


| Basic Information | |
|---|---|
| Family ID | F101748 |
| Family Type | Metagenome |
| Number of Sequences | 102 |
| Average Sequence Length | 42 residues |
| Representative Sequence | TRTKGKFMGQEFSTQERATDVFVKRDGRWQCVLTHLTRFTKK |
| Number of Associated Samples | 95 |
| Number of Associated Scaffolds | 102 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 5.88 % |
| % of genes near scaffold ends (potentially truncated) | 92.16 % |
| % of genes from short scaffolds (< 2000 bps) | 89.22 % |
| Associated GOLD sequencing projects | 93 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.059 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (14.706 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.431 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.980 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 47.14% Coil/Unstructured: 52.86% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 102 Family Scaffolds |
|---|---|---|
| PF05697 | Trigger_N | 36.27 |
| PF05698 | Trigger_C | 6.86 |
| PF00583 | Acetyltransf_1 | 1.96 |
| PF00903 | Glyoxalase | 1.96 |
| PF07969 | Amidohydro_3 | 1.96 |
| PF14534 | DUF4440 | 1.96 |
| PF01979 | Amidohydro_1 | 0.98 |
| PF04542 | Sigma70_r2 | 0.98 |
| PF03544 | TonB_C | 0.98 |
| PF02954 | HTH_8 | 0.98 |
| PF00589 | Phage_integrase | 0.98 |
| PF13243 | SQHop_cyclase_C | 0.98 |
| PF13884 | Peptidase_S74 | 0.98 |
| PF02517 | Rce1-like | 0.98 |
| PF13242 | Hydrolase_like | 0.98 |
| PF01872 | RibD_C | 0.98 |
| PF01625 | PMSR | 0.98 |
| PF06197 | DUF998 | 0.98 |
| PF02574 | S-methyl_trans | 0.98 |
| PF13231 | PMT_2 | 0.98 |
| PF01370 | Epimerase | 0.98 |
| PF03734 | YkuD | 0.98 |
| COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
|---|---|---|---|
| COG0544 | FKBP-type peptidyl-prolyl cis-trans isomerase (trigger factor) | Posttranslational modification, protein turnover, chaperones [O] | 43.14 |
| COG0225 | Peptide methionine sulfoxide reductase MsrA | Posttranslational modification, protein turnover, chaperones [O] | 0.98 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.98 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.98 |
| COG0646 | Methionine synthase I (cobalamin-dependent), methyltransferase domain | Amino acid transport and metabolism [E] | 0.98 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.98 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.98 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.98 |
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 0.98 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.98 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.98 |
| COG2040 | Homocysteine/selenocysteine methylase (S-methylmethionine-dependent) | Amino acid transport and metabolism [E] | 0.98 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 0.98 |
| COG3371 | Uncharacterized membrane protein | Function unknown [S] | 0.98 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.98 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.98 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.04 % |
| Unclassified | root | N/A | 1.96 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000363|ICChiseqgaiiFebDRAFT_10647214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Phenylobacterium → unclassified Phenylobacterium → Phenylobacterium sp. | 597 | Open in IMG/M |
| 3300000550|F24TB_10078005 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 739 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10073813 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 861 | Open in IMG/M |
| 3300000709|KanNP_Total_F14TBDRAFT_1023267 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 519 | Open in IMG/M |
| 3300001867|JGI12627J18819_10214879 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 775 | Open in IMG/M |
