


| Basic Information | |
|---|---|
| Family ID | F101757 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 102 |
| Average Sequence Length | 45 residues |
| Representative Sequence | GLPSVDCYRAGVEAWRRTHPDQSAEYAAKQAVAVILAAKVSLRVEE |
| Number of Associated Samples | 82 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 3.41 % |
| % of genes near scaffold ends (potentially truncated) | 79.41 % |
| % of genes from short scaffolds (< 2000 bps) | 82.35 % |
| Associated GOLD sequencing projects | 81 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (60.784 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (27.451 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.314 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (49.020 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 48.65% β-sheet: 0.00% Coil/Unstructured: 51.35% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF00275 | EPSP_synthase | 40.20 |
| PF08281 | Sigma70_r4_2 | 1.96 |
| PF02397 | Bac_transf | 0.98 |
| PF13340 | DUF4096 | 0.98 |
| PF00004 | AAA | 0.98 |
| PF00815 | Histidinol_dh | 0.98 |
| PF00180 | Iso_dh | 0.98 |
| PF13506 | Glyco_transf_21 | 0.98 |
| PF02518 | HATPase_c | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG0141 | Histidinol dehydrogenase | Amino acid transport and metabolism [E] | 0.98 |
| COG2148 | Sugar transferase involved in LPS biosynthesis (colanic, teichoic acid) | Cell wall/membrane/envelope biogenesis [M] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 60.78 % |
| Unclassified | root | N/A | 39.22 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002568|C688J35102_119830455 | Not Available | 787 | Open in IMG/M |
| 3300002568|C688J35102_120771200 | Not Available | 1534 | Open in IMG/M |
| 3300005353|Ga0070669_101165222 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 665 | Open in IMG/M |
| 3300005454|Ga0066687_10060835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1796 | Open in IMG/M |
| 3300005468|Ga0070707_100003062 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 15843 | Open in IMG/M |
| 3300005545|Ga0070695_101313192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 598 | Open in IMG/M |
| 3300005548|Ga0070665_101348887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 723 | Open in IMG/M |
| 3300005563|Ga0068855_102183996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 556 | Open in IMG/M |
| 3300005569|Ga0066705_10761935 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 579 | Open in IMG/M |
| 3300005618|Ga0068864_101740961 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300005891|Ga0075283_1085127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 579 | Open in IMG/M |
| 3300006028|Ga0070717_11006168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 759 | Open in IMG/M |
| 3300006173|Ga0070716_100380214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1009 | Open in IMG/M |
| 3300006237|Ga0097621_101953046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 560 | Open in IMG/M |
| 3300006854|Ga0075425_101252072 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 842 | Open in IMG/M |
