


| Basic Information | |
|---|---|
| Family ID | F101759 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 102 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MRTGNLAAVMKTMGHRDVKTAMHYQHPELDVVRAALDYGAESETAEMRA |
| Number of Associated Samples | 84 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 63.16 % |
| % of genes near scaffold ends (potentially truncated) | 10.78 % |
| % of genes from short scaffolds (< 2000 bps) | 7.84 % |
| Associated GOLD sequencing projects | 78 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (81.373 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (25.490 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.255 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.020 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 49.35% β-sheet: 0.00% Coil/Unstructured: 50.65% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF00589 | Phage_integrase | 10.78 |
| PF13620 | CarboxypepD_reg | 3.92 |
| PF07969 | Amidohydro_3 | 2.94 |
| PF01844 | HNH | 1.96 |
| PF13470 | PIN_3 | 0.98 |
| PF00294 | PfkB | 0.98 |
| PF01557 | FAA_hydrolase | 0.98 |
| PF02604 | PhdYeFM_antitox | 0.98 |
| PF07729 | FCD | 0.98 |
| PF03403 | PAF-AH_p_II | 0.98 |
| PF08281 | Sigma70_r4_2 | 0.98 |
| PF00578 | AhpC-TSA | 0.98 |
| PF00892 | EamA | 0.98 |
| PF05015 | HigB-like_toxin | 0.98 |
| PF15937 | PrlF_antitoxin | 0.98 |
| PF00486 | Trans_reg_C | 0.98 |
| PF15780 | ASH | 0.98 |
| PF02586 | SRAP | 0.98 |
| PF02954 | HTH_8 | 0.98 |
| PF12728 | HTH_17 | 0.98 |
| PF00150 | Cellulase | 0.98 |
| PF00144 | Beta-lactamase | 0.98 |
| PF03190 | Thioredox_DsbH | 0.98 |
| PF01381 | HTH_3 | 0.98 |
| PF00593 | TonB_dep_Rec | 0.98 |
| PF02517 | Rce1-like | 0.98 |
| PF07676 | PD40 | 0.98 |
| PF02896 | PEP-utilizers_C | 0.98 |
| PF12681 | Glyoxalase_2 | 0.98 |
| PF10282 | Lactonase | 0.98 |
| PF07638 | Sigma70_ECF | 0.98 |
| PF11535 | Calci_bind_CcbP | 0.98 |
| PF01252 | Peptidase_A8 | 0.98 |
| PF00512 | HisKA | 0.98 |
| PF07470 | Glyco_hydro_88 | 0.98 |
| PF05649 | Peptidase_M13_N | 0.98 |
| PF07883 | Cupin_2 | 0.98 |
| PF00882 | Zn_dep_PLPC | 0.98 |
| PF02899 | Phage_int_SAM_1 | 0.98 |
| PF01425 | Amidase | 0.98 |
| PF04397 | LytTR | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG0597 | Lipoprotein signal peptidase | Cell wall/membrane/envelope biogenesis [M] | 1.96 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.98 |
| COG1331 | Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains | General function prediction only [R] | 0.98 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.98 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.98 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.98 |
| COG1802 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 0.98 |
| COG2135 | ssDNA abasic site-binding protein YedK/HMCES, SRAP family | Replication, recombination and repair [L] | 0.98 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.98 |
| COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 0.98 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.98 |