| 3300003203|JGI25406J46586_10243385 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300004091|Ga0062387_100092597 | All Organisms → cellular organisms → Bacteria | 1602 | Open in IMG/M |
| 3300004463|Ga0063356_104881187 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300004479|Ga0062595_100074485 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1685 | Open in IMG/M |
| 3300005180|Ga0066685_10057372 | All Organisms → cellular organisms → Bacteria | 2516 | Open in IMG/M |
| 3300005447|Ga0066689_10252215 | All Organisms → cellular organisms → Bacteria | 1085 | Open in IMG/M |
| 3300005450|Ga0066682_10069245 | All Organisms → cellular organisms → Bacteria | 2174 | Open in IMG/M |
| 3300005536|Ga0070697_101160919 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300005552|Ga0066701_10196741 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1234 | Open in IMG/M |
| 3300005555|Ga0066692_10570507 | All Organisms → cellular organisms → Archaea | 713 | Open in IMG/M |
| 3300005574|Ga0066694_10139524 | All Organisms → cellular organisms → Bacteria | 1146 | Open in IMG/M |
| 3300005587|Ga0066654_10685665 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300005602|Ga0070762_11047165 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300005764|Ga0066903_102048929 | All Organisms → cellular organisms → Bacteria | 1100 | Open in IMG/M |
| 3300005764|Ga0066903_107023777 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300006028|Ga0070717_12025116 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300006034|Ga0066656_10367662 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
| 3300006034|Ga0066656_10885819 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300006173|Ga0070716_100541722 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300006237|Ga0097621_102423068 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300006797|Ga0066659_10069282 | All Organisms → cellular organisms → Bacteria | 2301 | Open in IMG/M |
| 3300006904|Ga0075424_100200930 | All Organisms → cellular organisms → Bacteria | 2117 | Open in IMG/M |
| 3300007255|Ga0099791_10418447 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300009012|Ga0066710_101384684 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
| 3300009137|Ga0066709_104201329 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300009147|Ga0114129_10922911 | All Organisms → cellular organisms → Bacteria | 1105 | Open in IMG/M |
| 3300010043|Ga0126380_11509632 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 595 | Open in IMG/M |
| 3300010359|Ga0126376_12923444 | Not Available | 527 | Open in IMG/M |
| 3300010361|Ga0126378_12496080 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 590 | Open in IMG/M |
| 3300010362|Ga0126377_13233300 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 526 | Open in IMG/M |
| 3300010376|Ga0126381_101380839 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
| 3300012189|Ga0137388_10597841 | All Organisms → cellular organisms → Bacteria | 1026 | Open in IMG/M |
| 3300012198|Ga0137364_10250125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_16_49_23 | 1310 | Open in IMG/M |
| 3300012199|Ga0137383_10798111 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300012200|Ga0137382_11011860 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 596 | Open in IMG/M |
| 3300012205|Ga0137362_11283730 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 617 | Open in IMG/M |
| 3300012209|Ga0137379_11037418 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300012209|Ga0137379_11823603 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 502 | Open in IMG/M |
| 3300012361|Ga0137360_10630821 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