| 3300009088|Ga0099830_10517345 | Not Available | 974 | Open in IMG/M |
| 3300009088|Ga0099830_11554717 | Not Available | 551 | Open in IMG/M |
| 3300009089|Ga0099828_10563160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1027 | Open in IMG/M |
| 3300009090|Ga0099827_10879725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 776 | Open in IMG/M |
| 3300009137|Ga0066709_104119509 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300010038|Ga0126315_11269298 | Not Available | 501 | Open in IMG/M |
| 3300010040|Ga0126308_11182671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 541 | Open in IMG/M |
| 3300010045|Ga0126311_11937067 | Not Available | 501 | Open in IMG/M |
| 3300010166|Ga0126306_10555911 | Not Available | 911 | Open in IMG/M |
| 3300010366|Ga0126379_11809605 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 715 | Open in IMG/M |
| 3300010375|Ga0105239_13072608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 544 | Open in IMG/M |
| 3300010376|Ga0126381_100252772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 2389 | Open in IMG/M |
| 3300011271|Ga0137393_10303938 | All Organisms → cellular organisms → Bacteria | 1359 | Open in IMG/M |
| 3300011271|Ga0137393_10501278 | Not Available | 1042 | Open in IMG/M |
| 3300011271|Ga0137393_10642998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 909 | Open in IMG/M |
| 3300011271|Ga0137393_10891100 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300012198|Ga0137364_10707899 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300012199|Ga0137383_10353763 | All Organisms → cellular organisms → Bacteria | 1076 | Open in IMG/M |
| 3300012200|Ga0137382_10602646 | Not Available | 784 | Open in IMG/M |
| 3300012202|Ga0137363_10964756 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300012203|Ga0137399_11653339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 529 | Open in IMG/M |
| 3300012205|Ga0137362_10641793 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
| 3300012206|Ga0137380_10563297 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 999 | Open in IMG/M |
| 3300012206|Ga0137380_10753645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 843 | Open in IMG/M |
| 3300012207|Ga0137381_10288379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1429 | Open in IMG/M |
| 3300012207|Ga0137381_10823907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 804 | Open in IMG/M |
| 3300012208|Ga0137376_10604619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 949 | Open in IMG/M |
| 3300012212|Ga0150985_107746753 | Not Available | 693 | Open in IMG/M |
| 3300012212|Ga0150985_108238556 | Not Available | 639 | Open in IMG/M |
| 3300012212|Ga0150985_110657185 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300012212|Ga0150985_116202673 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 710 | Open in IMG/M |
| 3300012351|Ga0137386_10257406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1255 | Open in IMG/M |
| 3300012360|Ga0137375_11041183 | Not Available | 640 | Open in IMG/M |
| 3300012925|Ga0137419_11115483 | Not Available | 657 | Open in IMG/M |