| COG2730 | Aryl-phospho-beta-D-glucosidase BglC, GH1 family | Carbohydrate transport and metabolism [G] | 0.98 |
| COG3549 | Plasmid maintenance system killer protein | Defense mechanisms [V] | 0.98 |
| COG3590 | Predicted metalloendopeptidase | Posttranslational modification, protein turnover, chaperones [O] | 0.98 |
| COG3934 | Endo-1,4-beta-mannosidase | Carbohydrate transport and metabolism [G] | 0.98 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.98 |
| COG4188 | Predicted dienelactone hydrolase | General function prediction only [R] | 0.98 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.98 |
| COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 0.98 |
| COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 0.98 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 81.37 % |
| All Organisms | root | All Organisms | 18.63 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005533|Ga0070734_10000245 | All Organisms → cellular organisms → Bacteria | 141206 | Open in IMG/M |
| 3300010360|Ga0126372_10219338 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1603 | Open in IMG/M |
| 3300010360|Ga0126372_12122067 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 610 | Open in IMG/M |
| 3300010376|Ga0126381_100030547 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 6422 | Open in IMG/M |
| 3300012199|Ga0137383_10451306 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 942 | Open in IMG/M |
| 3300020579|Ga0210407_10722775 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 771 | Open in IMG/M |
| 3300020583|Ga0210401_10020642 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6327 | Open in IMG/M |
| 3300021401|Ga0210393_10089198 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2448 | Open in IMG/M |
| 3300021432|Ga0210384_10061846 | All Organisms → cellular organisms → Bacteria | 3383 | Open in IMG/M |
| 3300021560|Ga0126371_10000486 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 32493 | Open in IMG/M |
| 3300021560|Ga0126371_10040705 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4402 | Open in IMG/M |
| 3300022557|Ga0212123_10000028 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 457915 | Open in IMG/M |
| 3300027826|Ga0209060_10000263 | All Organisms → cellular organisms → Bacteria | 114594 | Open in IMG/M |
| 3300028536|Ga0137415_10104258 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2687 | Open in IMG/M |
| 3300031573|Ga0310915_10925989 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 610 | Open in IMG/M |
| 3300031681|Ga0318572_10984840 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300031718|Ga0307474_10000037 | All Organisms → cellular organisms → Bacteria | 104595 | Open in IMG/M |
| 3300031720|Ga0307469_12200913 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 537 | Open in IMG/M |