| 3300012362|Ga0137361_10273676 | All Organisms → cellular organisms → Bacteria | 1542 | Open in IMG/M |
| 3300012363|Ga0137390_10133767 | All Organisms → cellular organisms → Bacteria | 2459 | Open in IMG/M |
| 3300012512|Ga0157327_1024776 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 706 | Open in IMG/M |
| 3300012532|Ga0137373_10931831 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300012918|Ga0137396_11293108 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 507 | Open in IMG/M |
| 3300012941|Ga0162652_100041321 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 727 | Open in IMG/M |
| 3300012971|Ga0126369_10284296 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae | 1646 | Open in IMG/M |
| 3300012971|Ga0126369_13717282 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 500 | Open in IMG/M |
| 3300012975|Ga0134110_10177064 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
| 3300012977|Ga0134087_10028708 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae | 2088 | Open in IMG/M |
| 3300012988|Ga0164306_11335181 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 607 | Open in IMG/M |
| 3300013096|Ga0157307_1144131 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 548 | Open in IMG/M |
| 3300013104|Ga0157370_10237221 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae | 1688 | Open in IMG/M |
| 3300014969|Ga0157376_12430829 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 563 | Open in IMG/M |
| 3300015051|Ga0137414_1124108 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 515 | Open in IMG/M |
| 3300015264|Ga0137403_10224869 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1797 | Open in IMG/M |
| 3300015358|Ga0134089_10375966 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 603 | Open in IMG/M |
| 3300015371|Ga0132258_12248291 | All Organisms → cellular organisms → Bacteria | 1368 | Open in IMG/M |
| 3300015371|Ga0132258_12451456 | All Organisms → cellular organisms → Bacteria | 1306 | Open in IMG/M |
| 3300015374|Ga0132255_102310907 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 820 | Open in IMG/M |
| 3300016422|Ga0182039_11177242 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 692 | Open in IMG/M |
| 3300018061|Ga0184619_10103518 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 1280 | Open in IMG/M |
| 3300018071|Ga0184618_10425081 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 561 | Open in IMG/M |
| 3300018073|Ga0184624_10482279 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 541 | Open in IMG/M |
| 3300018433|Ga0066667_10757624 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 820 | Open in IMG/M |
| 3300018468|Ga0066662_11171155 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 775 | Open in IMG/M |
| 3300019361|Ga0173482_10723064 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 518 | Open in IMG/M |
| 3300019882|Ga0193713_1107751 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300019888|Ga0193751_1139885 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
| 3300020008|Ga0193757_1004016 | All Organisms → cellular organisms → Bacteria | 1281 | Open in IMG/M |
| 3300020018|Ga0193721_1000496 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Candidatus Udaeobacter → Candidatus Udaeobacter copiosus | 11140 | Open in IMG/M |
| 3300020018|Ga0193721_1124938 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300020059|Ga0193745_1122506 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 540 | Open in IMG/M |
| 3300020062|Ga0193724_1063767 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300020581|Ga0210399_10006266 | All Organisms → cellular organisms → Bacteria | 9280 | Open in IMG/M |