| 3300012955|Ga0164298_10934259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 634 | Open in IMG/M |
| 3300012975|Ga0134110_10141880 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
| 3300015356|Ga0134073_10225547 | Not Available | 635 | Open in IMG/M |
| 3300015371|Ga0132258_12416085 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288 | 1316 | Open in IMG/M |
| 3300015374|Ga0132255_103622293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 657 | Open in IMG/M |
| 3300018433|Ga0066667_10732864 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300021170|Ga0210400_10480998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1025 | Open in IMG/M |
| 3300021362|Ga0213882_10138387 | Not Available | 995 | Open in IMG/M |
| 3300021384|Ga0213876_10646764 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300021432|Ga0210384_10304119 | Not Available | 1436 | Open in IMG/M |
| 3300021439|Ga0213879_10149411 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300021560|Ga0126371_10820193 | Not Available | 1076 | Open in IMG/M |
| 3300021560|Ga0126371_12317858 | Not Available | 649 | Open in IMG/M |
| 3300021560|Ga0126371_13903628 | Not Available | 502 | Open in IMG/M |
| 3300025915|Ga0207693_10646184 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300026078|Ga0207702_10008351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → unclassified Rhizobium → Rhizobium sp. NFR17 | 8740 | Open in IMG/M |
| 3300026508|Ga0257161_1078335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 681 | Open in IMG/M |
| 3300026542|Ga0209805_1108968 | Not Available | 1316 | Open in IMG/M |
| 3300026551|Ga0209648_10639883 | Not Available | 582 | Open in IMG/M |
| 3300026551|Ga0209648_10830547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 505 | Open in IMG/M |
| 3300027884|Ga0209275_10008747 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 4284 | Open in IMG/M |
| 3300028047|Ga0209526_10164640 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1549 | Open in IMG/M |
| 3300028047|Ga0209526_10272967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseicella → unclassified Roseicella → Roseicella sp. DB1501 | 1151 | Open in IMG/M |
| 3300028536|Ga0137415_11067455 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300029636|Ga0222749_10750558 | Not Available | 534 | Open in IMG/M |
| 3300031057|Ga0170834_107071398 | Not Available | 1016 | Open in IMG/M |
| 3300031546|Ga0318538_10353189 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300031708|Ga0310686_107340795 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300031770|Ga0318521_10280177 | Not Available | 978 | Open in IMG/M |
| 3300031823|Ga0307478_10165178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1764 | Open in IMG/M |
| 3300031823|Ga0307478_10889651 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300031893|Ga0318536_10198834 | Not Available | 1020 | Open in IMG/M |
| 3300031938|Ga0308175_101051433 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 901 | Open in IMG/M |
| 3300031938|Ga0308175_101396512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 781 | Open in IMG/M |
| 3300031939|Ga0308174_11880217 | Not Available | 515 | Open in IMG/M |