| 3300031823|Ga0307478_11822939 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 25.49% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.75% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 9.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.84% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.90% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.90% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.92% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.92% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.94% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.96% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.96% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.96% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.96% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.98% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.98% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.98% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.98% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.98% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005890 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_104 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009616 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 | Environmental | Open in IMG/M |
| 3300009640 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014152 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaG | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
| 3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0062386_1005714081 | 3300004152 | Bog Forest Soil | MRTMGHRDVKTAMHYQHPELEVVRAALDYAAPNDIAETRA* |
| Ga0066395_106584972 | 3300004633 | Tropical Forest Soil | MRTENLAAVMKTMGHRDVKTAMHYQHPELEIVRAALDNADVAIAKMSV* |
| Ga0066684_100167601 | 3300005179 | Soil | MRTGNLAAVMKTMGHRDVKTAMHYQHPELDVVRAALDYGAASEPAEMRA* |
| Ga0066388_1012863761 | 3300005332 | Tropical Forest Soil | AVMKTMGHRDVKTAMHYQHPELDVVRAALDYGAASETAEMRA* |
| Ga0066388_1032587541 | 3300005332 | Tropical Forest Soil | VMRTMGHRDVRTAMHYQHPELDVVRAALDFDAPADGSEKKV* |
| Ga0070713_1001373244 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | GNLAAVMRTMGHRDVRTAMHYQHPELEIVRAALDYEAVADATETTL* |
| Ga0070707_1000939661 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VMRTMGHRDVKTAMHYQHPELEVVRAALDYGMPKDIAEMRG* |
| Ga0070698_1011041342 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MRTMGHRDVRTAMHYQHPELELVRAALDYGAVVESNETSVSTE* |
| Ga0070734_10000245113 | 3300005533 | Surface Soil | MRTGNLVAVMRTMGHRHVKTAMHYQHPELETVRAALD* |
| Ga0070697_1017856171 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | LAAVMKTMEHRDVKTAMHYQHPELEVVRAALDYGAASETAEIRT* |
| Ga0070665_1003464413 | 3300005548 | Switchgrass Rhizosphere | MLAMGHKDVKTAMQYQHPEIEIVRATINEGESVTA* |
| Ga0066903_1083769841 | 3300005764 | Tropical Forest Soil | MRTGNLAAVMKTMGHRDVKSAMHYQRPELDVVRAALDWGAESETAETRA* |
| Ga0075285_10115022 | 3300005890 | Rice Paddy Soil | MRTGNLAAVMRTMGHRDVKTAMHYQNPELEVVRAALDYSMPNNIAEI* |
| Ga0070717_100015225 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MGHRDVKTAMHYQHPELDVVRAALDCGAATETAEMRA* |