| 3300020583|Ga0210401_11400780 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 556 | Open in IMG/M |
| 3300021405|Ga0210387_10243132 | All Organisms → cellular organisms → Bacteria | 1573 | Open in IMG/M |
| 3300021479|Ga0210410_11426674 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300021559|Ga0210409_10270961 | Not Available | 1534 | Open in IMG/M |
| 3300021560|Ga0126371_10085695 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3102 | Open in IMG/M |
| 3300022694|Ga0222623_10049885 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1609 | Open in IMG/M |
| 3300022694|Ga0222623_10304969 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 611 | Open in IMG/M |
| 3300025931|Ga0207644_10400905 | All Organisms → cellular organisms → Bacteria | 1121 | Open in IMG/M |
| 3300025934|Ga0207686_11171214 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300026332|Ga0209803_1112042 | All Organisms → cellular organisms → Bacteria | 1103 | Open in IMG/M |
| 3300026480|Ga0257177_1090151 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 503 | Open in IMG/M |
| 3300026498|Ga0257156_1026225 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1171 | Open in IMG/M |
| 3300028718|Ga0307307_10293169 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300028828|Ga0307312_10006375 | All Organisms → cellular organisms → Bacteria | 6368 | Open in IMG/M |
| 3300031680|Ga0318574_10264767 | All Organisms → cellular organisms → Bacteria | 996 | Open in IMG/M |
| 3300031754|Ga0307475_10672897 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300031954|Ga0306926_11786886 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 698 | Open in IMG/M |
| 3300032001|Ga0306922_10748478 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
| 3300032035|Ga0310911_10004398 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Chthoniobacterales → Chthoniobacteraceae → Chthoniobacter → Chthoniobacter flavus | 6004 | Open in IMG/M |
| 3300032180|Ga0307471_104322747 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300032261|Ga0306920_103862105 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300033551|Ga0247830_11116714 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300034115|Ga0364945_0186213 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 631 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 14.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 11.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 11.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.82% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.84% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.92% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.94% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.94% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.94% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.94% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.96% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.96% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.96% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.96% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.96% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.98% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.98% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.98% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.98% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.98% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.98% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.98% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.98% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.98% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000709 | Amended soil microbial communities from Kansas Great Prairies, USA - Total DNA F1.4 TB amended with BrdU and acetate no abondance | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Host-Associated | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012941 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t4i015 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013096 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020008 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1m2 | Environmental | Open in IMG/M |