| 3300032076|Ga0306924_12045158 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae | 589 | Open in IMG/M |
| 3300032090|Ga0318518_10316696 | All Organisms → cellular organisms → Bacteria | 801 | Open in IMG/M |
| 3300032174|Ga0307470_10368240 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
| 3300032174|Ga0307470_11810907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 517 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 27.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.84% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.86% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.90% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 3.92% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.92% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.92% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.92% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 3.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.94% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.94% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.96% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.96% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.98% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.98% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.98% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.98% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.98% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.98% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005891 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_304 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
| 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021439 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03 | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026508 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027383 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| C688J35102_1198304553 | 3300002568 | Soil | GLPLVDCYRAGVDAWLGAHPDQRREHAAPKAVAVILAAKMSLRIDAA* |
| C688J35102_1207712004 | 3300002568 | Soil | GLPLVDCYRAGVDAWLGAHPDQRREHAAPKAVAVILAAKVSLRIDGA* |
| Ga0070669_1011652223 | 3300005353 | Switchgrass Rhizosphere | GQPSVDCYRAGVEAWRRTHPDQSAEYSAKQAVAVILAAKVTLRVEE* |
| Ga0066687_100608351 | 3300005454 | Soil | GAGLPSVDCYRAGVEAWRRTHPDQSAEYAAKQAVAVILAAKVSLRVEE* |
| Ga0070707_10000306219 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | GMQSVDCYRAGVDAWRRAHPDQSAEYAAKQAVAVILAVKVSLRVEE* |
| Ga0070695_1013131923 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | VLQAFEEAREAGMQSVDCYRAGVDAWRRAHPDQSAEYAAKQAVAVILAVKVSLRVEE* |
| Ga0070665_1013488873 | 3300005548 | Switchgrass Rhizosphere | GARRDGLASVDCYRAGVDAWRRTHPDQSAEYAAKQAVAVILAAKVSLRVEE* |
| Ga0068855_1021839962 | 3300005563 | Corn Rhizosphere | LPSVDCYRAGVDAWRRTHPDQSAEYAAKQAVAVILAAKVSLRLEE* |
| Ga0066705_107619353 | 3300005569 | Soil | ETARRSGRPSVECYQAGVAAWRREYPDQSAEYAAKQAVAVILATHAKIRIEE* |
| Ga0068864_1017409611 | 3300005618 | Switchgrass Rhizosphere | EAWRRTHPDQSAEYAAKQAVAVILAAKVSLRVEE* |
| Ga0075283_10851273 | 3300005891 | Rice Paddy Soil | AGVEAWRRTHPDQSSEYAAKQAVAVILAAKVSLRVEG* |