| Ga0070716_1003062621 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MGHRDVKTAMHYQHPELDVVRAALDCGAATETSEMRA* |
| Ga0070712_1007223032 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MRTGNLAAVMKTMGHRDAKTAMHYQHPELDVVRAALDYRAASETTEMRA* |
| Ga0066665_101308611 | 3300006796 | Soil | MKTMGHRDVKTAMHYQHPEQEIVRAALDYNASVKRAEIIRV* |
| Ga0075433_110030672 | 3300006852 | Populus Rhizosphere | RVLMRTGNLAAVMKTMGHRDVKTAMQYQHPELEVVRSALDYIAESEAVEMRA* |
| Ga0075425_1000415373 | 3300006854 | Populus Rhizosphere | MKTMGHRDVKTAMQYQHPELEVVRSALDYIAESEAVEMRA* |
| Ga0102924_100170211 | 3300007982 | Iron-Sulfur Acid Spring | MKTMGHRDVKTAMHYQHPELDVVHAALDYGAAGEAAEMRR* |
| Ga0099829_100284221 | 3300009038 | Vadose Zone Soil | TMGHRDVKTAMHYQHPELEIVRDALDYNAGTKGAEITV* |
| Ga0116111_10764431 | 3300009616 | Peatland | MRTGNLAAVMKTMGHRDVKTAMHYQHPELGVVRAALDYGATTETAEIRA* |
| Ga0116126_12754901 | 3300009640 | Peatland | MGHRDVKTAMRYQHPELEVVRAALDYGTASETAEM |
| Ga0126374_103574631 | 3300009792 | Tropical Forest Soil | MRTMGHRDVRTAMHYQHPELDVVRAALDFDAPADGSEKKV* |
| Ga0126384_102600851 | 3300010046 | Tropical Forest Soil | TMGHRDVKTAMQYQHPELEVVRAALDYGMPNDVVAVRA* |
| Ga0126373_100064937 | 3300010048 | Tropical Forest Soil | MRTGNLAAVMKTMGHRDVKPAMHFQHPELDVVRAALDYGVASETAEMRA* |
| Ga0126373_1001424214 | 3300010048 | Tropical Forest Soil | MRTGNLAAVMSTMGHRDVKTAMHYQHPEVEVVRVALDYGMPNNIGEMRV* |
| Ga0126373_100326452 | 3300010048 | Tropical Forest Soil | MKTMGHRDVKTAMHYQHPELDVVRAALDYGAESETAEMQV* |
| Ga0126373_100986882 | 3300010048 | Tropical Forest Soil | MGHRDVKTAMHYPHPEVEVVRAALDYGMPNNIGEMRV* |
| Ga0126373_119994942 | 3300010048 | Tropical Forest Soil | MKTMGHRDVKTAMNYQHPELDVVRDALDNGPASEVAEMRA* |
| Ga0126373_120909352 | 3300010048 | Tropical Forest Soil | MRTGNLAAVMKAMGHRDVKTAMNYQHPELDIVRAAPDYTANSAQIRV* |
| Ga0126370_100176798 | 3300010358 | Tropical Forest Soil | GHRDVKTAMHYPHPEVEVVRVALDYGMPNNIGEMRV* |
| Ga0126372_102193381 | 3300010360 | Tropical Forest Soil | MRTGNLAAVMKTMGHSDVKAMHYQHPELDVVRAALD |
| Ga0126372_109403402 | 3300010360 | Tropical Forest Soil | TGNLAAVMRTMGHRDVKTAMHYQHPELEVVRAALDYGMPNDVVAVRA* |
| Ga0126372_121220671 | 3300010360 | Tropical Forest Soil | AVLTKTGNLPAVMKTMGHKDVRAAMHYQHPDLEIVRAL* |
| Ga0126378_101816564 | 3300010361 | Tropical Forest Soil | MRTGNLAAVMRTMGHRDVKTAMHYQHPELEVVRVALDYGMPNDVVAVRA* |
| Ga0126378_123850342 | 3300010361 | Tropical Forest Soil | MKTMGHHDVKTAMHYQHPELEVVRAALDYDVPVDKTEMKGAGKRLAAHSM |
| Ga0126377_110100241 | 3300010362 | Tropical Forest Soil | TGNLAAVMRTMGHRDVRAALHYQHPEVEVVRAALDGMPNNIGEMRV* |
| Ga0126379_102032923 | 3300010366 | Tropical Forest Soil | MRTGNLAAVMRTMGHRNVKTAMQYQHPEIEVVRAGLDYAAPNDIAETRV* |
| Ga0126379_132008121 | 3300010366 | Tropical Forest Soil | GNLAAVMRTMGHRDVRTAMHYQHPELEVVRAALDFDAPADSSEKKV* |
| Ga0126381_1000305474 | 3300010376 | Tropical Forest Soil | MRTGNLAAVMKTMGHSDVKAMHYQHPELDVVRAALDC |
| Ga0126381_1009851281 | 3300010376 | Tropical Forest Soil | GTRVLMRTRNLAAVMKTMGHGDVKTATHCQHPELDVVRAALDYGAANETVEMRE* |
| Ga0136449_1043044841 | 3300010379 | Peatlands Soil | MRTGNLAAVMKTMGHRDVKTAMHYQHPELEIVRAALDYGAATDTTETSV* |
