIAGVAVFLVVAWDAFEAIILPRRVTRKF |
| Ga0209179_10986782 | 3300027512 | Vadose Zone Soil | MTSVIPYPGEFAAGVAVFLVVVWDAFEAIILPRRV |
| Ga0209528_10234861 | 3300027610 | Forest Soil | MTSVIPYPGEFAAGVALFLIVVWDAFEAIILPRRVTRK |
| Ga0209076_10329034 | 3300027643 | Vadose Zone Soil | MPHMIPAPGAFAAGVAIFVIVVWDAFEAIILPRRVTRKF |
| Ga0209009_11984772 | 3300027667 | Forest Soil | MLAMIPVPGVFIVGVALFFVVIWDAFEAIILPRRVTRKF |
| Ga0209588_10737641 | 3300027671 | Vadose Zone Soil | MTSAISAPGEFLAGVALFLIVVWDAFEAIILPRRVTRKFR |
| Ga0209118_100309211 | 3300027674 | Forest Soil | MPHMISAPGAFAAGVAIFLIVLWDAFEAIILPRRVTRKFR |
| Ga0209118_11004522 | 3300027674 | Forest Soil | MILAPGVFIAGVVIFLIVSWDAFEAIILPRRVTRKFRLARIY |
| Ga0209248_100451183 | 3300027729 | Bog Forest Soil | MNTVPHMIPEPGVFLLGVAMFMFVIWDAFEAIILPRRVTRKF |
| Ga0209180_102028133 | 3300027846 | Vadose Zone Soil | MIPVPGVFAAGVAIFLIVLWDAFEAIILPRRVTRKF |
| Ga0209180_102152631 | 3300027846 | Vadose Zone Soil | MPHMISAPGAFAAGVAIFLIVLWDAFEAIILPRRVTR |
| Ga0209701_101582623 | 3300027862 | Vadose Zone Soil | MPHMIPFLGAFAAGVALFLIVIWDAFEAIILPRRVTRR |
| Ga0209590_100160061 | 3300027882 | Vadose Zone Soil | MPHMIPAPGAFAAGVAIFLIVLWDAFEAIILPRRVTRKFR |
| Ga0209488_112145582 | 3300027903 | Vadose Zone Soil | MTSVIPYPGEFAAGVAVFLVVVWDAFEAIILPRRVTRKFRLT |
| Ga0209006_102510281 | 3300027908 | Forest Soil | MQHLIPAPGAFVAGIVIFLIVVWDAFESIILPRRVT |
| Ga0311352_103814401 | 3300029944 | Palsa | MPHMIPVPGIFILGVVIFLIVVWDAFEAIILPRRVTRKF |
| Ga0075405_112874481 | 3300030847 | Soil | MLRMIPAPGVFIAGVVIFLVVAWDAFEAIILPRRV |
| Ga0073994_100712121 | 3300030991 | Soil | MTSVIPYPGEFAADVALFLIVVWDAFEAIILPRRVTRKFR |
| Ga0302308_105097292 | 3300031027 | Palsa | MNTTPHIIPVPGVFILGVAVFWIVVWDAFEAIILPR |
| Ga0307483_10214592 | 3300031590 | Hardwood Forest Soil | MIPAPGAFVAGVVVFLVVAWDSFEAIILPRRVTRKF |
| Ga0306917_115459401 | 3300031719 | Soil | MIPVPGAFVAGVAVFLVVAWDAFEAIILPRRVTRK |
| Ga0306918_114254262 | 3300031744 | Soil | MIPAPGAFIAGVVVFLVVAWDAFEAIILPRRVTRKFRLT |
| Ga0307477_108513622 | 3300031753 | Hardwood Forest Soil | MATAIPYPGVFAVGVALFLIVVWDAFEAIILPRRVTR |
| Ga0307475_108012403 | 3300031754 | Hardwood Forest Soil | MLSMPPAPGAFVAGAALFLIVLWDAFEAIILPRRV |
| Ga0318546_106438621 | 3300031771 | Soil | MLRMIPVPGIFIAGVAVFLVVVWDAFESVILPRRVTRRFR |
| Ga0318529_101474951 | 3300031792 | Soil | MIPAPGAFIAGVVVFLVVAWDAFEAIILPRRVTRKF |
| Ga0318511_103616141 | 3300031845 | Soil | MPHMIPAPGTFAAGAGLFLIVLWDAFESIILPRRVTRRF |
| Ga0306919_110146602 | 3300031879 | Soil | MIPVPGAFVAGVAVFLVVAWDAFEAIILPRRVTRKFR |
| Ga0306921_105189081 | 3300031912 | Soil | MLGMIPAPGVFLCGVAIFLIVLWDAFEAIILPRRVTRRF |
| Ga0310912_107235013 | 3300031941 | Soil | MLTSPAAFFLGVAILVVVVWDAFEVIILPRRVTRRF |
| Ga0310916_111653071 | 3300031942 | Soil | MIPAPGAFIAGLVVFLVVAWDAFEAIILPRRVTRRF |
| Ga0306922_108970993 | 3300032001 | Soil | MILAPGVFVAGIAIFLFVIWDAFEAIILPRRVTRKFRLARF |
| Ga0318570_104866821 | 3300032054 | Soil | MPHMIPAPGTFAAGVAVFLIVLWDAFESIILPRRVTRRF |
| Ga0306924_120502181 | 3300032076 | Soil | MIPVPGVFLCGVVLFLVVLWDAFEAIILPRRVTRKF |
| Ga0335070_105657341 | 3300032829 | Soil | MLRMIPVPGVFLAGIAVFLVVAWDAFEAIILPRRVTRR |
| Ga0335081_125938941 | 3300032892 | Soil | MILRPGVFLAGVAIFYLVAWDAFEAIILPRRVTRKIR |
| Ga0335077_107863601 | 3300033158 | Soil | MHGMIPHPLVFAAGFAIFVIVLWDAFESIILPRRVTR |
| Ga0310914_118088131 | 3300033289 | Soil | MIPVPGAFVAGVAVFLVVAWDAFEAIILPRRVTRKFRL |
| ⦗Top⦘ |