| Ga0070717_110061681 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MRDDRSPVDCYRAGVEAWRRTHPDQSAEYAAKQAVAVILGAKVSLRVEE* |
| Ga0070716_1003802141 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | AGVAAWRREHPDQSAEYAAKQAVAVILATHAKIRIEE* |
| Ga0070765_1010629863 | 3300006176 | Soil | ECYRAGVAAWRRVHPDQSPEYAAKRAVAVILERHVKLRVEE* |
| Ga0097621_1019530461 | 3300006237 | Miscanthus Rhizosphere | QAGQPSVDCYRAGVEAWRRTHPDQSAEYSAKQAVAVILAAKVTLRVEE* |
| Ga0075425_1012520721 | 3300006854 | Populus Rhizosphere | AVLDAFEAAREEGLPAVECYRAGVAAWRRIHRDQSAEYAARQAVAVILAAKVSLRVEE* |
| Ga0099830_105173451 | 3300009088 | Vadose Zone Soil | GVEAWRRAHPNQTAAYAAKQAVAVILAAKVRLRFDDA* |
| Ga0099830_115547171 | 3300009088 | Vadose Zone Soil | QDAGLLPVTCYRAGVEAWRHEHPDQRPEYAAKQAVAIILAAKVRLRVDDE* |
| Ga0099828_105631603 | 3300009089 | Vadose Zone Soil | QDAGLPSVDCYRAGVEAWRRAHPNQTAAYAAKQAVAVILAAKVRLRFDDA* |
| Ga0099827_108797252 | 3300009090 | Vadose Zone Soil | VDVIAAFEVAHEAGLPTVRCYLAGVEAWRRAHPDQRLEYAARQAVAVIHAAKIRLRVEDA |
| Ga0066709_1041195091 | 3300009137 | Grasslands Soil | SVDCYRAGVDAWRRTHPDQSAEYAAKQAVAVILATKVSLRVEE* |
| Ga0126315_112692982 | 3300010038 | Serpentine Soil | ALVECYRAGIDAWRRAHPDHAFQYAAQQAVAVILAAKISLHVDV* |
| Ga0126308_111826711 | 3300010040 | Serpentine Soil | PSVDCYRAGVEAWRRRHPDQSSEYAAKQAVAVILAAKVSLRVEE* |
| Ga0126311_119370671 | 3300010045 | Serpentine Soil | EAWRRVHPDQSSEYAAKQAVAVILAAKVSLRVEE* |
| Ga0126306_105559113 | 3300010166 | Serpentine Soil | AGVDAWRRTHPDQSAEYAAKQAVAVILAAKVSLRVDE* |
| Ga0126379_118096052 | 3300010366 | Tropical Forest Soil | SGRPSVECYRAGVEAWRRQHPDQSAEYAAKQAVAVILARHAKIRIEE* |
| Ga0105239_130726083 | 3300010375 | Corn Rhizosphere | VDCYRAGVEAWRRTHPDQSAEYSAKQAVAVILAAKVTLRVEE* |
| Ga0126381_1002527725 | 3300010376 | Tropical Forest Soil | SGRPSVECYRAGVAAWRREHPDQSPEYAAKQAVAVILATHAKIRIEE* |
| Ga0137393_103039381 | 3300011271 | Vadose Zone Soil | VRCRPGGPLPPVICYRAGVEAWQHAHPDQRREYAAKQAVAVILAAKVRLRVDDA* |
| Ga0137393_105012782 | 3300011271 | Vadose Zone Soil | MFWFAPLGVEAWRRAHPGQMPKYAAQKAVAVILAAKIGLRVDDA* |
| Ga0137393_106429983 | 3300011271 | Vadose Zone Soil | AFEAAQEAGLSTVRCYLAGVEAWRRAHPDQRLEYAAHQAVAVIHAAKIRLRVEDA* |
| Ga0137393_108911002 | 3300011271 | Vadose Zone Soil | DAWRRAHPDQSAEYAAKQAVAVILAVKVSLRVEE* |
| Ga0137364_107078993 | 3300012198 | Vadose Zone Soil | YRAGVAAWRREHPDQSAEYAAKQAVAVIIARHVKIRIEE* |
| Ga0137364_113604111 | 3300012198 | Vadose Zone Soil | GVEAWRRVHPDQTLEHAARRAVVVILAVKVSLRIPDD* |
| Ga0137383_103537633 | 3300012199 | Vadose Zone Soil | RAGVEAWRRTHPDQSAEYAAKQAVAVILAAKVSLRVEE* |
| Ga0137382_106026461 | 3300012200 | Vadose Zone Soil | EAWRSAHPDQRPEYAAKQAVAVILAAKVKLRVEDA* |
| Ga0137363_109647561 | 3300012202 | Vadose Zone Soil | AGVAAWRRIHRDHAAEYAARQAVAVILAAKVSLRVDQ* |
| Ga0137399_116533391 | 3300012203 | Vadose Zone Soil | SAREAGMSSVDCYRAGVDAWRRTHPDQSAEYAAKQAVAVILTAKVSLRVEE* |
| Ga0137362_106417933 | 3300012205 | Vadose Zone Soil | CYRAGVEAWRRIHRDHAAEYAARQAVAVILAAKVSLRVDQ* |
| Ga0137380_105632971 | 3300012206 | Vadose Zone Soil | TVRCYLAGVEAWRRAHPDQRPEYAARQAVAVIHAAKVRLRVEDA* |
| Ga0137380_107536452 | 3300012206 | Vadose Zone Soil | GLPTVRCYLAGVEAWRRAHPDQRLEYAAGQAVAVIHAAKIKLRVEDA* |