| Ga0126383_100202253 | 3300010398 | Tropical Forest Soil | MRTGNLAAVMKTMGHSDVKAMHYQHPELDVVRAALDCDAPADTTESGLSAKS* |
| Ga0126383_100606732 | 3300010398 | Tropical Forest Soil | MRTGNLAAVMKTMGHRDVKTAMHYQHPELDVVRAALDYGAESETAEMRA* |
| Ga0137388_100881331 | 3300012189 | Vadose Zone Soil | MRTGNLAAVMKTMGHRDVKTAMHYQHPELEIVRAALDYNADAATADIRV* |
| Ga0137383_104513061 | 3300012199 | Vadose Zone Soil | TGNLAAVMKTMGHRDVKTAMHYQHPELEIVRAALDNTPGAPNAEVRV* |
| Ga0137380_116760401 | 3300012206 | Vadose Zone Soil | LAAVMKTMGHRDVRTAMHYQDPELEIVRAALDYNAGAKGAELSV* |
| Ga0137379_111928372 | 3300012209 | Vadose Zone Soil | MRTGNLAAVMKTMGHRDVKTAMHYQHPELEIVRAALDYNASPAAVEI |
| Ga0137384_103379061 | 3300012357 | Vadose Zone Soil | RTMGHRDVKTAMHYQHPELEIVRAALDYGVPNEVAEARV* |
| Ga0137384_111721391 | 3300012357 | Vadose Zone Soil | MRTGNLAAVMKTMGHRDVKTAMHYQHPELEIVRAALDYNASPAAVEISV* |
| Ga0137361_101763654 | 3300012362 | Vadose Zone Soil | MRTGNLAAVMKTMGHRDVKTAMHYQHPELDVVRAALDYNTANETAEMRA* |
| Ga0137390_114687472 | 3300012363 | Vadose Zone Soil | MKTMGHRDVKTAMHYQHPELEIVRAALDYNESVNGAETRV* |
| Ga0137373_112384331 | 3300012532 | Vadose Zone Soil | MRTGNLAAVMKTMGHRDVKTAMHYQHPDLEIVRAALDYSAGAKGAEMTV* |
| Ga0137359_101116563 | 3300012923 | Vadose Zone Soil | MKTMGHRDVKPAMHYQHPELEIVRAALDYGATSVIGET* |
| Ga0126375_108616992 | 3300012948 | Tropical Forest Soil | MRTGNLAAVMRTMGHRDVKTAMQYQHPELEVVRAALDYGMPNDVVAVRA* |
| Ga0126369_136371341 | 3300012971 | Tropical Forest Soil | MGHRDVKTAIDYQHPELEIVRAALDYSAGASNAEMRM* |
| Ga0181533_100491310 | 3300014152 | Bog | MGHRDVKTAMRYQHPELEVVRAALDYGTASETAEMRA* |
| Ga0182038_115424831 | 3300016445 | Soil | YRTRVLMRTGNLAAVMRTMGHRDVKTAMHYQHPELEVVRAALDYGTESSAVEMRV |
| Ga0187802_101469043 | 3300017822 | Freshwater Sediment | MGHRDVKTAMHYQHPELEVVRAALDHGMPNDIAETRV |
| Ga0187818_102459272 | 3300017823 | Freshwater Sediment | MRTGNLAAVMKTMGHRDVKTAMHYQHTELDVVRAALDYDAASETAEI |
| Ga0187817_107564331 | 3300017955 | Freshwater Sediment | MRTMGHRDVRAAMHYQHPELEIVRAALDKSEATDAIETRV |
| Ga0187816_101116291 | 3300017995 | Freshwater Sediment | VMKTMGHRDVKTAMHYQHPELEVVRAALDSGPANETAALRV |
| Ga0187872_100247033 | 3300018017 | Peatland | MGHRDVKTAMRYQHPELEVVRAALDYGTASETAEMRA |
| Ga0187857_104889882 | 3300018026 | Peatland | MRTGNLAAVMKTMGHRDVKTAMHYQHPELGVVRAALDYGATTETAEIRA |
| Ga0187858_102303101 | 3300018057 | Peatland | MRTGNLAAVMKTMGHRDVKTAMHYQHPELGVVRAALYYGATTETAEIRA |
| Ga0187784_100173338 | 3300018062 | Tropical Peatland | MRTMGHRDVKTAMHYQHPELEVVRAALDYGMPNDTAMQE |
| Ga0187769_100025046 | 3300018086 | Tropical Peatland | MKTMGHRDVKTAMHYQHPELEIVRAALDYGEEANTTETGA |
| Ga0187771_100709393 | 3300018088 | Tropical Peatland | VMKTMGHRDVKTAMHYQHPELEIVRAALDYGEEANTTETGA |
| Ga0187771_108498641 | 3300018088 | Tropical Peatland | MKTMGHRDVKTAMHYQHPELDVVRAALDYGAANEPAEMRA |
| Ga0187770_108850771 | 3300018090 | Tropical Peatland | MGHRDVKTAMHYQHPELDVVRAALDWGSASETAELRV |
| Ga0066667_107635692 | 3300018433 | Grasslands Soil | MKTMGHRDVKTAMHYQHPEQEIVRAALDYNASVKRAEIIRV |