| 3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
| 3300020059 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a2 | Environmental | Open in IMG/M |
| 3300020062 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026480 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-B | Environmental | Open in IMG/M |
| 3300026498 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A | Environmental | Open in IMG/M |
| 3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034115 | Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICChiseqgaiiFebDRAFT_106472142 | 3300000363 | Soil | LTTTKGKFMEQDFTSCERATDIFVKQNDRWQCVFTQLTRFTKK* |
| F24TB_100780052 | 3300000550 | Soil | GQDFASCERATDIFVKQADRWQCVFTQLTRFAKK* |
| AF_2010_repII_A1DRAFT_100738132 | 3300000597 | Forest Soil | LTKTKAKFAGQEFTTRERXTDVFVRRGGHWQCVFSQLTTFKKK* |
| KanNP_Total_F14TBDRAFT_10232672 | 3300000709 | Soil | TTKGKFMGQDFASCERATDIFVKQADRWQCVFTQLTRFAKK* |
| JGI12627J18819_102148791 | 3300001867 | Forest Soil | MGQDFTTQERATDVLVKKDGRWQVVFSQLTRFNKK* |
| JGI25406J46586_102433851 | 3300003203 | Tabebuia Heterophylla Rhizosphere | ITAVTRAKGKFMEQEFSTQERATDVFVKRGGRWQCVLTHLTRLAEK* |
| Ga0062387_1000925971 | 3300004091 | Bog Forest Soil | AAVTALTTTKGKYMGQEFTSQERATDMFVKKDGRWQCIVSQLTRFTKK* |
| Ga0063356_1048811872 | 3300004463 | Arabidopsis Thaliana Rhizosphere | TKGKFMGQDFTSCERATDIFVKQNDRWQCVFTQLTRFTKK* |
| Ga0062595_1000744852 | 3300004479 | Soil | MGQDFTTQERATDVLVKRDGRWQVVFSQLTRFNKK* |
| Ga0066685_100573721 | 3300005180 | Soil | NTAVVTGLTATKGKFMGQDFTACERATDIFVKHTDRWQCVFTQLTRFAKK* |
| Ga0066689_102522153 | 3300005447 | Soil | TGLTTSKGKFMGQDFTSCERATDIFVKQSDRWQCVFTQLTRFTKK* |
| Ga0066682_100692453 | 3300005450 | Soil | TTKGKFMGQDFASCERATDIFVKQTDRWQCVFTQLTRFSKK* |
| Ga0070697_1011609191 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | GLTTSKGKFMGQEFTTRERATDIFVNQHGRWQCVFSQLTRVTKK* |
| Ga0066701_101967412 | 3300005552 | Soil | ITALTRTKGEFMGQAFSTQERATDVFVRLDGRWQCVLSQLTRFSKK* |
| Ga0066692_105705071 | 3300005555 | Soil | DYLGKEFKTRERATDVFVKKDGRWQCVLTHLTTFTKKT* |
| Ga0066694_101395242 | 3300005574 | Soil | TKYLGKEFTTHERATDVFVKKDERWQCVLTHLTTLAKKT* |
| Ga0066654_106856652 | 3300005587 | Soil | GVTRTKGKFMGQEFSTQERATDVFVKRDGRWQCVLTHLTRFPEK* |
| Ga0070762_110471651 | 3300005602 | Soil | KFSGQPFTTHERATDVFVKQDGRWHCVLSQLTKVADK* |
| Ga0066903_1020489292 | 3300005764 | Tropical Forest Soil | SKGKFMGHEFTTHERSTDFFVKLDGQWRCVLTQLTGFSKK* |
| Ga0066903_1070237771 | 3300005764 | Tropical Forest Soil | TRTKGKFMGQEFSTQERGTDVFVKRDGRWQCVLTHLTRLPEK* |
| Ga0070717_120251161 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | TAITRTKGKFMGQEFSTQERATDVFVKRDGRWQCVLTHLTRLPNK* |
| Ga0066656_103676621 | 3300006034 | Soil | PTKGKFAGQEFTTRERATDVFVKQGGRWQCAFSQLTKFNKK* |
| Ga0066656_108858191 | 3300006034 | Soil | STRGKFAGQEFATQERATDFFLKRHGRWQCGFSQLTTFKKK* |
| Ga0070716_1005417222 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MRTKGKFVGQEFTTQERATDFFVKQGGRWRCGFSQLTKFSKK* |
| Ga0097621_1024230682 | 3300006237 | Miscanthus Rhizosphere | FAGQPLATEERATDVFVKRDGRWQCVFSQLTTLKKKS* |
| Ga0066659_100692821 | 3300006797 | Soil | TKGKFMGQDFASCERATDIFVKHTDRWQCVFTQLTRFTKR* |
| Ga0075424_1002009303 | 3300006904 | Populus Rhizosphere | TKGKFMGQEFSTEERATDFFVRLDGQWQYVLTQLTRFTKQ* |