| Ga0137381_102883791 | 3300012207 | Vadose Zone Soil | VRCYLAGVEAWRRAHPDQRLEYAARQAVAVIHAAKIKLRVEDA* |
| Ga0137381_108239072 | 3300012207 | Vadose Zone Soil | RCYLAGVEAWRRAHPDQRLEYAARQAVAVIHAAKIRLRVEDV* |
| Ga0137376_106046191 | 3300012208 | Vadose Zone Soil | ADCYRAGVVAWSQAHPDQKPAYAAQRAVAVILAAKVSLRVEG* |
| Ga0150985_1077467532 | 3300012212 | Avena Fatua Rhizosphere | AAEQAGLPLVDCYRAGVDAWLGAHPDQGREHAAQKAVAVILAAKVTLRIHGA* |
| Ga0150985_1082385561 | 3300012212 | Avena Fatua Rhizosphere | GLPLVDCYRAGVDAWLGAHPDQRREHAAPKAVAVILVAKMSLRIDAA* |
| Ga0150985_1106571852 | 3300012212 | Avena Fatua Rhizosphere | DCYRAGVEAWRRRHPDQSSEYAAKQAVAVILAAKVSLRVEE* |
| Ga0150985_1162026731 | 3300012212 | Avena Fatua Rhizosphere | AAEQAGLPLVDCYRAGVDAWLGVHPDQRREHAAQKAVAVILVAKVTLRIDGATGSR* |
| Ga0137386_102574061 | 3300012351 | Vadose Zone Soil | FEAAQEAGLPTVRCYLAGVEAWRRAHPDQRLEYAARQAVAVIHAAKIRLRVEDT* |
| Ga0137375_110411832 | 3300012360 | Vadose Zone Soil | DCYRAGVEAWRRAHPDQRREYAAKQAVAVILAAKVRLRVDDA* |
| Ga0137390_103165603 | 3300012363 | Vadose Zone Soil | TVRCYLAAIEAWRRADPDQGPEYAARRAVAVIHAAKVRLRVEDA* |
| Ga0150984_1036208232 | 3300012469 | Avena Fatua Rhizosphere | RGRQRVHPDHAKHYAAQRAVAVILANKVSLRIEDA* |
| Ga0137358_103616412 | 3300012582 | Vadose Zone Soil | YGGGVEAWRRIHPDQAHTYAAQRAVAVILGAKVSLHIEDL* |
| Ga0137358_109469992 | 3300012582 | Vadose Zone Soil | RRLAGAEAWRRVHPDQVHAYAAQRAVEVILAAKASLRIKDA* |
| Ga0137396_103089692 | 3300012918 | Vadose Zone Soil | LPTVRCYLAGVEAWRRVHPDQIPEYAARQAVAVIHAAKVRLRVEDA* |
| Ga0137419_111154831 | 3300012925 | Vadose Zone Soil | AGVEAWRRQHPDQSAEYAAKQAVAVILATHAKVQIEE* |
| Ga0164298_109342592 | 3300012955 | Soil | VEAWRRTHPDQSAEYAAKQAVAVILAAKVSLRVEE* |
| Ga0164301_109065953 | 3300012960 | Soil | AFESARRSGRPSVECYRAGVEAWRREHPDQSAEYAAKQAVAVILARHAKVQIEG* |
| Ga0134110_101418801 | 3300012975 | Grasslands Soil | GLPSVDCYRAGVEAWRRTHPDQSAEYAAKQAVAVILAAKVSLRVEE* |
| Ga0134110_104258161 | 3300012975 | Grasslands Soil | LAGVEAWHRAHPDQSGPYARKQAVAVILGAKVSLRIPDE* |
| Ga0134073_102255473 | 3300015356 | Grasslands Soil | GVDAWRRAHPDQSAEYAAKQAVAVILAAKVSLRIEE* |
| Ga0132258_124160851 | 3300015371 | Arabidopsis Rhizosphere | RAGVDAWRRTHPDQSAEYAAKQAVAVILAAKVSLRVEE* |
| Ga0132255_1036222931 | 3300015374 | Arabidopsis Rhizosphere | EDARQAGQPSVDCYRAGVEAWRRTHPDQSAEYSAKQAVAVILAAKVTLRVEE* |
| Ga0066667_107328643 | 3300018433 | Grasslands Soil | EAREAGMQSVDCYRAGVDAWRRAHPDQSAEYAAKQAVAVILAVKVSLRVEE |
| Ga0210400_104809981 | 3300021170 | Soil | MRDDRSPVDCYRAGVEAWRRAHPDQRPGYAAQKAVAVILTARVSLRVDDA |
| Ga0213882_101383873 | 3300021362 | Exposed Rock | SVECYRAGVAAWRHEHPDQSAEYAAKQAVAVILAAHAKIRIEE |
| Ga0213876_106467641 | 3300021384 | Plant Roots | GVEAWRRTHPDQSAEYSAKQAVAVILAAKVTLRVEE |
| Ga0210384_103041191 | 3300021432 | Soil | RAGVDAWRRTHPDQSAEYAAKQAVAVILAVKVSLRVEE |
| Ga0213879_101494113 | 3300021439 | Bulk Soil | TVECYRAGVAAWRRAHPDHSAEYSAKQAVSAILARYAKLRIEE |
| Ga0126371_108201932 | 3300021560 | Tropical Forest Soil | YRAGVAAWRREHPDQSPEYAAKQAVTVILAAHAKIRIEE |
| Ga0126371_123178583 | 3300021560 | Tropical Forest Soil | YRAGVAAWRREHPDQSAEYAAKQAVAVILAAHAKIRIEE |