| Ga0206352_100027363 | 3300020078 | Corn, Switchgrass And Miscanthus Rhizosphere | MKVMGHKDVRTAMRYQHPELDIVRDALNNQTAVVQ |
| Ga0210407_107227752 | 3300020579 | Soil | MRTGNLAAVMRTMGHRDVKTAMPYQHPELEIVRAAL |
| Ga0210401_100206422 | 3300020583 | Soil | MRTGNLAAVMRTMGHRDVKTAMHYQHPELEIVRAALDTVRQSLK |
| Ga0210393_100891984 | 3300021401 | Soil | MRTGNLAAVMRTMGHRDVKTAMHYQHPELVIVRAALD |
| Ga0210384_100618464 | 3300021432 | Soil | MRTGNLAAVMRTMGHRDVRTAMHYQHPELEIVGAALDYGAPPDSNEPTVLAG |
| Ga0126371_100004864 | 3300021560 | Tropical Forest Soil | MRTGNLAAVMKTMGHRDVKSAMHYQRPELDVVRAALDWGAESETAETRA |
| Ga0126371_100407055 | 3300021560 | Tropical Forest Soil | MRTGNLAAVMKTMGHRDVKTAMHYQHPELEIVRAALDSALVSE |
| Ga0126371_131234561 | 3300021560 | Tropical Forest Soil | MRTGNLAAVMKAMGHRDVKTAMNYQHPELDIVRAAPDYTANSAQIRV |
| Ga0212123_10000028248 | 3300022557 | Iron-Sulfur Acid Spring | MKTMGHRDVKTAMHYQHPELDVVHAALDYGAAGEAAEMRR |
| Ga0207692_101061994 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MRTGNLAAVMKTMGHRDAKTAMHYQHPELDVVRAALDYSAES |
| Ga0207693_102144953 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MGHRDVKTAMHYQHPELDVVRAALDCGAATETAEMRA |
| Ga0207646_100381521 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | NLAAVMRTMGHRDVKTAMHYQHPELEVVRAALDYGMPKDIAEMRG |
| Ga0209154_100036612 | 3300026317 | Soil | MRTGNLAAVMKTMGHRDVKAAMHYQHPELDVVRAALDYGAASETVERRA |
| Ga0209473_10271384 | 3300026330 | Soil | TRVLMRTGNLAAVMKTMGHRDVKTAMHYQHPELDVVRAALDYGAASEPAEMRA |
| Ga0209161_102962011 | 3300026548 | Soil | TGNLAAVMKTMGHRDVKTAMHYQHPELDVVRAALDYGAASEPAEMRA |
| Ga0209060_1000026313 | 3300027826 | Surface Soil | MRTGNLVAVMRTMGHRHVKTAMHYQHPELETVRAALD |
| Ga0209180_102309402 | 3300027846 | Vadose Zone Soil | MKTMGHRDVKTAMHYQHPELEIVRAALDYNESAKGAEMRV |
| Ga0137415_101042585 | 3300028536 | Vadose Zone Soil | MRTGNLAAVMRTMGHRDVKTAMRYQHPELETVRAALRRL |
| Ga0310915_109259891 | 3300031573 | Soil | MRTGNLAAVMKTMGHRDVKTAMHYQHPELDVVRVARITARQ |
| Ga0318572_109848402 | 3300031681 | Soil | MRTGNLAAVMKTMGHRDVKTAMHYQHPELDVVRVAR |
| Ga0307476_1000042330 | 3300031715 | Hardwood Forest Soil | MGHHDVKTAMQYQHPELEIVRAALDYGASSTKSAA |
| Ga0310813_115376401 | 3300031716 | Soil | MGHRDVKIAMHYQHPELDVVRAALDYGTASETGGMRA |
| Ga0307474_1000003798 | 3300031718 | Hardwood Forest Soil | MRIGNLAVVMRTMGHRDVKTATHYQHPELEVVRAALDYGAPNDAAEARA |
| Ga0307474_1000017454 | 3300031718 | Hardwood Forest Soil | MGHRDVKTAMHYQHPELEIVRAALDYGASSTKSAA |
| Ga0307474_100257246 | 3300031718 | Hardwood Forest Soil | MRTGNLSAVMKTMGHRDVKTAMHYQPPELDVARAALDYGTASESAEIQA |
| Ga0307469_122009132 | 3300031720 | Hardwood Forest Soil | MRTGNLAAVMRTMGHRDVKTAMHYQHPELEIVRAALD |
| Ga0307478_118229392 | 3300031823 | Hardwood Forest Soil | MRTGNLAAAMRTMGHRDVKTAMHYQHPELEIVRADARL |
| Ga0310917_107110901 | 3300031833 | Soil | MRTGNLAAVMKTMGHRDVKTAMHYQHPELDVVRAALDYGGAGETAEMRA |
| Ga0310910_110337681 | 3300031946 | Soil | HRDVKTAMHYQHPELEIVRAALDYRAGANSAQIRV |
| Ga0335069_102665692 | 3300032893 | Soil | MRTGNLAAVMKTMGHRDVKTAMHYQHPELDVVRAALDFGAAGETAEMRA |
| ⦗Top⦘ |