| Ga0099791_104184471 | 3300007255 | Vadose Zone Soil | DTAIVTALTTTKGKFAGQEFSTRERATDFFVKQGGRWQCVFSQLTKFNRK* |
| Ga0066710_1013846841 | 3300009012 | Grasslands Soil | FMGQDFASCERATDIFVKQTGCWQCVFTQLTRFTKK |
| Ga0066709_1042013291 | 3300009137 | Grasslands Soil | GQDFTSCERATDIFVKQSDRWQCVFTQLTRSTKN* |
| Ga0114129_109229113 | 3300009147 | Populus Rhizosphere | TALTRTKAKFAEQEFTTQERATDVFVRRAGRWQCVFSQLTKLKAK* |
| Ga0126380_115096321 | 3300010043 | Tropical Forest Soil | RTKGKFMGQEFSTQERATDVFVKRDGRWQCVLTHLTRFSKK* |
| Ga0126376_129234441 | 3300010359 | Tropical Forest Soil | KYMNREFETRERTTDVFVKREGRWQCVITHLTKFSKQ* |
| Ga0126378_124960801 | 3300010361 | Tropical Forest Soil | GKFMGQDFSTQERATDVFVKRDGRWQGVLSHLTRLTKK* |
| Ga0126377_132333001 | 3300010362 | Tropical Forest Soil | KAKFSGQEFTTEERATDVFVKRAGRWQCVFSQLTKSKPK* |
| Ga0126381_1013808391 | 3300010376 | Tropical Forest Soil | FTGQDFSTQERATDVFIKRDGRWQCVISHLTRFAKK* |
| Ga0137388_105978411 | 3300012189 | Vadose Zone Soil | TAVVTGLTTTKGKFMGQDFTSCERATDIFVKQNDRWQCVFTQLTRFTKK* |
| Ga0137364_102501251 | 3300012198 | Vadose Zone Soil | KGKFMGQDFTSCERATDIFVKQNDRWQCVFTQLTRFTKK* |
| Ga0137383_107981112 | 3300012199 | Vadose Zone Soil | VVTGLTTSKGKFMGQDFASCERATDIFVKQADRWQCVFTQLTRFTKK* |
| Ga0137382_110118601 | 3300012200 | Vadose Zone Soil | TKGKFMGQEFSTQERATDVFVKRDGRWQCVLTHLTRFPSK* |
| Ga0137362_112837301 | 3300012205 | Vadose Zone Soil | TAVVTGLTTTKGKFRGQDFASCERATDIFVKRNDRWQCVFTQLTRFTKK* |
| Ga0137379_110374181 | 3300012209 | Vadose Zone Soil | AVVTALTATKGKFAGQEFTTRERATDVFVKQGGRWQCVFSQLTKFNKK* |
| Ga0137379_118236031 | 3300012209 | Vadose Zone Soil | GVTRTKGKFMGQEFSTQERATDVFVKRDGRWQCVLTHLTRFPSK* |
| Ga0137360_106308212 | 3300012361 | Vadose Zone Soil | GQEFTTRERATDVFVKQGGRWQCVFSQLTKFNKK* |
| Ga0137361_102736761 | 3300012362 | Vadose Zone Soil | NTAVVTGLTTTKGKFMGQDFASCERATDIFVKQTGRWQCVFTQLTRFTKK* |
| Ga0137390_101337674 | 3300012363 | Vadose Zone Soil | FVTSVTATKGEFMGQEFSTRERATDVFVKQNGRWQCVFSQLTRFSKTK* |
| Ga0157327_10247761 | 3300012512 | Arabidopsis Rhizosphere | AVTCTKGKFMGQEFSTRERATDVFVKRDGRWQCVVTHLTRVANK* |
| Ga0137373_109318312 | 3300012532 | Vadose Zone Soil | AVVSGLTRTKGKFMGQDFSTQERATDVFVMKNGRWQCVFSQLTRFIK* |
| Ga0137396_112931081 | 3300012918 | Vadose Zone Soil | NTAVVTGLTTTKGTFMGQDFASCERATDIFVKQTDRWQCVFTQLTRFTKK* |
| Ga0162652_1000413211 | 3300012941 | Soil | GQEFSTQERATDVFTKRDGRWQCVLTHLTRFPKK* |
| Ga0126369_102842963 | 3300012971 | Tropical Forest Soil | TAITRTKGKFMGQEFKTEERATDFFVRFDGQWRCVLTQLTGFTKK* |
| Ga0126369_137172821 | 3300012971 | Tropical Forest Soil | STKGKFMGQEFSTRERATDVFVKREGRWQCVLTHLTRLPEK* |
| Ga0134110_101770642 | 3300012975 | Grasslands Soil | LTTTKGKFAGQEFTTRERATDVFVKQGGRWQCVFSQLTKFNKK* |
| Ga0134087_100287083 | 3300012977 | Grasslands Soil | TKGKFAGQEFTTRERATDVFVKQGGRWQCAFSQLTKFNKK* |
| Ga0164306_113351812 | 3300012988 | Soil | KFMGQEFSTQERATDVFVKREGRWQCVLTHLTGFPRK* |
| Ga0157307_11441311 | 3300013096 | Soil | TRTKGKFMGQEFSTQERATDVFVKSDGRWQCVLTHLTRFPKK* |
| Ga0157370_102372211 | 3300013104 | Corn Rhizosphere | GKFMGQEFSTQERATDVFVKRDGRWQCVLTHLTRFPNK* |
| Ga0157376_124308291 | 3300014969 | Miscanthus Rhizosphere | RTKGKFMGHDFSTQERATDVFVKRDGRWQCVLTHLTRFPKK* |
| Ga0137414_11241081 | 3300015051 | Vadose Zone Soil | MGQEFSAQERATDVFVKCDGRWQCVLTHLTRFSKK* |
| Ga0137403_102248691 | 3300015264 | Vadose Zone Soil | TTSKGKFMGQDFTSCERATDIFVKQADCWQCVFTQLTRFTKK* |
| Ga0134089_103759661 | 3300015358 | Grasslands Soil | RTKGKFMGQEFSTQERATDVFVKRDGRWQCVLTHLTRFPTK* |
| Ga0132258_122482912 | 3300015371 | Arabidopsis Rhizosphere | MGQEFSTQERATDVFVKREGQWQCVLTHLTGFPKK* |
| Ga0132258_124514561 | 3300015371 | Arabidopsis Rhizosphere | MGQGFTTHERATDVLARLNGRWLCVFSQLTRVASP* |