| Ga0126371_139036282 | 3300021560 | Tropical Forest Soil | SARRAGRASVECYIAGVQAWRRQHPDQSAEYAAKRAVSVILATHAKLRIEE |
| Ga0207684_103936382 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | SAGVEAWRRVHPDQTLEYAARRAVAVILAVKVSLRIPDE |
| Ga0207693_106461843 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | GLPSVDCYRAGVEAWRRTHPDQSAEYAAKQAVAVILAAKVSLRVEE |
| Ga0207700_117136572 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MATAVCYRAGVAAWRLAHPDHAATYAGKQAVAVIPAAKASFLLRV |
| Ga0207702_100083519 | 3300026078 | Corn Rhizosphere | EAVLDAFEEARGAGLPSVDCYRAGVEAWRRRHPDQSSEYAAKQAVAVILAAKVSMRVEE |
| Ga0257161_10783351 | 3300026508 | Soil | VLKAFESAHRSGRPSVECYRAGVEAWRREHPDQSAEYAAKQAVAVILATHAKVQIEE |
| Ga0209805_11089683 | 3300026542 | Soil | AGVEAWRRTHPDQSAEYAAKQAVAVILAAKVSLRVEE |
| Ga0209648_106398832 | 3300026551 | Grasslands Soil | DAFDAAREEGLASVDCYRAGVDAWRRTHPDQSAEYAAKQAVAVILAAKVSLRIEE |
| Ga0209648_108305471 | 3300026551 | Grasslands Soil | SVDCYRAGVDAWRRAHPDQSAEYAAKQAVAVILAVKVSLRVEE |
| Ga0209213_10507981 | 3300027383 | Forest Soil | VAAWRRLYPDQTRTYAAQRAVAVILAAKVSLRIPDE |
| Ga0209528_11226171 | 3300027610 | Forest Soil | AFDAAQAAHLAPVFCYRAGIEAWRRVHPDQRPKHAAQEAVDVILAAKVRLRVDDA |
| Ga0209275_100087475 | 3300027884 | Soil | VEAWRHQHPDQSAEYAAKQAVAVILATHVKIPIEE |
| Ga0209526_101646401 | 3300028047 | Forest Soil | EAGLQSVDCYRAGVDAWRRAHPDQSAEYAAKQAVAVILAVKVSLRVEE |
| Ga0209526_102729673 | 3300028047 | Forest Soil | PPVFCYRAGVEAWRRAHPDQRPEYAATQAVAVILAAKVRLRVDDA |
| Ga0137415_110674553 | 3300028536 | Vadose Zone Soil | CYRAGVEAWRRTHPDQSAEYAAKQAVAVILTAKVSLRVEE |
| Ga0222749_107505583 | 3300029636 | Soil | VDCYRAGVDAWRRTHPDQSAEYAAKQAVAVILAVKVSLRVEE |
| Ga0170834_1070713984 | 3300031057 | Forest Soil | RPSVECYRAGVEAWRRQHPDQTAEYTAKQAVAVILAAHAKIRIEE |
| Ga0170818_1076660971 | 3300031474 | Forest Soil | RKSTAGCHSAGVEAWRRVHPDQTLEYAARRAVEVILTLKVSLRIPDE |
| Ga0318538_103531891 | 3300031546 | Soil | YRAGVAAWRREHPDQSPEYAAKQAVAVILATHAKIRIEE |
| Ga0310686_1073407953 | 3300031708 | Soil | CYRAGVEAWRRTHRDHASQSAARQAVAVILAAKARLRVDQ |
| Ga0318521_102801773 | 3300031770 | Soil | AGVAAWRREHPDQSPEYAAKQAVAVILATHAKIRIEE |
| Ga0307478_101651781 | 3300031823 | Hardwood Forest Soil | RGGRPSVDCYRAGVDVWRRTHPDQSAEYAAKQAVDVILKAKFGVRRPD |
| Ga0307478_108896511 | 3300031823 | Hardwood Forest Soil | IDAFDAARRSGEASVDCYRAGVEAWRRTHPDQSAEYAAKQAVAVILAAKVSLRVEE |
| Ga0318536_101988341 | 3300031893 | Soil | VECYRAGVVMWRRAHPDQSAEHAASSAVAVILSKHAKIRIEE |
| Ga0308175_1010514331 | 3300031938 | Soil | RPPVDCYRAGVDVWRRHYPDQAAEYAAKQAVAVILNATSTDLLAVE |
| Ga0308175_1013965123 | 3300031938 | Soil | FEEARAAGQQSVDCYRAGVEAWRRMHPDQSAEYAAKQAVAVILAAKVSLRVEE |
| Ga0308174_118802172 | 3300031939 | Soil | CYRAGVEAWRRTHPDQSAEYAAKQAVSVILSAKVSLRVEE |
| Ga0306924_120451581 | 3300032076 | Soil | YRAAVEVWRREHPDQSPEYAAKRAVAVILTAHAKIQIEE |
| Ga0318518_103166961 | 3300032090 | Soil | SVECYRAGVAAWRREHPDQSPEYAAKQAVAVILATHAKIRIEE |
| Ga0307470_103682403 | 3300032174 | Hardwood Forest Soil | AGMQSVDCYRAGVDAWRRAHPDQSAEYAAKQAVAVILAVKVSLRVEE |
| Ga0307470_118109071 | 3300032174 | Hardwood Forest Soil | AVLEAFEEGRDAGLPSVDCYRAGVEAWRRTHPDQSAEYAAKQAVAVILAAKVSLRVEE |
| ⦗Top⦘ |