| Ga0132255_1023109071 | 3300015374 | Arabidopsis Rhizosphere | LTRTKAKFAGQEVTTQERATDVFVRRAGRWQCVFSQLTKFDAK* |
| Ga0182039_111772422 | 3300016422 | Soil | AGQEFATQERATDFFIKREGRWQCVFSQLTTFKKK |
| Ga0184619_101035181 | 3300018061 | Groundwater Sediment | TAVVTGLTTTKGKFMGQDFASRERATDIFVKQGDRWQCVFTQLTRFTKK |
| Ga0184618_104250812 | 3300018071 | Groundwater Sediment | TELTTTKGKFMGQDFASRERATDVFVKQTDRWQCVFTQLTRFTKK |
| Ga0184624_104822791 | 3300018073 | Groundwater Sediment | MGQEFSTQERATDVFVKRDGRWQCVLTHLTRFTKK |
| Ga0066667_107576241 | 3300018433 | Grasslands Soil | NNALVTVLTTGKGKFMGQDFTSCERATDIFVKQSDRWQCVFTQLTRSTKK |
| Ga0066662_111711552 | 3300018468 | Grasslands Soil | KGEFMGQAFSTQERATDVFVRLDGRWQCVLSQLTRFSKK |
| Ga0173482_107230641 | 3300019361 | Soil | TRTKGKFMGQEFSTQERATDVFVKRDGRWQCVLTHLTRFPNK |
| Ga0193713_11077512 | 3300019882 | Soil | GLTTTKGKFMGQDFASFERATDIFVKQGDRWQCVFTQLTRFTKK |
| Ga0193751_11398852 | 3300019888 | Soil | GKFMGQDFTSCERATDIFVKQNDRWQCVFTQLTRFTKK |
| Ga0193757_10040161 | 3300020008 | Soil | TRTKGKFMGQEFSTQERATDVFVKRDGRWQCVLTHLTRFTKK |
| Ga0193721_10004961 | 3300020018 | Soil | YENTALVTGLTTSKGKFMGQDFTSCERATDIFVKQVDRWQCVFTQLTRFTKK |
| Ga0193721_11249381 | 3300020018 | Soil | TTTKGKFMGQDFASCERATDILVKQTDRWQCVLTQLTRFAKK |
| Ga0193745_11225062 | 3300020059 | Soil | NTAVVTGLTTTKGKFMGQDFASCERATDIFVKQTDRWQCVFTQLTRFTKK |
| Ga0193724_10637671 | 3300020062 | Soil | TGLTTTKGKFMGQDFTSCERATDVFVKQNDRWQCVFTQLTRFAKK |
| Ga0210399_100062667 | 3300020581 | Soil | MGQDFTTQERATDVLVKKDGRWQAVFSQLTRFNKK |
| Ga0210401_114007801 | 3300020583 | Soil | TTKGKFSGQAFTTQERATDVFVKQNGRWLCALSQLTRFTKK |
| Ga0210387_102431322 | 3300021405 | Soil | KGKFMGQEFSTQERATDVFVKCEGRWRCVLTHLTRLPNK |
| Ga0210410_114266742 | 3300021479 | Soil | FMGQEFTTQERATDFFIKQGGRWQCVFSQLTKFDKK |
| Ga0210409_102709611 | 3300021559 | Soil | RTKGKFMGQDFTTQERATDVLVKRDGRWQVVFSQLTRFNKK |
| Ga0126371_100856954 | 3300021560 | Tropical Forest Soil | TSSKAKYMGQEFSTRERATDVFVKLDGKWQCVITHLTTLTKK |
| Ga0222623_100498853 | 3300022694 | Groundwater Sediment | GNTAVVTGLTTTKGKFMGQDFASCERATDIFVKQTDRWQCVFTQLTRFTKK |
| Ga0222623_103049692 | 3300022694 | Groundwater Sediment | NTAVVTGLTTTKGKFMGQDFASCERATDIFVKQADRWQCVFTQLTRFAKK |
| Ga0207644_104009052 | 3300025931 | Switchgrass Rhizosphere | KGKFMGQEFSTHERATDVFVKRDGRWQCVLTHLTRFAKK |
| Ga0207686_111712141 | 3300025934 | Miscanthus Rhizosphere | RSKGKFMGQEFSTQERATDVFVKRDGRWQCVLTHLTRFTK |
| Ga0209803_11120421 | 3300026332 | Soil | TGLTTSKGKFMGQDFTSCERATDIFVKQSDRWQCVFTQLTRFTKK |
| Ga0257177_10901511 | 3300026480 | Soil | NTAMVTALTKTKGKFSGQVFTTQERATDIFVKQNGRWQCALSQLTKFTKK |
| Ga0257156_10262253 | 3300026498 | Soil | VVTGLTTSKGKFMGQDFASCERATDIFVKQNDRWQCVFTQLTRFTKK |
| Ga0307307_102931692 | 3300028718 | Soil | TAVVTGLTTSKGKFMGQDFTSCERATDIFVKQADRWRCVFTQLTRFTKK |
| Ga0307312_100063751 | 3300028828 | Soil | MGQDFTSCERATDIFVKQDDRWRCVFTQLTRFTNRSS |
| Ga0318574_102647672 | 3300031680 | Soil | VRSYGNSAVVTALMKTKGKFAGQEFTTRERATDFFVKQGGCWQCVFSQPTKFNRK |
| Ga0307475_106728972 | 3300031754 | Hardwood Forest Soil | TAVVTGLTTSKGKFMGQDFTSCERATDIFVKQDDRWQCVFTQLTRFTKK |
| Ga0306926_117868862 | 3300031954 | Soil | TAITSTKGKFMGQEFSTRERATDVFVKRDERWECVLTHLTRFTTK |
| Ga0306922_107484782 | 3300032001 | Soil | AVVTTITSTKVRFAGQEFATQERATDFFIKREGRWQCVFSQLTTFKKK |
| Ga0310911_100043981 | 3300032035 | Soil | LRVRSYGNSAVVTALMKTKGKFAGQEFTTRERATDFFVKQGGCWQCVFSQPTKFNRK |
| Ga0307471_1043227472 | 3300032180 | Hardwood Forest Soil | LGQEFTTHERSTDVFVKRGGQWRCVLTQLTGFKKQ |
| Ga0306920_1038621051 | 3300032261 | Soil | KFMGQDFTSCERATDIFVKQADRWQCVFTQLTRFTKK |
| Ga0247830_111167142 | 3300033551 | Soil | MGQDFASCERATDIFVKQTDRWQCVLTQLTRFAKK |
| Ga0364945_0186213_493_600 | 3300034115 | Sediment | MGQDFRTQERATDVFVKRDGRWQCVLTHLTRFPKK |
| ⦗Top⦘ |